data_2EPA # _entry.id 2EPA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2EPA pdb_00002epa 10.2210/pdb2epa/pdb RCSB RCSB026939 ? ? WWPDB D_1000026939 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsi002009741.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2EPA _pdbx_database_status.recvd_initial_deposition_date 2007-03-29 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Izumi, K.' 1 'Hayashi, F.' 2 'Yoshida, M.' 3 'Yokoyama, S.' 4 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 5 # _citation.id primary _citation.title 'Solution structure of the first and second zf-C2H2 domains from human Krueppel-like factor 10' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Izumi, K.' 1 ? primary 'Hayashi, F.' 2 ? primary 'Yoshida, M.' 3 ? primary 'Yokoyama, S.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Krueppel-like factor 10' 8118.066 1 ? ? 'zf-C2H2, UNP residues 359-423' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1, TIEG-1, EGR-alpha ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGPQIDSSRIRSHICSHPGCGKTYFKSSHLKAHTRTHTGEKPFSCSWKGCERRFARSDELSRHRRTH _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGPQIDSSRIRSHICSHPGCGKTYFKSSHLKAHTRTHTGEKPFSCSWKGCERRFARSDELSRHRRTH _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsi002009741.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 PRO n 1 9 GLN n 1 10 ILE n 1 11 ASP n 1 12 SER n 1 13 SER n 1 14 ARG n 1 15 ILE n 1 16 ARG n 1 17 SER n 1 18 HIS n 1 19 ILE n 1 20 CYS n 1 21 SER n 1 22 HIS n 1 23 PRO n 1 24 GLY n 1 25 CYS n 1 26 GLY n 1 27 LYS n 1 28 THR n 1 29 TYR n 1 30 PHE n 1 31 LYS n 1 32 SER n 1 33 SER n 1 34 HIS n 1 35 LEU n 1 36 LYS n 1 37 ALA n 1 38 HIS n 1 39 THR n 1 40 ARG n 1 41 THR n 1 42 HIS n 1 43 THR n 1 44 GLY n 1 45 GLU n 1 46 LYS n 1 47 PRO n 1 48 PHE n 1 49 SER n 1 50 CYS n 1 51 SER n 1 52 TRP n 1 53 LYS n 1 54 GLY n 1 55 CYS n 1 56 GLU n 1 57 ARG n 1 58 ARG n 1 59 PHE n 1 60 ALA n 1 61 ARG n 1 62 SER n 1 63 ASP n 1 64 GLU n 1 65 LEU n 1 66 SER n 1 67 ARG n 1 68 HIS n 1 69 ARG n 1 70 ARG n 1 71 THR n 1 72 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene KLF10 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P060925-12 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code KLF10_HUMAN _struct_ref.pdbx_db_accession Q13118 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code PQIDSSRIRSHICSHPGCGKTYFKSSHLKAHTRTHTGEKPFSCSWKGCERRFARSDELSRHRRTH _struct_ref.pdbx_align_begin 359 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2EPA _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 72 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q13118 _struct_ref_seq.db_align_beg 359 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 423 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 72 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2EPA GLY A 1 ? UNP Q13118 ? ? 'expression tag' 1 1 1 2EPA SER A 2 ? UNP Q13118 ? ? 'expression tag' 2 2 1 2EPA SER A 3 ? UNP Q13118 ? ? 'expression tag' 3 3 1 2EPA GLY A 4 ? UNP Q13118 ? ? 'expression tag' 4 4 1 2EPA SER A 5 ? UNP Q13118 ? ? 'expression tag' 5 5 1 2EPA SER A 6 ? UNP Q13118 ? ? 'expression tag' 6 6 1 2EPA GLY A 7 ? UNP Q13118 ? ? 'expression tag' 7 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.46mM sample; 20mM TrisHCl(pH 7.0); 100mM NaCl; 1mM DTT; 0.02% NaN3; 0.05mM ZnCl2; 1mM IDA; 90% H2O,10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2EPA _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2EPA _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, structures with the lowest energy, target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2EPA _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection VNMR 6.1 Varian 1 processing NMRPipe 20060702 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9743 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2EPA _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2EPA _struct.title 'Solution structure of the first and second zf-C2H2 domains from human Krueppel-like factor 10' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2EPA _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text ;Transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1, TIEG-1, EGR-alpha, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 31 ? THR A 43 ? LYS A 31 THR A 43 1 ? 13 HELX_P HELX_P2 2 ARG A 61 ? ARG A 69 ? ARG A 61 ARG A 69 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 20 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 20 A ZN 300 1_555 ? ? ? ? ? ? ? 2.256 ? ? metalc2 metalc ? ? A CYS 25 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 25 A ZN 300 1_555 ? ? ? ? ? ? ? 2.257 ? ? metalc3 metalc ? ? A HIS 38 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 38 A ZN 300 1_555 ? ? ? ? ? ? ? 2.041 ? ? metalc4 metalc ? ? A HIS 42 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 42 A ZN 300 1_555 ? ? ? ? ? ? ? 2.052 ? ? metalc5 metalc ? ? A CYS 50 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 50 A ZN 400 1_555 ? ? ? ? ? ? ? 2.289 ? ? metalc6 metalc ? ? A CYS 55 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 55 A ZN 400 1_555 ? ? ? ? ? ? ? 2.347 ? ? metalc7 metalc ? ? A HIS 68 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 68 A ZN 400 1_555 ? ? ? ? ? ? ? 2.049 ? ? metalc8 metalc ? ? A HIS 72 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 72 A ZN 400 1_555 ? ? ? ? ? ? ? 2.045 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 HIS A 18 ? ILE A 19 ? HIS A 18 ILE A 19 A 2 THR A 28 ? TYR A 29 ? THR A 28 TYR A 29 B 1 PHE A 48 ? SER A 49 ? PHE A 48 SER A 49 B 2 ARG A 58 ? PHE A 59 ? ARG A 58 PHE A 59 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N HIS A 18 ? N HIS A 18 O TYR A 29 ? O TYR A 29 B 1 2 N PHE A 48 ? N PHE A 48 O PHE A 59 ? O PHE A 59 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 300 ? 4 'BINDING SITE FOR RESIDUE ZN A 300' AC2 Software A ZN 400 ? 4 'BINDING SITE FOR RESIDUE ZN A 400' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 20 ? CYS A 20 . ? 1_555 ? 2 AC1 4 HIS A 22 ? HIS A 22 . ? 1_555 ? 3 AC1 4 CYS A 25 ? CYS A 25 . ? 1_555 ? 4 AC1 4 LYS A 27 ? LYS A 27 . ? 1_555 ? 5 AC2 4 CYS A 50 ? CYS A 50 . ? 1_555 ? 6 AC2 4 TRP A 52 ? TRP A 52 . ? 1_555 ? 7 AC2 4 CYS A 55 ? CYS A 55 . ? 1_555 ? 8 AC2 4 PHE A 59 ? PHE A 59 . ? 1_555 ? # _database_PDB_matrix.entry_id 2EPA _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2EPA _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 ARG 14 14 14 ARG ARG A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 HIS 18 18 18 HIS HIS A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 CYS 20 20 20 CYS CYS A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 HIS 22 22 22 HIS HIS A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 CYS 25 25 25 CYS CYS A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 HIS 34 34 34 HIS HIS A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 HIS 38 38 38 HIS HIS A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 HIS 42 42 42 HIS HIS A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 PHE 48 48 48 PHE PHE A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 CYS 50 50 50 CYS CYS A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 TRP 52 52 52 TRP TRP A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 CYS 55 55 55 CYS CYS A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 HIS 68 68 68 HIS HIS A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 HIS 72 72 72 HIS HIS A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 300 300 ZN ZN A . C 2 ZN 1 400 400 ZN ZN A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 20 ? A CYS 20 ? 1_555 ZN ? B ZN . ? A ZN 300 ? 1_555 SG ? A CYS 25 ? A CYS 25 ? 1_555 107.9 ? 2 SG ? A CYS 20 ? A CYS 20 ? 1_555 ZN ? B ZN . ? A ZN 300 ? 1_555 NE2 ? A HIS 38 ? A HIS 38 ? 1_555 112.9 ? 3 SG ? A CYS 25 ? A CYS 25 ? 1_555 ZN ? B ZN . ? A ZN 300 ? 1_555 NE2 ? A HIS 38 ? A HIS 38 ? 1_555 114.0 ? 4 SG ? A CYS 20 ? A CYS 20 ? 1_555 ZN ? B ZN . ? A ZN 300 ? 1_555 NE2 ? A HIS 42 ? A HIS 42 ? 1_555 111.7 ? 5 SG ? A CYS 25 ? A CYS 25 ? 1_555 ZN ? B ZN . ? A ZN 300 ? 1_555 NE2 ? A HIS 42 ? A HIS 42 ? 1_555 108.5 ? 6 NE2 ? A HIS 38 ? A HIS 38 ? 1_555 ZN ? B ZN . ? A ZN 300 ? 1_555 NE2 ? A HIS 42 ? A HIS 42 ? 1_555 101.7 ? 7 SG ? A CYS 50 ? A CYS 50 ? 1_555 ZN ? C ZN . ? A ZN 400 ? 1_555 SG ? A CYS 55 ? A CYS 55 ? 1_555 112.2 ? 8 SG ? A CYS 50 ? A CYS 50 ? 1_555 ZN ? C ZN . ? A ZN 400 ? 1_555 NE2 ? A HIS 68 ? A HIS 68 ? 1_555 116.9 ? 9 SG ? A CYS 55 ? A CYS 55 ? 1_555 ZN ? C ZN . ? A ZN 400 ? 1_555 NE2 ? A HIS 68 ? A HIS 68 ? 1_555 105.3 ? 10 SG ? A CYS 50 ? A CYS 50 ? 1_555 ZN ? C ZN . ? A ZN 400 ? 1_555 NE2 ? A HIS 72 ? A HIS 72 ? 1_555 112.8 ? 11 SG ? A CYS 55 ? A CYS 55 ? 1_555 ZN ? C ZN . ? A ZN 400 ? 1_555 NE2 ? A HIS 72 ? A HIS 72 ? 1_555 105.5 ? 12 NE2 ? A HIS 68 ? A HIS 68 ? 1_555 ZN ? C ZN . ? A ZN 400 ? 1_555 NE2 ? A HIS 72 ? A HIS 72 ? 1_555 103.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-04-01 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' struct_ref_seq_dif 6 3 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_struct_ref_seq_dif.details' 5 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 6 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 7 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 17 ? ? -97.86 -67.33 2 1 HIS A 18 ? ? -52.02 108.41 3 1 THR A 39 ? ? -38.98 -29.84 4 1 CYS A 55 ? ? -97.96 -64.85 5 2 PRO A 8 ? ? -69.81 -178.70 6 2 SER A 17 ? ? -98.01 -68.06 7 2 HIS A 18 ? ? -52.02 109.51 8 2 CYS A 20 ? ? -52.22 106.36 9 2 SER A 32 ? ? -37.04 -28.64 10 2 HIS A 34 ? ? -35.05 -31.87 11 2 THR A 41 ? ? -36.91 -39.76 12 2 ARG A 69 ? ? -36.43 -39.08 13 3 SER A 17 ? ? -97.84 -66.00 14 3 HIS A 18 ? ? -53.02 104.53 15 3 LYS A 31 ? ? -55.83 106.64 16 3 THR A 39 ? ? -32.22 -39.42 17 4 SER A 17 ? ? -97.55 -70.33 18 4 SER A 32 ? ? -35.44 -31.32 19 4 THR A 39 ? ? -34.02 -32.37 20 4 CYS A 55 ? ? -97.99 -68.45 21 4 HIS A 68 ? ? -92.01 -63.64 22 5 PRO A 8 ? ? -69.79 85.05 23 5 GLN A 9 ? ? -57.68 171.79 24 5 ASP A 11 ? ? -94.48 -66.23 25 5 SER A 17 ? ? -97.74 -68.83 26 5 HIS A 18 ? ? -54.07 107.46 27 5 SER A 32 ? ? -38.41 -27.13 28 5 HIS A 34 ? ? -35.67 -34.04 29 5 SER A 66 ? ? -39.11 -34.35 30 5 ARG A 69 ? ? -38.16 -35.75 31 6 PRO A 8 ? ? -69.77 92.33 32 6 SER A 13 ? ? -34.19 -38.67 33 6 SER A 17 ? ? -97.88 -66.27 34 6 HIS A 18 ? ? -52.01 104.85 35 6 LYS A 31 ? ? -59.25 101.97 36 6 THR A 39 ? ? -37.29 -39.19 37 7 PRO A 8 ? ? -69.78 -179.15 38 7 SER A 17 ? ? -97.92 -71.18 39 7 HIS A 18 ? ? -52.28 105.56 40 7 SER A 32 ? ? -38.85 -25.57 41 8 SER A 17 ? ? -97.94 -68.59 42 8 HIS A 18 ? ? -52.43 103.30 43 8 LYS A 31 ? ? -59.67 102.39 44 8 THR A 39 ? ? -34.44 -33.22 45 8 ARG A 69 ? ? -39.53 -27.20 46 9 PRO A 8 ? ? -69.77 -175.33 47 9 ARG A 14 ? ? -56.78 174.23 48 9 HIS A 18 ? ? -58.64 102.99 49 9 CYS A 25 ? ? -97.90 -63.54 50 9 LYS A 31 ? ? -59.36 102.11 51 10 SER A 17 ? ? -97.97 -67.39 52 10 HIS A 18 ? ? -51.92 108.04 53 10 CYS A 20 ? ? -57.82 108.45 54 10 LYS A 31 ? ? -55.59 102.15 55 10 SER A 32 ? ? -38.65 -29.34 56 11 ILE A 10 ? ? 32.78 34.10 57 11 SER A 17 ? ? -97.89 -68.19 58 11 HIS A 18 ? ? -52.02 105.50 59 11 CYS A 20 ? ? -33.04 -36.29 60 11 LYS A 31 ? ? -57.06 102.14 61 11 THR A 39 ? ? -32.36 -35.49 62 11 THR A 41 ? ? -37.55 -28.00 63 11 GLU A 56 ? ? 39.34 35.78 64 11 ARG A 69 ? ? -32.81 -37.45 65 12 ARG A 16 ? ? -52.41 109.99 66 12 SER A 17 ? ? -97.98 -71.89 67 12 SER A 32 ? ? 34.40 31.17 68 13 CYS A 20 ? ? -33.49 -34.89 69 13 THR A 41 ? ? -38.02 -33.04 70 14 SER A 17 ? ? -97.84 -70.16 71 14 HIS A 18 ? ? -53.71 109.38 72 14 SER A 21 ? ? -36.78 -38.04 73 14 LYS A 27 ? ? -52.05 106.60 74 14 THR A 41 ? ? -39.19 -36.51 75 15 PRO A 8 ? ? -69.82 -176.48 76 15 SER A 17 ? ? -98.03 -65.76 77 15 HIS A 18 ? ? -51.88 105.39 78 15 LYS A 31 ? ? -52.89 101.98 79 15 LYS A 46 ? ? -50.96 105.71 80 15 LYS A 53 ? ? -98.00 -69.38 81 16 SER A 17 ? ? -97.88 -64.84 82 16 HIS A 18 ? ? -53.40 103.91 83 16 PRO A 47 ? ? -69.84 2.93 84 16 GLU A 56 ? ? 36.68 40.81 85 17 PRO A 8 ? ? -69.79 -177.86 86 17 ARG A 14 ? ? -59.41 178.07 87 17 SER A 17 ? ? -97.94 -68.52 88 17 HIS A 18 ? ? -51.96 106.62 89 18 SER A 17 ? ? -97.93 -75.89 90 18 THR A 39 ? ? -34.66 -32.47 91 19 SER A 17 ? ? -97.96 -69.67 92 19 HIS A 18 ? ? -52.32 106.00 93 19 ARG A 70 ? ? -33.68 -35.88 94 20 SER A 17 ? ? -98.00 -69.26 95 20 SER A 32 ? ? -37.82 -32.01 96 20 THR A 41 ? ? -39.89 -29.10 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #