data_2EPT # _entry.id 2EPT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2EPT pdb_00002ept 10.2210/pdb2ept/pdb RCSB RCSB026958 ? ? WWPDB D_1000026958 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-10-02 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-09 4 'Structure model' 1 3 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_ref_seq_dif 7 4 'Structure model' chem_comp_atom 8 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2EPT _pdbx_database_status.recvd_initial_deposition_date 2007-03-30 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsi002014866.4 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tanabe, W.' 1 'Suzuki, S.' 2 'Muto, Y.' 3 'Inoue, M.' 4 'Kigawa, T.' 5 'Terada, T.' 6 'Shirouzu, M.' 7 'Yokoyama, S.' 8 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 9 # _citation.id primary _citation.title 'Solution structure of the first C2H2 type zinc finger domain of Zinc finger protein 32' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tanabe, W.' 1 ? primary 'Suzuki, S.' 2 ? primary 'Muto, Y.' 3 ? primary 'Inoue, M.' 4 ? primary 'Kigawa, T.' 5 ? primary 'Terada, T.' 6 ? primary 'Shirouzu, M.' 7 ? primary 'Yokoyama, S.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Zinc finger protein 32' 4290.651 1 ? ? 'zinc finger domain' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Zinc finger protein KOX30, C2H2-546' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGQRVYECQECGKSFRQKGSLTLHERIHTGSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGQRVYECQECGKSFRQKGSLTLHERIHTGSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsi002014866.4 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 GLN n 1 9 ARG n 1 10 VAL n 1 11 TYR n 1 12 GLU n 1 13 CYS n 1 14 GLN n 1 15 GLU n 1 16 CYS n 1 17 GLY n 1 18 LYS n 1 19 SER n 1 20 PHE n 1 21 ARG n 1 22 GLN n 1 23 LYS n 1 24 GLY n 1 25 SER n 1 26 LEU n 1 27 THR n 1 28 LEU n 1 29 HIS n 1 30 GLU n 1 31 ARG n 1 32 ILE n 1 33 HIS n 1 34 THR n 1 35 GLY n 1 36 SER n 1 37 GLY n 1 38 PRO n 1 39 SER n 1 40 SER n 1 41 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'ZNF32, KOX30' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P061204-04 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'Cell-free protein synthesis' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 67 67 GLY GLY A . n A 1 2 SER 2 68 68 SER SER A . n A 1 3 SER 3 69 69 SER SER A . n A 1 4 GLY 4 70 70 GLY GLY A . n A 1 5 SER 5 71 71 SER SER A . n A 1 6 SER 6 72 72 SER SER A . n A 1 7 GLY 7 73 73 GLY GLY A . n A 1 8 GLN 8 74 74 GLN GLN A . n A 1 9 ARG 9 75 75 ARG ARG A . n A 1 10 VAL 10 76 76 VAL VAL A . n A 1 11 TYR 11 77 77 TYR TYR A . n A 1 12 GLU 12 78 78 GLU GLU A . n A 1 13 CYS 13 79 79 CYS CYS A . n A 1 14 GLN 14 80 80 GLN GLN A . n A 1 15 GLU 15 81 81 GLU GLU A . n A 1 16 CYS 16 82 82 CYS CYS A . n A 1 17 GLY 17 83 83 GLY GLY A . n A 1 18 LYS 18 84 84 LYS LYS A . n A 1 19 SER 19 85 85 SER SER A . n A 1 20 PHE 20 86 86 PHE PHE A . n A 1 21 ARG 21 87 87 ARG ARG A . n A 1 22 GLN 22 88 88 GLN GLN A . n A 1 23 LYS 23 89 89 LYS LYS A . n A 1 24 GLY 24 90 90 GLY GLY A . n A 1 25 SER 25 91 91 SER SER A . n A 1 26 LEU 26 92 92 LEU LEU A . n A 1 27 THR 27 93 93 THR THR A . n A 1 28 LEU 28 94 94 LEU LEU A . n A 1 29 HIS 29 95 95 HIS HIS A . n A 1 30 GLU 30 96 96 GLU GLU A . n A 1 31 ARG 31 97 97 ARG ARG A . n A 1 32 ILE 32 98 98 ILE ILE A . n A 1 33 HIS 33 99 99 HIS HIS A . n A 1 34 THR 34 100 100 THR THR A . n A 1 35 GLY 35 101 101 GLY GLY A . n A 1 36 SER 36 102 102 SER SER A . n A 1 37 GLY 37 103 103 GLY GLY A . n A 1 38 PRO 38 104 104 PRO PRO A . n A 1 39 SER 39 105 105 SER SER A . n A 1 40 SER 40 106 106 SER SER A . n A 1 41 GLY 41 107 107 GLY GLY A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 201 _pdbx_nonpoly_scheme.auth_seq_num 201 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _exptl.entry_id 2EPT _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 2EPT _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2EPT _struct.title 'Solution structure of the first C2H2 type zinc finger domain of Zinc finger protein 32' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2EPT _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text ;C2H2, zinc finger domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ZNF32_HUMAN _struct_ref.pdbx_db_accession P17041 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code QRVYECQECGKSFRQKGSLTLHERIHTG _struct_ref.pdbx_align_begin 74 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2EPT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 35 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P17041 _struct_ref_seq.db_align_beg 74 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 101 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 74 _struct_ref_seq.pdbx_auth_seq_align_end 101 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2EPT GLY A 1 ? UNP P17041 ? ? 'expression tag' 67 1 1 2EPT SER A 2 ? UNP P17041 ? ? 'expression tag' 68 2 1 2EPT SER A 3 ? UNP P17041 ? ? 'expression tag' 69 3 1 2EPT GLY A 4 ? UNP P17041 ? ? 'expression tag' 70 4 1 2EPT SER A 5 ? UNP P17041 ? ? 'expression tag' 71 5 1 2EPT SER A 6 ? UNP P17041 ? ? 'expression tag' 72 6 1 2EPT GLY A 7 ? UNP P17041 ? ? 'expression tag' 73 7 1 2EPT SER A 36 ? UNP P17041 ? ? 'expression tag' 102 8 1 2EPT GLY A 37 ? UNP P17041 ? ? 'expression tag' 103 9 1 2EPT PRO A 38 ? UNP P17041 ? ? 'expression tag' 104 10 1 2EPT SER A 39 ? UNP P17041 ? ? 'expression tag' 105 11 1 2EPT SER A 40 ? UNP P17041 ? ? 'expression tag' 106 12 1 2EPT GLY A 41 ? UNP P17041 ? ? 'expression tag' 107 13 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLN A 22 ? GLU A 30 ? GLN A 88 GLU A 96 1 ? 9 HELX_P HELX_P2 2 ARG A 31 ? HIS A 33 ? ARG A 97 HIS A 99 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 13 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 79 A ZN 201 1_555 ? ? ? ? ? ? ? 2.301 ? ? metalc2 metalc ? ? A CYS 16 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 82 A ZN 201 1_555 ? ? ? ? ? ? ? 2.217 ? ? metalc3 metalc ? ? A HIS 29 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 95 A ZN 201 1_555 ? ? ? ? ? ? ? 2.072 ? ? metalc4 metalc ? ? A HIS 33 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 99 A ZN 201 1_555 ? ? ? ? ? ? ? 1.921 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 13 ? A CYS 79 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 16 ? A CYS 82 ? 1_555 117.5 ? 2 SG ? A CYS 13 ? A CYS 79 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 29 ? A HIS 95 ? 1_555 113.0 ? 3 SG ? A CYS 16 ? A CYS 82 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 29 ? A HIS 95 ? 1_555 105.1 ? 4 SG ? A CYS 13 ? A CYS 79 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 33 ? A HIS 99 ? 1_555 107.3 ? 5 SG ? A CYS 16 ? A CYS 82 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 33 ? A HIS 99 ? 1_555 112.3 ? 6 NE2 ? A HIS 29 ? A HIS 95 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 33 ? A HIS 99 ? 1_555 100.3 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 11 ? GLU A 12 ? TYR A 77 GLU A 78 A 2 SER A 19 ? PHE A 20 ? SER A 85 PHE A 86 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id TYR _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 11 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 77 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id PHE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 20 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id PHE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 86 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 2 TYR A 77 ? ? -69.91 89.18 2 2 GLU A 81 ? ? -130.89 -44.06 3 2 HIS A 99 ? ? -92.72 56.00 4 2 SER A 106 ? ? -66.95 -176.60 5 3 SER A 71 ? ? -174.16 -179.53 6 4 SER A 69 ? ? -108.40 79.06 7 4 TYR A 77 ? ? -67.22 89.73 8 4 GLN A 80 ? ? -97.37 35.03 9 4 GLU A 81 ? ? -133.57 -47.31 10 6 HIS A 99 ? ? -93.72 55.34 11 6 PRO A 104 ? ? -69.72 97.68 12 7 PRO A 104 ? ? -69.72 92.03 13 8 SER A 68 ? ? -170.77 133.37 14 8 TYR A 77 ? ? -59.35 104.87 15 8 SER A 102 ? ? -58.49 171.87 16 9 TYR A 77 ? ? -65.64 97.27 17 9 GLN A 80 ? ? -97.22 30.58 18 10 SER A 72 ? ? -98.58 52.54 19 11 SER A 69 ? ? -100.13 -68.53 20 11 TYR A 77 ? ? -66.56 96.66 21 12 SER A 68 ? ? -100.17 56.81 22 13 SER A 72 ? ? -102.73 64.49 23 14 GLU A 81 ? ? -134.81 -44.48 24 14 SER A 106 ? ? -109.86 -65.66 25 15 SER A 69 ? ? -103.58 -64.96 26 15 TYR A 77 ? ? -69.42 98.66 27 15 HIS A 99 ? ? -91.41 51.69 28 15 PRO A 104 ? ? -69.83 -173.25 29 16 TYR A 77 ? ? -66.82 95.73 30 16 GLU A 81 ? ? -130.81 -48.31 31 17 SER A 72 ? ? -102.07 41.12 32 17 GLN A 80 ? ? -99.84 33.67 33 17 GLU A 81 ? ? -131.67 -48.08 34 18 TYR A 77 ? ? -69.78 89.57 35 18 PRO A 104 ? ? -69.72 -178.44 36 19 TYR A 77 ? ? -67.09 90.91 37 20 GLN A 74 ? ? -123.86 -54.03 38 20 GLU A 81 ? ? -132.31 -48.17 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_nmr_ensemble.entry_id 2EPT _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, structures with the lowest energy, target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2EPT _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.08mM 13C-15N PROTEIN; 20mM d-Tris-HCl(pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O ;0.05mM ZnCl2, 1mM IDA' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_refine.entry_id 2EPT _pdbx_nmr_refine.method 'torsion angle dyanamics, simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20060702 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9820 'Kobayashi, N.' 4 'structure solution' CYANA 2.1 'Guntert, P.' 5 refinement CYANA 2.1 'Guntert, P.' 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ARG N N N N 1 ARG CA C N S 2 ARG C C N N 3 ARG O O N N 4 ARG CB C N N 5 ARG CG C N N 6 ARG CD C N N 7 ARG NE N N N 8 ARG CZ C N N 9 ARG NH1 N N N 10 ARG NH2 N N N 11 ARG OXT O N N 12 ARG H H N N 13 ARG H2 H N N 14 ARG HA H N N 15 ARG HB2 H N N 16 ARG HB3 H N N 17 ARG HG2 H N N 18 ARG HG3 H N N 19 ARG HD2 H N N 20 ARG HD3 H N N 21 ARG HE H N N 22 ARG HH11 H N N 23 ARG HH12 H N N 24 ARG HH21 H N N 25 ARG HH22 H N N 26 ARG HXT H N N 27 CYS N N N N 28 CYS CA C N R 29 CYS C C N N 30 CYS O O N N 31 CYS CB C N N 32 CYS SG S N N 33 CYS OXT O N N 34 CYS H H N N 35 CYS H2 H N N 36 CYS HA H N N 37 CYS HB2 H N N 38 CYS HB3 H N N 39 CYS HG H N N 40 CYS HXT H N N 41 GLN N N N N 42 GLN CA C N S 43 GLN C C N N 44 GLN O O N N 45 GLN CB C N N 46 GLN CG C N N 47 GLN CD C N N 48 GLN OE1 O N N 49 GLN NE2 N N N 50 GLN OXT O N N 51 GLN H H N N 52 GLN H2 H N N 53 GLN HA H N N 54 GLN HB2 H N N 55 GLN HB3 H N N 56 GLN HG2 H N N 57 GLN HG3 H N N 58 GLN HE21 H N N 59 GLN HE22 H N N 60 GLN HXT H N N 61 GLU N N N N 62 GLU CA C N S 63 GLU C C N N 64 GLU O O N N 65 GLU CB C N N 66 GLU CG C N N 67 GLU CD C N N 68 GLU OE1 O N N 69 GLU OE2 O N N 70 GLU OXT O N N 71 GLU H H N N 72 GLU H2 H N N 73 GLU HA H N N 74 GLU HB2 H N N 75 GLU HB3 H N N 76 GLU HG2 H N N 77 GLU HG3 H N N 78 GLU HE2 H N N 79 GLU HXT H N N 80 GLY N N N N 81 GLY CA C N N 82 GLY C C N N 83 GLY O O N N 84 GLY OXT O N N 85 GLY H H N N 86 GLY H2 H N N 87 GLY HA2 H N N 88 GLY HA3 H N N 89 GLY HXT H N N 90 HIS N N N N 91 HIS CA C N S 92 HIS C C N N 93 HIS O O N N 94 HIS CB C N N 95 HIS CG C Y N 96 HIS ND1 N Y N 97 HIS CD2 C Y N 98 HIS CE1 C Y N 99 HIS NE2 N Y N 100 HIS OXT O N N 101 HIS H H N N 102 HIS H2 H N N 103 HIS HA H N N 104 HIS HB2 H N N 105 HIS HB3 H N N 106 HIS HD1 H N N 107 HIS HD2 H N N 108 HIS HE1 H N N 109 HIS HE2 H N N 110 HIS HXT H N N 111 ILE N N N N 112 ILE CA C N S 113 ILE C C N N 114 ILE O O N N 115 ILE CB C N S 116 ILE CG1 C N N 117 ILE CG2 C N N 118 ILE CD1 C N N 119 ILE OXT O N N 120 ILE H H N N 121 ILE H2 H N N 122 ILE HA H N N 123 ILE HB H N N 124 ILE HG12 H N N 125 ILE HG13 H N N 126 ILE HG21 H N N 127 ILE HG22 H N N 128 ILE HG23 H N N 129 ILE HD11 H N N 130 ILE HD12 H N N 131 ILE HD13 H N N 132 ILE HXT H N N 133 LEU N N N N 134 LEU CA C N S 135 LEU C C N N 136 LEU O O N N 137 LEU CB C N N 138 LEU CG C N N 139 LEU CD1 C N N 140 LEU CD2 C N N 141 LEU OXT O N N 142 LEU H H N N 143 LEU H2 H N N 144 LEU HA H N N 145 LEU HB2 H N N 146 LEU HB3 H N N 147 LEU HG H N N 148 LEU HD11 H N N 149 LEU HD12 H N N 150 LEU HD13 H N N 151 LEU HD21 H N N 152 LEU HD22 H N N 153 LEU HD23 H N N 154 LEU HXT H N N 155 LYS N N N N 156 LYS CA C N S 157 LYS C C N N 158 LYS O O N N 159 LYS CB C N N 160 LYS CG C N N 161 LYS CD C N N 162 LYS CE C N N 163 LYS NZ N N N 164 LYS OXT O N N 165 LYS H H N N 166 LYS H2 H N N 167 LYS HA H N N 168 LYS HB2 H N N 169 LYS HB3 H N N 170 LYS HG2 H N N 171 LYS HG3 H N N 172 LYS HD2 H N N 173 LYS HD3 H N N 174 LYS HE2 H N N 175 LYS HE3 H N N 176 LYS HZ1 H N N 177 LYS HZ2 H N N 178 LYS HZ3 H N N 179 LYS HXT H N N 180 PHE N N N N 181 PHE CA C N S 182 PHE C C N N 183 PHE O O N N 184 PHE CB C N N 185 PHE CG C Y N 186 PHE CD1 C Y N 187 PHE CD2 C Y N 188 PHE CE1 C Y N 189 PHE CE2 C Y N 190 PHE CZ C Y N 191 PHE OXT O N N 192 PHE H H N N 193 PHE H2 H N N 194 PHE HA H N N 195 PHE HB2 H N N 196 PHE HB3 H N N 197 PHE HD1 H N N 198 PHE HD2 H N N 199 PHE HE1 H N N 200 PHE HE2 H N N 201 PHE HZ H N N 202 PHE HXT H N N 203 PRO N N N N 204 PRO CA C N S 205 PRO C C N N 206 PRO O O N N 207 PRO CB C N N 208 PRO CG C N N 209 PRO CD C N N 210 PRO OXT O N N 211 PRO H H N N 212 PRO HA H N N 213 PRO HB2 H N N 214 PRO HB3 H N N 215 PRO HG2 H N N 216 PRO HG3 H N N 217 PRO HD2 H N N 218 PRO HD3 H N N 219 PRO HXT H N N 220 SER N N N N 221 SER CA C N S 222 SER C C N N 223 SER O O N N 224 SER CB C N N 225 SER OG O N N 226 SER OXT O N N 227 SER H H N N 228 SER H2 H N N 229 SER HA H N N 230 SER HB2 H N N 231 SER HB3 H N N 232 SER HG H N N 233 SER HXT H N N 234 THR N N N N 235 THR CA C N S 236 THR C C N N 237 THR O O N N 238 THR CB C N R 239 THR OG1 O N N 240 THR CG2 C N N 241 THR OXT O N N 242 THR H H N N 243 THR H2 H N N 244 THR HA H N N 245 THR HB H N N 246 THR HG1 H N N 247 THR HG21 H N N 248 THR HG22 H N N 249 THR HG23 H N N 250 THR HXT H N N 251 TYR N N N N 252 TYR CA C N S 253 TYR C C N N 254 TYR O O N N 255 TYR CB C N N 256 TYR CG C Y N 257 TYR CD1 C Y N 258 TYR CD2 C Y N 259 TYR CE1 C Y N 260 TYR CE2 C Y N 261 TYR CZ C Y N 262 TYR OH O N N 263 TYR OXT O N N 264 TYR H H N N 265 TYR H2 H N N 266 TYR HA H N N 267 TYR HB2 H N N 268 TYR HB3 H N N 269 TYR HD1 H N N 270 TYR HD2 H N N 271 TYR HE1 H N N 272 TYR HE2 H N N 273 TYR HH H N N 274 TYR HXT H N N 275 VAL N N N N 276 VAL CA C N S 277 VAL C C N N 278 VAL O O N N 279 VAL CB C N N 280 VAL CG1 C N N 281 VAL CG2 C N N 282 VAL OXT O N N 283 VAL H H N N 284 VAL H2 H N N 285 VAL HA H N N 286 VAL HB H N N 287 VAL HG11 H N N 288 VAL HG12 H N N 289 VAL HG13 H N N 290 VAL HG21 H N N 291 VAL HG22 H N N 292 VAL HG23 H N N 293 VAL HXT H N N 294 ZN ZN ZN N N 295 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ARG N CA sing N N 1 ARG N H sing N N 2 ARG N H2 sing N N 3 ARG CA C sing N N 4 ARG CA CB sing N N 5 ARG CA HA sing N N 6 ARG C O doub N N 7 ARG C OXT sing N N 8 ARG CB CG sing N N 9 ARG CB HB2 sing N N 10 ARG CB HB3 sing N N 11 ARG CG CD sing N N 12 ARG CG HG2 sing N N 13 ARG CG HG3 sing N N 14 ARG CD NE sing N N 15 ARG CD HD2 sing N N 16 ARG CD HD3 sing N N 17 ARG NE CZ sing N N 18 ARG NE HE sing N N 19 ARG CZ NH1 sing N N 20 ARG CZ NH2 doub N N 21 ARG NH1 HH11 sing N N 22 ARG NH1 HH12 sing N N 23 ARG NH2 HH21 sing N N 24 ARG NH2 HH22 sing N N 25 ARG OXT HXT sing N N 26 CYS N CA sing N N 27 CYS N H sing N N 28 CYS N H2 sing N N 29 CYS CA C sing N N 30 CYS CA CB sing N N 31 CYS CA HA sing N N 32 CYS C O doub N N 33 CYS C OXT sing N N 34 CYS CB SG sing N N 35 CYS CB HB2 sing N N 36 CYS CB HB3 sing N N 37 CYS SG HG sing N N 38 CYS OXT HXT sing N N 39 GLN N CA sing N N 40 GLN N H sing N N 41 GLN N H2 sing N N 42 GLN CA C sing N N 43 GLN CA CB sing N N 44 GLN CA HA sing N N 45 GLN C O doub N N 46 GLN C OXT sing N N 47 GLN CB CG sing N N 48 GLN CB HB2 sing N N 49 GLN CB HB3 sing N N 50 GLN CG CD sing N N 51 GLN CG HG2 sing N N 52 GLN CG HG3 sing N N 53 GLN CD OE1 doub N N 54 GLN CD NE2 sing N N 55 GLN NE2 HE21 sing N N 56 GLN NE2 HE22 sing N N 57 GLN OXT HXT sing N N 58 GLU N CA sing N N 59 GLU N H sing N N 60 GLU N H2 sing N N 61 GLU CA C sing N N 62 GLU CA CB sing N N 63 GLU CA HA sing N N 64 GLU C O doub N N 65 GLU C OXT sing N N 66 GLU CB CG sing N N 67 GLU CB HB2 sing N N 68 GLU CB HB3 sing N N 69 GLU CG CD sing N N 70 GLU CG HG2 sing N N 71 GLU CG HG3 sing N N 72 GLU CD OE1 doub N N 73 GLU CD OE2 sing N N 74 GLU OE2 HE2 sing N N 75 GLU OXT HXT sing N N 76 GLY N CA sing N N 77 GLY N H sing N N 78 GLY N H2 sing N N 79 GLY CA C sing N N 80 GLY CA HA2 sing N N 81 GLY CA HA3 sing N N 82 GLY C O doub N N 83 GLY C OXT sing N N 84 GLY OXT HXT sing N N 85 HIS N CA sing N N 86 HIS N H sing N N 87 HIS N H2 sing N N 88 HIS CA C sing N N 89 HIS CA CB sing N N 90 HIS CA HA sing N N 91 HIS C O doub N N 92 HIS C OXT sing N N 93 HIS CB CG sing N N 94 HIS CB HB2 sing N N 95 HIS CB HB3 sing N N 96 HIS CG ND1 sing Y N 97 HIS CG CD2 doub Y N 98 HIS ND1 CE1 doub Y N 99 HIS ND1 HD1 sing N N 100 HIS CD2 NE2 sing Y N 101 HIS CD2 HD2 sing N N 102 HIS CE1 NE2 sing Y N 103 HIS CE1 HE1 sing N N 104 HIS NE2 HE2 sing N N 105 HIS OXT HXT sing N N 106 ILE N CA sing N N 107 ILE N H sing N N 108 ILE N H2 sing N N 109 ILE CA C sing N N 110 ILE CA CB sing N N 111 ILE CA HA sing N N 112 ILE C O doub N N 113 ILE C OXT sing N N 114 ILE CB CG1 sing N N 115 ILE CB CG2 sing N N 116 ILE CB HB sing N N 117 ILE CG1 CD1 sing N N 118 ILE CG1 HG12 sing N N 119 ILE CG1 HG13 sing N N 120 ILE CG2 HG21 sing N N 121 ILE CG2 HG22 sing N N 122 ILE CG2 HG23 sing N N 123 ILE CD1 HD11 sing N N 124 ILE CD1 HD12 sing N N 125 ILE CD1 HD13 sing N N 126 ILE OXT HXT sing N N 127 LEU N CA sing N N 128 LEU N H sing N N 129 LEU N H2 sing N N 130 LEU CA C sing N N 131 LEU CA CB sing N N 132 LEU CA HA sing N N 133 LEU C O doub N N 134 LEU C OXT sing N N 135 LEU CB CG sing N N 136 LEU CB HB2 sing N N 137 LEU CB HB3 sing N N 138 LEU CG CD1 sing N N 139 LEU CG CD2 sing N N 140 LEU CG HG sing N N 141 LEU CD1 HD11 sing N N 142 LEU CD1 HD12 sing N N 143 LEU CD1 HD13 sing N N 144 LEU CD2 HD21 sing N N 145 LEU CD2 HD22 sing N N 146 LEU CD2 HD23 sing N N 147 LEU OXT HXT sing N N 148 LYS N CA sing N N 149 LYS N H sing N N 150 LYS N H2 sing N N 151 LYS CA C sing N N 152 LYS CA CB sing N N 153 LYS CA HA sing N N 154 LYS C O doub N N 155 LYS C OXT sing N N 156 LYS CB CG sing N N 157 LYS CB HB2 sing N N 158 LYS CB HB3 sing N N 159 LYS CG CD sing N N 160 LYS CG HG2 sing N N 161 LYS CG HG3 sing N N 162 LYS CD CE sing N N 163 LYS CD HD2 sing N N 164 LYS CD HD3 sing N N 165 LYS CE NZ sing N N 166 LYS CE HE2 sing N N 167 LYS CE HE3 sing N N 168 LYS NZ HZ1 sing N N 169 LYS NZ HZ2 sing N N 170 LYS NZ HZ3 sing N N 171 LYS OXT HXT sing N N 172 PHE N CA sing N N 173 PHE N H sing N N 174 PHE N H2 sing N N 175 PHE CA C sing N N 176 PHE CA CB sing N N 177 PHE CA HA sing N N 178 PHE C O doub N N 179 PHE C OXT sing N N 180 PHE CB CG sing N N 181 PHE CB HB2 sing N N 182 PHE CB HB3 sing N N 183 PHE CG CD1 doub Y N 184 PHE CG CD2 sing Y N 185 PHE CD1 CE1 sing Y N 186 PHE CD1 HD1 sing N N 187 PHE CD2 CE2 doub Y N 188 PHE CD2 HD2 sing N N 189 PHE CE1 CZ doub Y N 190 PHE CE1 HE1 sing N N 191 PHE CE2 CZ sing Y N 192 PHE CE2 HE2 sing N N 193 PHE CZ HZ sing N N 194 PHE OXT HXT sing N N 195 PRO N CA sing N N 196 PRO N CD sing N N 197 PRO N H sing N N 198 PRO CA C sing N N 199 PRO CA CB sing N N 200 PRO CA HA sing N N 201 PRO C O doub N N 202 PRO C OXT sing N N 203 PRO CB CG sing N N 204 PRO CB HB2 sing N N 205 PRO CB HB3 sing N N 206 PRO CG CD sing N N 207 PRO CG HG2 sing N N 208 PRO CG HG3 sing N N 209 PRO CD HD2 sing N N 210 PRO CD HD3 sing N N 211 PRO OXT HXT sing N N 212 SER N CA sing N N 213 SER N H sing N N 214 SER N H2 sing N N 215 SER CA C sing N N 216 SER CA CB sing N N 217 SER CA HA sing N N 218 SER C O doub N N 219 SER C OXT sing N N 220 SER CB OG sing N N 221 SER CB HB2 sing N N 222 SER CB HB3 sing N N 223 SER OG HG sing N N 224 SER OXT HXT sing N N 225 THR N CA sing N N 226 THR N H sing N N 227 THR N H2 sing N N 228 THR CA C sing N N 229 THR CA CB sing N N 230 THR CA HA sing N N 231 THR C O doub N N 232 THR C OXT sing N N 233 THR CB OG1 sing N N 234 THR CB CG2 sing N N 235 THR CB HB sing N N 236 THR OG1 HG1 sing N N 237 THR CG2 HG21 sing N N 238 THR CG2 HG22 sing N N 239 THR CG2 HG23 sing N N 240 THR OXT HXT sing N N 241 TYR N CA sing N N 242 TYR N H sing N N 243 TYR N H2 sing N N 244 TYR CA C sing N N 245 TYR CA CB sing N N 246 TYR CA HA sing N N 247 TYR C O doub N N 248 TYR C OXT sing N N 249 TYR CB CG sing N N 250 TYR CB HB2 sing N N 251 TYR CB HB3 sing N N 252 TYR CG CD1 doub Y N 253 TYR CG CD2 sing Y N 254 TYR CD1 CE1 sing Y N 255 TYR CD1 HD1 sing N N 256 TYR CD2 CE2 doub Y N 257 TYR CD2 HD2 sing N N 258 TYR CE1 CZ doub Y N 259 TYR CE1 HE1 sing N N 260 TYR CE2 CZ sing Y N 261 TYR CE2 HE2 sing N N 262 TYR CZ OH sing N N 263 TYR OH HH sing N N 264 TYR OXT HXT sing N N 265 VAL N CA sing N N 266 VAL N H sing N N 267 VAL N H2 sing N N 268 VAL CA C sing N N 269 VAL CA CB sing N N 270 VAL CA HA sing N N 271 VAL C O doub N N 272 VAL C OXT sing N N 273 VAL CB CG1 sing N N 274 VAL CB CG2 sing N N 275 VAL CB HB sing N N 276 VAL CG1 HG11 sing N N 277 VAL CG1 HG12 sing N N 278 VAL CG1 HG13 sing N N 279 VAL CG2 HG21 sing N N 280 VAL CG2 HG22 sing N N 281 VAL CG2 HG23 sing N N 282 VAL OXT HXT sing N N 283 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 2EPT _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_