data_2EWU # _entry.id 2EWU # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2EWU pdb_00002ewu 10.2210/pdb2ewu/pdb RCSB RCSB035190 ? ? WWPDB D_1000035190 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 2EWI 'the same protein(F20Y)' unspecified PDB 2EWK 'the same protein(T24V)' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2EWU _pdbx_database_status.recvd_initial_deposition_date 2005-11-07 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Higuchi, Y.' 1 'Komori, H.' 2 'Morita, K.' 3 # _citation.id primary _citation.title 'The F20H mutant of tetraheme cytochrome c3 from Desulfovibrio Vulgaris Miyazaki F' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Higuchi, Y.' 1 ? primary 'Komori, H.' 2 ? primary 'Morita, K.' 3 ? # _cell.entry_id 2EWU _cell.length_a 52.196 _cell.length_b 67.418 _cell.length_c 34.454 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2EWU _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Cytochrome c3' 11549.255 1 ? F20H ? ? 2 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE' 616.487 4 ? ? ? ? 3 water nat water 18.015 347 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;APKAPADGLKMDKTKQPVVHNHSTHKAVKCGDCHHPVNGKEDYQKCATAGCHDNMDKKDKSAKGYYHAMHDKGTKFKSCV GCHLETAGADAAKKKELTGCKGSKCHS ; _entity_poly.pdbx_seq_one_letter_code_can ;APKAPADGLKMDKTKQPVVHNHSTHKAVKCGDCHHPVNGKEDYQKCATAGCHDNMDKKDKSAKGYYHAMHDKGTKFKSCV GCHLETAGADAAKKKELTGCKGSKCHS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 PRO n 1 3 LYS n 1 4 ALA n 1 5 PRO n 1 6 ALA n 1 7 ASP n 1 8 GLY n 1 9 LEU n 1 10 LYS n 1 11 MET n 1 12 ASP n 1 13 LYS n 1 14 THR n 1 15 LYS n 1 16 GLN n 1 17 PRO n 1 18 VAL n 1 19 VAL n 1 20 HIS n 1 21 ASN n 1 22 HIS n 1 23 SER n 1 24 THR n 1 25 HIS n 1 26 LYS n 1 27 ALA n 1 28 VAL n 1 29 LYS n 1 30 CYS n 1 31 GLY n 1 32 ASP n 1 33 CYS n 1 34 HIS n 1 35 HIS n 1 36 PRO n 1 37 VAL n 1 38 ASN n 1 39 GLY n 1 40 LYS n 1 41 GLU n 1 42 ASP n 1 43 TYR n 1 44 GLN n 1 45 LYS n 1 46 CYS n 1 47 ALA n 1 48 THR n 1 49 ALA n 1 50 GLY n 1 51 CYS n 1 52 HIS n 1 53 ASP n 1 54 ASN n 1 55 MET n 1 56 ASP n 1 57 LYS n 1 58 LYS n 1 59 ASP n 1 60 LYS n 1 61 SER n 1 62 ALA n 1 63 LYS n 1 64 GLY n 1 65 TYR n 1 66 TYR n 1 67 HIS n 1 68 ALA n 1 69 MET n 1 70 HIS n 1 71 ASP n 1 72 LYS n 1 73 GLY n 1 74 THR n 1 75 LYS n 1 76 PHE n 1 77 LYS n 1 78 SER n 1 79 CYS n 1 80 VAL n 1 81 GLY n 1 82 CYS n 1 83 HIS n 1 84 LEU n 1 85 GLU n 1 86 THR n 1 87 ALA n 1 88 GLY n 1 89 ALA n 1 90 ASP n 1 91 ALA n 1 92 ALA n 1 93 LYS n 1 94 LYS n 1 95 LYS n 1 96 GLU n 1 97 LEU n 1 98 THR n 1 99 GLY n 1 100 CYS n 1 101 LYS n 1 102 GLY n 1 103 SER n 1 104 LYS n 1 105 CYS n 1 106 HIS n 1 107 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Desulfovibrio _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species 'Desulfovibrio vulgaris' _entity_src_gen.gene_src_strain Miyazaki _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name ;Desulfovibrio vulgaris str. 'Miyazaki F' ; _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 883 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Shewanella oneidensis' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 70863 _entity_src_gen.host_org_genus Shewanella _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain TSP-C _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pKF19k _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CYC3_DESVM _struct_ref.pdbx_db_accession P00132 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 24 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2EWU _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 107 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00132 _struct_ref_seq.db_align_beg 24 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 130 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 107 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2EWU _struct_ref_seq_dif.mon_id HIS _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 20 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P00132 _struct_ref_seq_dif.db_mon_id PHE _struct_ref_seq_dif.pdbx_seq_db_seq_num 43 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 20 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HEM non-polymer . 'PROTOPORPHYRIN IX CONTAINING FE' HEME 'C34 H32 Fe N4 O4' 616.487 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2EWU _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.623523 _exptl_crystal.density_percent_sol 53.12 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.4 _exptl_crystal_grow.pdbx_details '40% MPD, pH 7.4, VAPOR DIFFUSION, temperature 277K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 4' _diffrn_detector.pdbx_collection_date 2004-11-15 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.7 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SPRING-8 BEAMLINE BL44B2' _diffrn_source.pdbx_synchrotron_site SPring-8 _diffrn_source.pdbx_synchrotron_beamline BL44B2 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.7 # _reflns.entry_id 2EWU _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 15.9 _reflns.d_resolution_high 1.1 _reflns.number_obs 50149 _reflns.number_all ? _reflns.percent_possible_obs ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _refine.entry_id 2EWU _refine.ls_number_reflns_obs 46515 _refine.ls_number_reflns_all 46515 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 10.00 _refine.ls_d_res_high 1.10 _refine.ls_percent_reflns_obs 92.7 _refine.ls_R_factor_obs 0.1113 _refine.ls_R_factor_all 0.114 _refine.ls_R_factor_R_work 0.1113 _refine.ls_R_factor_R_free 0.153 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters 11874 _refine.ls_number_restraints 13587 _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method 'FREE R' _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'ENGH & HUBER' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 2EWU _refine_analyze.Luzzati_coordinate_error_obs ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues 0 _refine_analyze.occupancy_sum_hydrogen 0.00 _refine_analyze.occupancy_sum_non_hydrogen 1319.00 _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 800 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 172 _refine_hist.number_atoms_solvent 347 _refine_hist.number_atoms_total 1319 _refine_hist.d_res_high 1.10 _refine_hist.d_res_low 10.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function s_bond_d 0.018 ? ? ? 'X-RAY DIFFRACTION' ? s_angle_d 0.033 ? ? ? 'X-RAY DIFFRACTION' ? s_similar_dist 0.000 ? ? ? 'X-RAY DIFFRACTION' ? s_from_restr_planes 0.0278 ? ? ? 'X-RAY DIFFRACTION' ? s_zero_chiral_vol 0.090 ? ? ? 'X-RAY DIFFRACTION' ? s_non_zero_chiral_vol 0.090 ? ? ? 'X-RAY DIFFRACTION' ? s_anti_bump_dis_restr 0.032 ? ? ? 'X-RAY DIFFRACTION' ? s_rigid_bond_adp_cmpnt 0.005 ? ? ? 'X-RAY DIFFRACTION' ? s_similar_adp_cmpnt 0.042 ? ? ? 'X-RAY DIFFRACTION' ? s_approx_iso_adps 0.095 ? ? ? 'X-RAY DIFFRACTION' ? # _pdbx_refine.entry_id 2EWU _pdbx_refine.R_factor_all_no_cutoff 0.114 _pdbx_refine.R_factor_obs_no_cutoff ? _pdbx_refine.free_R_factor_no_cutoff ? _pdbx_refine.free_R_val_test_set_size_perc_no_cutoff ? _pdbx_refine.free_R_val_test_set_ct_no_cutoff ? _pdbx_refine.R_factor_all_4sig_cutoff 0.1072 _pdbx_refine.R_factor_obs_4sig_cutoff ? _pdbx_refine.free_R_factor_4sig_cutoff ? _pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff ? _pdbx_refine.free_R_val_test_set_ct_4sig_cutoff ? _pdbx_refine.number_reflns_obs_4sig_cutoff 42352 _pdbx_refine.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine.free_R_error_no_cutoff ? # _struct.entry_id 2EWU _struct.title 'The F20H mutant of tetraheme cytochrome c3 from Desulfovibrio Vulgaris Miyazaki F' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2EWU _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' _struct_keywords.text 'electron transport' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 HIS A 22 ? LYS A 26 ? HIS A 22 LYS A 26 5 ? 5 HELX_P HELX_P2 2 LYS A 29 ? HIS A 34 ? LYS A 29 HIS A 34 1 ? 6 HELX_P HELX_P3 3 GLY A 64 ? ASP A 71 ? GLY A 64 ASP A 71 1 ? 8 HELX_P HELX_P4 4 SER A 78 ? GLY A 88 ? SER A 78 GLY A 88 1 ? 11 HELX_P HELX_P5 5 ASP A 90 ? GLY A 99 ? ASP A 90 GLY A 99 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale none ? A CYS 30 SG ? ? ? 1_555 D HEM . CAB ? ? A CYS 30 A HEM 1001 1_555 ? ? ? ? ? ? ? 1.896 ? ? covale2 covale none ? A CYS 33 SG ? ? ? 1_555 D HEM . CAC ? ? A CYS 33 A HEM 1001 1_555 ? ? ? ? ? ? ? 1.855 ? ? covale3 covale none ? A CYS 46 SG ? ? ? 1_555 C HEM . CAB ? ? A CYS 46 A HEM 1002 1_555 ? ? ? ? ? ? ? 1.863 ? ? covale4 covale none ? A CYS 51 SG ? ? ? 1_555 C HEM . CAC ? ? A CYS 51 A HEM 1002 1_555 ? ? ? ? ? ? ? 1.890 ? ? covale5 covale none ? A CYS 79 SG ? ? ? 1_555 E HEM . CAB ? ? A CYS 79 A HEM 1003 1_555 ? ? ? ? ? ? ? 1.864 ? ? covale6 covale none ? A CYS 82 SG ? ? ? 1_555 E HEM . CAC ? ? A CYS 82 A HEM 1003 1_555 ? ? ? ? ? ? ? 1.861 ? ? covale7 covale none ? A CYS 100 SG ? ? ? 1_555 B HEM . CAB ? ? A CYS 100 A HEM 1004 1_555 ? ? ? ? ? ? ? 1.861 ? ? covale8 covale none ? A CYS 105 SG ? ? ? 1_555 B HEM . CAC ? ? A CYS 105 A HEM 1004 1_555 ? ? ? ? ? ? ? 1.875 ? ? metalc1 metalc ? ? A HIS 22 NE2 ? ? ? 1_555 D HEM . FE ? ? A HIS 22 A HEM 1001 1_555 ? ? ? ? ? ? ? 1.978 ? ? metalc2 metalc ? ? A HIS 25 NE2 ? ? ? 1_555 E HEM . FE ? ? A HIS 25 A HEM 1003 1_555 ? ? ? ? ? ? ? 1.976 ? ? metalc3 metalc ? ? A HIS 34 NE2 ? ? ? 1_555 D HEM . FE ? ? A HIS 34 A HEM 1001 1_555 ? ? ? ? ? ? ? 1.962 ? ? metalc4 metalc ? ? A HIS 35 NE2 ? ? ? 1_555 C HEM . FE ? ? A HIS 35 A HEM 1002 1_555 ? ? ? ? ? ? ? 1.987 ? ? metalc5 metalc ? ? A HIS 52 NE2 ? ? ? 1_555 C HEM . FE ? ? A HIS 52 A HEM 1002 1_555 ? ? ? ? ? ? ? 1.972 ? ? metalc6 metalc ? ? A HIS 70 NE2 ? ? ? 1_555 B HEM . FE ? ? A HIS 70 A HEM 1004 1_555 ? ? ? ? ? ? ? 1.985 ? ? metalc7 metalc ? ? A HIS 83 NE2 ? ? ? 1_555 E HEM . FE ? ? A HIS 83 A HEM 1003 1_555 ? ? ? ? ? ? ? 1.993 ? ? metalc8 metalc ? ? A HIS 106 NE2 ? ? ? 1_555 B HEM . FE ? ? A HIS 106 A HEM 1004 1_555 ? ? ? ? ? ? ? 1.974 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 9 ? MET A 11 ? LEU A 9 MET A 11 A 2 VAL A 18 ? HIS A 20 ? VAL A 18 HIS A 20 B 1 PRO A 36 ? VAL A 37 ? PRO A 36 VAL A 37 B 2 LYS A 40 ? GLU A 41 ? LYS A 40 GLU A 41 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N MET A 11 ? N MET A 11 O VAL A 18 ? O VAL A 18 B 1 2 N VAL A 37 ? N VAL A 37 O LYS A 40 ? O LYS A 40 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A HEM 1004 ? 23 'BINDING SITE FOR RESIDUE HEM A 1004' AC2 Software A HEM 1002 ? 18 'BINDING SITE FOR RESIDUE HEM A 1002' AC3 Software A HEM 1001 ? 23 'BINDING SITE FOR RESIDUE HEM A 1001' AC4 Software A HEM 1003 ? 19 'BINDING SITE FOR RESIDUE HEM A 1003' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 23 MET A 11 ? MET A 11 . ? 1_555 ? 2 AC1 23 ASP A 12 ? ASP A 12 . ? 1_555 ? 3 AC1 23 LYS A 13 ? LYS A 13 . ? 1_555 ? 4 AC1 23 THR A 14 ? THR A 14 . ? 1_555 ? 5 AC1 23 GLN A 16 ? GLN A 16 . ? 1_555 ? 6 AC1 23 PRO A 17 ? PRO A 17 . ? 1_555 ? 7 AC1 23 VAL A 18 ? VAL A 18 . ? 1_555 ? 8 AC1 23 GLY A 39 ? GLY A 39 . ? 4_466 ? 9 AC1 23 TYR A 65 ? TYR A 65 . ? 1_555 ? 10 AC1 23 TYR A 66 ? TYR A 66 . ? 1_555 ? 11 AC1 23 HIS A 70 ? HIS A 70 . ? 1_555 ? 12 AC1 23 CYS A 79 ? CYS A 79 . ? 1_555 ? 13 AC1 23 HIS A 83 ? HIS A 83 . ? 1_555 ? 14 AC1 23 LEU A 97 ? LEU A 97 . ? 1_555 ? 15 AC1 23 THR A 98 ? THR A 98 . ? 1_555 ? 16 AC1 23 GLY A 99 ? GLY A 99 . ? 1_555 ? 17 AC1 23 CYS A 100 ? CYS A 100 . ? 1_555 ? 18 AC1 23 CYS A 105 ? CYS A 105 . ? 1_555 ? 19 AC1 23 HIS A 106 ? HIS A 106 . ? 1_555 ? 20 AC1 23 HOH F . ? HOH A 2033 . ? 1_555 ? 21 AC1 23 HOH F . ? HOH A 2038 . ? 1_555 ? 22 AC1 23 HOH F . ? HOH A 2054 . ? 1_555 ? 23 AC1 23 HOH F . ? HOH A 2058 . ? 1_555 ? 24 AC2 18 HIS A 35 ? HIS A 35 . ? 1_555 ? 25 AC2 18 ASP A 42 ? ASP A 42 . ? 1_555 ? 26 AC2 18 GLN A 44 ? GLN A 44 . ? 1_555 ? 27 AC2 18 LYS A 45 ? LYS A 45 . ? 1_555 ? 28 AC2 18 CYS A 46 ? CYS A 46 . ? 1_555 ? 29 AC2 18 CYS A 51 ? CYS A 51 . ? 1_555 ? 30 AC2 18 HIS A 52 ? HIS A 52 . ? 1_555 ? 31 AC2 18 HIS A 67 ? HIS A 67 . ? 1_555 ? 32 AC2 18 ALA A 68 ? ALA A 68 . ? 1_555 ? 33 AC2 18 THR A 74 ? THR A 74 . ? 1_555 ? 34 AC2 18 LYS A 75 ? LYS A 75 . ? 1_555 ? 35 AC2 18 PHE A 76 ? PHE A 76 . ? 1_555 ? 36 AC2 18 HOH F . ? HOH A 2017 . ? 1_555 ? 37 AC2 18 HOH F . ? HOH A 2036 . ? 1_555 ? 38 AC2 18 HOH F . ? HOH A 2068 . ? 1_555 ? 39 AC2 18 HOH F . ? HOH A 2076 . ? 1_555 ? 40 AC2 18 HOH F . ? HOH A 2091 . ? 1_555 ? 41 AC2 18 HOH F . ? HOH A 2244 . ? 1_554 ? 42 AC3 23 PRO A 2 ? PRO A 2 . ? 1_555 ? 43 AC3 23 LYS A 3 ? LYS A 3 . ? 1_555 ? 44 AC3 23 ALA A 4 ? ALA A 4 . ? 1_555 ? 45 AC3 23 PRO A 5 ? PRO A 5 . ? 1_555 ? 46 AC3 23 LEU A 9 ? LEU A 9 . ? 1_555 ? 47 AC3 23 MET A 11 ? MET A 11 . ? 1_555 ? 48 AC3 23 HIS A 20 ? HIS A 20 . ? 1_555 ? 49 AC3 23 HIS A 22 ? HIS A 22 . ? 1_555 ? 50 AC3 23 HIS A 25 ? HIS A 25 . ? 1_555 ? 51 AC3 23 VAL A 28 ? VAL A 28 . ? 1_555 ? 52 AC3 23 CYS A 30 ? CYS A 30 . ? 1_555 ? 53 AC3 23 CYS A 33 ? CYS A 33 . ? 1_555 ? 54 AC3 23 HIS A 34 ? HIS A 34 . ? 1_555 ? 55 AC3 23 LYS A 45 ? LYS A 45 . ? 1_555 ? 56 AC3 23 CYS A 46 ? CYS A 46 . ? 1_555 ? 57 AC3 23 HEM E . ? HEM A 1003 . ? 1_555 ? 58 AC3 23 HOH F . ? HOH A 2003 . ? 1_555 ? 59 AC3 23 HOH F . ? HOH A 2025 . ? 1_555 ? 60 AC3 23 HOH F . ? HOH A 2114 . ? 1_555 ? 61 AC3 23 HOH F . ? HOH A 2141 . ? 1_555 ? 62 AC3 23 HOH F . ? HOH A 2160 . ? 1_555 ? 63 AC3 23 HOH F . ? HOH A 2184 . ? 1_555 ? 64 AC3 23 HOH F . ? HOH A 2276 . ? 1_555 ? 65 AC4 19 VAL A 18 ? VAL A 18 . ? 1_555 ? 66 AC4 19 HIS A 20 ? HIS A 20 . ? 1_555 ? 67 AC4 19 ASN A 21 ? ASN A 21 . ? 1_555 ? 68 AC4 19 THR A 24 ? THR A 24 . ? 1_555 ? 69 AC4 19 HIS A 25 ? HIS A 25 . ? 1_555 ? 70 AC4 19 LYS A 77 ? LYS A 77 . ? 1_555 ? 71 AC4 19 SER A 78 ? SER A 78 . ? 1_555 ? 72 AC4 19 CYS A 79 ? CYS A 79 . ? 1_555 ? 73 AC4 19 CYS A 82 ? CYS A 82 . ? 1_555 ? 74 AC4 19 HIS A 83 ? HIS A 83 . ? 1_555 ? 75 AC4 19 LYS A 93 ? LYS A 93 . ? 1_555 ? 76 AC4 19 LYS A 104 ? LYS A 104 . ? 1_555 ? 77 AC4 19 HEM D . ? HEM A 1001 . ? 1_555 ? 78 AC4 19 HOH F . ? HOH A 2018 . ? 1_555 ? 79 AC4 19 HOH F . ? HOH A 2050 . ? 1_555 ? 80 AC4 19 HOH F . ? HOH A 2062 . ? 1_555 ? 81 AC4 19 HOH F . ? HOH A 2104 . ? 1_555 ? 82 AC4 19 HOH F . ? HOH A 2148 . ? 1_555 ? 83 AC4 19 HOH F . ? HOH A 2320 . ? 1_555 ? # _database_PDB_matrix.entry_id 2EWU _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.000000 _database_PDB_matrix.origx_vector[2] 0.000000 _database_PDB_matrix.origx_vector[3] 0.000000 # _atom_sites.entry_id 2EWU _atom_sites.fract_transf_matrix[1][1] 0.019159 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014833 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.029024 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C FE N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 MET 11 11 11 MET MET A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 HIS 20 20 20 HIS HIS A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 HIS 22 22 22 HIS HIS A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 HIS 25 25 25 HIS HIS A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 CYS 30 30 30 CYS CYS A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 CYS 33 33 33 CYS CYS A . n A 1 34 HIS 34 34 34 HIS HIS A . n A 1 35 HIS 35 35 35 HIS HIS A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 TYR 43 43 43 TYR TYR A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 CYS 46 46 46 CYS CYS A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 CYS 51 51 51 CYS CYS A . n A 1 52 HIS 52 52 52 HIS HIS A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 MET 55 55 55 MET MET A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 TYR 65 65 65 TYR TYR A . n A 1 66 TYR 66 66 66 TYR TYR A . n A 1 67 HIS 67 67 67 HIS HIS A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 MET 69 69 69 MET MET A . n A 1 70 HIS 70 70 70 HIS HIS A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 PHE 76 76 76 PHE PHE A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 CYS 79 79 79 CYS CYS A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 CYS 82 82 82 CYS CYS A . n A 1 83 HIS 83 83 83 HIS HIS A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 THR 86 86 86 THR THR A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 THR 98 98 98 THR THR A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 CYS 100 100 100 CYS CYS A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 CYS 105 105 105 CYS CYS A . n A 1 106 HIS 106 106 106 HIS HIS A . n A 1 107 SER 107 107 107 SER SER A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HEM 1 1004 1004 HEM HEM A . C 2 HEM 1 1002 1002 HEM HEM A . D 2 HEM 1 1001 1001 HEM HEM A . E 2 HEM 1 1003 1003 HEM HEM A . F 3 HOH 1 2001 2001 HOH HOH A . F 3 HOH 2 2002 2002 HOH HOH A . F 3 HOH 3 2003 2003 HOH HOH A . F 3 HOH 4 2004 2004 HOH HOH A . F 3 HOH 5 2005 2005 HOH HOH A . F 3 HOH 6 2006 2006 HOH HOH A . F 3 HOH 7 2007 2007 HOH HOH A . F 3 HOH 8 2008 2008 HOH HOH A . F 3 HOH 9 2009 2009 HOH HOH A . F 3 HOH 10 2010 2010 HOH HOH A . F 3 HOH 11 2011 2011 HOH HOH A . F 3 HOH 12 2012 2012 HOH HOH A . F 3 HOH 13 2013 2013 HOH HOH A . F 3 HOH 14 2014 2014 HOH HOH A . F 3 HOH 15 2015 2015 HOH HOH A . F 3 HOH 16 2016 2016 HOH HOH A . F 3 HOH 17 2017 2017 HOH HOH A . F 3 HOH 18 2018 2018 HOH HOH A . F 3 HOH 19 2019 2019 HOH HOH A . F 3 HOH 20 2020 2020 HOH HOH A . F 3 HOH 21 2021 2021 HOH HOH A . F 3 HOH 22 2022 2022 HOH HOH A . F 3 HOH 23 2023 2023 HOH HOH A . F 3 HOH 24 2024 2024 HOH HOH A . F 3 HOH 25 2025 2025 HOH HOH A . F 3 HOH 26 2026 2026 HOH HOH A . F 3 HOH 27 2027 2027 HOH HOH A . F 3 HOH 28 2028 2028 HOH HOH A . F 3 HOH 29 2029 2029 HOH HOH A . F 3 HOH 30 2030 2030 HOH HOH A . F 3 HOH 31 2031 2031 HOH HOH A . F 3 HOH 32 2032 2032 HOH HOH A . F 3 HOH 33 2033 2033 HOH HOH A . F 3 HOH 34 2034 2034 HOH HOH A . F 3 HOH 35 2035 2035 HOH HOH A . F 3 HOH 36 2036 2036 HOH HOH A . F 3 HOH 37 2037 2037 HOH HOH A . F 3 HOH 38 2038 2038 HOH HOH A . F 3 HOH 39 2039 2039 HOH HOH A . F 3 HOH 40 2040 2040 HOH HOH A . F 3 HOH 41 2041 2041 HOH HOH A . F 3 HOH 42 2042 2042 HOH HOH A . F 3 HOH 43 2043 2043 HOH HOH A . F 3 HOH 44 2044 2044 HOH HOH A . F 3 HOH 45 2045 2045 HOH HOH A . F 3 HOH 46 2046 2046 HOH HOH A . F 3 HOH 47 2047 2047 HOH HOH A . F 3 HOH 48 2048 2048 HOH HOH A . F 3 HOH 49 2049 2049 HOH HOH A . F 3 HOH 50 2050 2050 HOH HOH A . F 3 HOH 51 2051 2051 HOH HOH A . F 3 HOH 52 2052 2052 HOH HOH A . F 3 HOH 53 2053 2053 HOH HOH A . F 3 HOH 54 2054 2054 HOH HOH A . F 3 HOH 55 2055 2055 HOH HOH A . F 3 HOH 56 2056 2056 HOH HOH A . F 3 HOH 57 2057 2057 HOH HOH A . F 3 HOH 58 2058 2058 HOH HOH A . F 3 HOH 59 2059 2059 HOH HOH A . F 3 HOH 60 2060 2060 HOH HOH A . F 3 HOH 61 2061 2061 HOH HOH A . F 3 HOH 62 2062 2062 HOH HOH A . F 3 HOH 63 2063 2063 HOH HOH A . F 3 HOH 64 2064 2064 HOH HOH A . F 3 HOH 65 2065 2065 HOH HOH A . F 3 HOH 66 2066 2066 HOH HOH A . F 3 HOH 67 2067 2067 HOH HOH A . F 3 HOH 68 2068 2068 HOH HOH A . F 3 HOH 69 2069 2069 HOH HOH A . F 3 HOH 70 2070 2070 HOH HOH A . F 3 HOH 71 2071 2071 HOH HOH A . F 3 HOH 72 2072 2072 HOH HOH A . F 3 HOH 73 2073 2073 HOH HOH A . F 3 HOH 74 2074 2074 HOH HOH A . F 3 HOH 75 2075 2075 HOH HOH A . F 3 HOH 76 2076 2076 HOH HOH A . F 3 HOH 77 2077 2077 HOH HOH A . F 3 HOH 78 2078 2078 HOH HOH A . F 3 HOH 79 2079 2079 HOH HOH A . F 3 HOH 80 2080 2080 HOH HOH A . F 3 HOH 81 2081 2081 HOH HOH A . F 3 HOH 82 2082 2082 HOH HOH A . F 3 HOH 83 2083 2083 HOH HOH A . F 3 HOH 84 2084 2084 HOH HOH A . F 3 HOH 85 2085 2085 HOH HOH A . F 3 HOH 86 2086 2086 HOH HOH A . F 3 HOH 87 2087 2087 HOH HOH A . F 3 HOH 88 2088 2088 HOH HOH A . F 3 HOH 89 2089 2089 HOH HOH A . F 3 HOH 90 2090 2090 HOH HOH A . F 3 HOH 91 2091 2091 HOH HOH A . F 3 HOH 92 2092 2092 HOH HOH A . F 3 HOH 93 2093 2093 HOH HOH A . F 3 HOH 94 2094 2094 HOH HOH A . F 3 HOH 95 2095 2095 HOH HOH A . F 3 HOH 96 2096 2096 HOH HOH A . F 3 HOH 97 2097 2097 HOH HOH A . F 3 HOH 98 2098 2098 HOH HOH A . F 3 HOH 99 2099 2099 HOH HOH A . F 3 HOH 100 2100 2100 HOH HOH A . F 3 HOH 101 2101 2101 HOH HOH A . F 3 HOH 102 2102 2102 HOH HOH A . F 3 HOH 103 2103 2103 HOH HOH A . F 3 HOH 104 2104 2104 HOH HOH A . F 3 HOH 105 2105 2105 HOH HOH A . F 3 HOH 106 2106 2106 HOH HOH A . F 3 HOH 107 2107 2107 HOH HOH A . F 3 HOH 108 2108 2108 HOH HOH A . F 3 HOH 109 2109 2109 HOH HOH A . F 3 HOH 110 2110 2110 HOH HOH A . F 3 HOH 111 2111 2111 HOH HOH A . F 3 HOH 112 2112 2112 HOH HOH A . F 3 HOH 113 2113 2113 HOH HOH A . F 3 HOH 114 2114 2114 HOH HOH A . F 3 HOH 115 2115 2115 HOH HOH A . F 3 HOH 116 2116 2116 HOH HOH A . F 3 HOH 117 2117 2117 HOH HOH A . F 3 HOH 118 2118 2118 HOH HOH A . F 3 HOH 119 2119 2119 HOH HOH A . F 3 HOH 120 2120 2120 HOH HOH A . F 3 HOH 121 2121 2121 HOH HOH A . F 3 HOH 122 2122 2122 HOH HOH A . F 3 HOH 123 2123 2123 HOH HOH A . F 3 HOH 124 2124 2124 HOH HOH A . F 3 HOH 125 2125 2125 HOH HOH A . F 3 HOH 126 2126 2126 HOH HOH A . F 3 HOH 127 2127 2127 HOH HOH A . F 3 HOH 128 2128 2128 HOH HOH A . F 3 HOH 129 2129 2129 HOH HOH A . F 3 HOH 130 2130 2130 HOH HOH A . F 3 HOH 131 2131 2131 HOH HOH A . F 3 HOH 132 2132 2132 HOH HOH A . F 3 HOH 133 2133 2133 HOH HOH A . F 3 HOH 134 2134 2134 HOH HOH A . F 3 HOH 135 2135 2135 HOH HOH A . F 3 HOH 136 2136 2136 HOH HOH A . F 3 HOH 137 2137 2137 HOH HOH A . F 3 HOH 138 2138 2138 HOH HOH A . F 3 HOH 139 2139 2139 HOH HOH A . F 3 HOH 140 2140 2140 HOH HOH A . F 3 HOH 141 2141 2141 HOH HOH A . F 3 HOH 142 2142 2142 HOH HOH A . F 3 HOH 143 2143 2143 HOH HOH A . F 3 HOH 144 2144 2144 HOH HOH A . F 3 HOH 145 2145 2145 HOH HOH A . F 3 HOH 146 2146 2146 HOH HOH A . F 3 HOH 147 2147 2147 HOH HOH A . F 3 HOH 148 2148 2148 HOH HOH A . F 3 HOH 149 2149 2149 HOH HOH A . F 3 HOH 150 2150 2150 HOH HOH A . F 3 HOH 151 2151 2151 HOH HOH A . F 3 HOH 152 2152 2152 HOH HOH A . F 3 HOH 153 2153 2153 HOH HOH A . F 3 HOH 154 2154 2154 HOH HOH A . F 3 HOH 155 2155 2155 HOH HOH A . F 3 HOH 156 2156 2156 HOH HOH A . F 3 HOH 157 2157 2157 HOH HOH A . F 3 HOH 158 2158 2158 HOH HOH A . F 3 HOH 159 2159 2159 HOH HOH A . F 3 HOH 160 2160 2160 HOH HOH A . F 3 HOH 161 2161 2161 HOH HOH A . F 3 HOH 162 2162 2162 HOH HOH A . F 3 HOH 163 2163 2163 HOH HOH A . F 3 HOH 164 2164 2164 HOH HOH A . F 3 HOH 165 2165 2165 HOH HOH A . F 3 HOH 166 2166 2166 HOH HOH A . F 3 HOH 167 2167 2167 HOH HOH A . F 3 HOH 168 2168 2168 HOH HOH A . F 3 HOH 169 2169 2169 HOH HOH A . F 3 HOH 170 2170 2170 HOH HOH A . F 3 HOH 171 2171 2171 HOH HOH A . F 3 HOH 172 2172 2172 HOH HOH A . F 3 HOH 173 2173 2173 HOH HOH A . F 3 HOH 174 2174 2174 HOH HOH A . F 3 HOH 175 2175 2175 HOH HOH A . F 3 HOH 176 2176 2176 HOH HOH A . F 3 HOH 177 2177 2177 HOH HOH A . F 3 HOH 178 2178 2178 HOH HOH A . F 3 HOH 179 2179 2179 HOH HOH A . F 3 HOH 180 2180 2180 HOH HOH A . F 3 HOH 181 2181 2181 HOH HOH A . F 3 HOH 182 2182 2182 HOH HOH A . F 3 HOH 183 2183 2183 HOH HOH A . F 3 HOH 184 2184 2184 HOH HOH A . F 3 HOH 185 2185 2185 HOH HOH A . F 3 HOH 186 2186 2186 HOH HOH A . F 3 HOH 187 2187 2187 HOH HOH A . F 3 HOH 188 2188 2188 HOH HOH A . F 3 HOH 189 2189 2189 HOH HOH A . F 3 HOH 190 2190 2190 HOH HOH A . F 3 HOH 191 2191 2191 HOH HOH A . F 3 HOH 192 2192 2192 HOH HOH A . F 3 HOH 193 2193 2193 HOH HOH A . F 3 HOH 194 2194 2194 HOH HOH A . F 3 HOH 195 2195 2195 HOH HOH A . F 3 HOH 196 2196 2196 HOH HOH A . F 3 HOH 197 2197 2197 HOH HOH A . F 3 HOH 198 2198 2198 HOH HOH A . F 3 HOH 199 2199 2199 HOH HOH A . F 3 HOH 200 2200 2200 HOH HOH A . F 3 HOH 201 2201 2201 HOH HOH A . F 3 HOH 202 2202 2202 HOH HOH A . F 3 HOH 203 2203 2203 HOH HOH A . F 3 HOH 204 2204 2204 HOH HOH A . F 3 HOH 205 2205 2205 HOH HOH A . F 3 HOH 206 2206 2206 HOH HOH A . F 3 HOH 207 2207 2207 HOH HOH A . F 3 HOH 208 2208 2208 HOH HOH A . F 3 HOH 209 2209 2209 HOH HOH A . F 3 HOH 210 2210 2210 HOH HOH A . F 3 HOH 211 2211 2211 HOH HOH A . F 3 HOH 212 2212 2212 HOH HOH A . F 3 HOH 213 2213 2213 HOH HOH A . F 3 HOH 214 2214 2214 HOH HOH A . F 3 HOH 215 2215 2215 HOH HOH A . F 3 HOH 216 2216 2216 HOH HOH A . F 3 HOH 217 2217 2217 HOH HOH A . F 3 HOH 218 2218 2218 HOH HOH A . F 3 HOH 219 2219 2219 HOH HOH A . F 3 HOH 220 2220 2220 HOH HOH A . F 3 HOH 221 2221 2221 HOH HOH A . F 3 HOH 222 2222 2222 HOH HOH A . F 3 HOH 223 2223 2223 HOH HOH A . F 3 HOH 224 2224 2224 HOH HOH A . F 3 HOH 225 2225 2225 HOH HOH A . F 3 HOH 226 2226 2226 HOH HOH A . F 3 HOH 227 2227 2227 HOH HOH A . F 3 HOH 228 2228 2228 HOH HOH A . F 3 HOH 229 2229 2229 HOH HOH A . F 3 HOH 230 2230 2230 HOH HOH A . F 3 HOH 231 2231 2231 HOH HOH A . F 3 HOH 232 2232 2232 HOH HOH A . F 3 HOH 233 2233 2233 HOH HOH A . F 3 HOH 234 2234 2234 HOH HOH A . F 3 HOH 235 2235 2235 HOH HOH A . F 3 HOH 236 2236 2236 HOH HOH A . F 3 HOH 237 2237 2237 HOH HOH A . F 3 HOH 238 2238 2238 HOH HOH A . F 3 HOH 239 2239 2239 HOH HOH A . F 3 HOH 240 2240 2240 HOH HOH A . F 3 HOH 241 2241 2241 HOH HOH A . F 3 HOH 242 2242 2242 HOH HOH A . F 3 HOH 243 2243 2243 HOH HOH A . F 3 HOH 244 2244 2244 HOH HOH A . F 3 HOH 245 2245 2245 HOH HOH A . F 3 HOH 246 2246 2246 HOH HOH A . F 3 HOH 247 2247 2247 HOH HOH A . F 3 HOH 248 2248 2248 HOH HOH A . F 3 HOH 249 2249 2249 HOH HOH A . F 3 HOH 250 2250 2250 HOH HOH A . F 3 HOH 251 2251 2251 HOH HOH A . F 3 HOH 252 2252 2252 HOH HOH A . F 3 HOH 253 2253 2253 HOH HOH A . F 3 HOH 254 2254 2254 HOH HOH A . F 3 HOH 255 2255 2255 HOH HOH A . F 3 HOH 256 2256 2256 HOH HOH A . F 3 HOH 257 2257 2257 HOH HOH A . F 3 HOH 258 2258 2258 HOH HOH A . F 3 HOH 259 2259 2259 HOH HOH A . F 3 HOH 260 2260 2260 HOH HOH A . F 3 HOH 261 2261 2261 HOH HOH A . F 3 HOH 262 2262 2262 HOH HOH A . F 3 HOH 263 2263 2263 HOH HOH A . F 3 HOH 264 2264 2264 HOH HOH A . F 3 HOH 265 2265 2265 HOH HOH A . F 3 HOH 266 2266 2266 HOH HOH A . F 3 HOH 267 2267 2267 HOH HOH A . F 3 HOH 268 2268 2268 HOH HOH A . F 3 HOH 269 2269 2269 HOH HOH A . F 3 HOH 270 2270 2270 HOH HOH A . F 3 HOH 271 2271 2271 HOH HOH A . F 3 HOH 272 2272 2272 HOH HOH A . F 3 HOH 273 2273 2273 HOH HOH A . F 3 HOH 274 2274 2274 HOH HOH A . F 3 HOH 275 2275 2275 HOH HOH A . F 3 HOH 276 2276 2276 HOH HOH A . F 3 HOH 277 2277 2277 HOH HOH A . F 3 HOH 278 2278 2278 HOH HOH A . F 3 HOH 279 2279 2279 HOH HOH A . F 3 HOH 280 2280 2280 HOH HOH A . F 3 HOH 281 2281 2281 HOH HOH A . F 3 HOH 282 2282 2282 HOH HOH A . F 3 HOH 283 2283 2283 HOH HOH A . F 3 HOH 284 2284 2284 HOH HOH A . F 3 HOH 285 2285 2285 HOH HOH A . F 3 HOH 286 2286 2286 HOH HOH A . F 3 HOH 287 2287 2287 HOH HOH A . F 3 HOH 288 2288 2288 HOH HOH A . F 3 HOH 289 2289 2289 HOH HOH A . F 3 HOH 290 2290 2290 HOH HOH A . F 3 HOH 291 2291 2291 HOH HOH A . F 3 HOH 292 2292 2292 HOH HOH A . F 3 HOH 293 2293 2293 HOH HOH A . F 3 HOH 294 2294 2294 HOH HOH A . F 3 HOH 295 2295 2295 HOH HOH A . F 3 HOH 296 2296 2296 HOH HOH A . F 3 HOH 297 2297 2297 HOH HOH A . F 3 HOH 298 2298 2298 HOH HOH A . F 3 HOH 299 2299 2299 HOH HOH A . F 3 HOH 300 2300 2300 HOH HOH A . F 3 HOH 301 2301 2301 HOH HOH A . F 3 HOH 302 2302 2302 HOH HOH A . F 3 HOH 303 2303 2303 HOH HOH A . F 3 HOH 304 2304 2304 HOH HOH A . F 3 HOH 305 2305 2305 HOH HOH A . F 3 HOH 306 2306 2306 HOH HOH A . F 3 HOH 307 2307 2307 HOH HOH A . F 3 HOH 308 2308 2308 HOH HOH A . F 3 HOH 309 2309 2309 HOH HOH A . F 3 HOH 310 2310 2310 HOH HOH A . F 3 HOH 311 2311 2311 HOH HOH A . F 3 HOH 312 2312 2312 HOH HOH A . F 3 HOH 313 2313 2313 HOH HOH A . F 3 HOH 314 2314 2314 HOH HOH A . F 3 HOH 315 2315 2315 HOH HOH A . F 3 HOH 316 2316 2316 HOH HOH A . F 3 HOH 317 2317 2317 HOH HOH A . F 3 HOH 318 2318 2318 HOH HOH A . F 3 HOH 319 2319 2319 HOH HOH A . F 3 HOH 320 2320 2320 HOH HOH A . F 3 HOH 321 2321 2321 HOH HOH A . F 3 HOH 322 2322 2322 HOH HOH A . F 3 HOH 323 2323 2323 HOH HOH A . F 3 HOH 324 2324 2324 HOH HOH A . F 3 HOH 325 2325 2325 HOH HOH A . F 3 HOH 326 2326 2326 HOH HOH A . F 3 HOH 327 2327 2327 HOH HOH A . F 3 HOH 328 2328 2328 HOH HOH A . F 3 HOH 329 2329 2329 HOH HOH A . F 3 HOH 330 2330 2330 HOH HOH A . F 3 HOH 331 2331 2331 HOH HOH A . F 3 HOH 332 2332 2332 HOH HOH A . F 3 HOH 333 2333 2333 HOH HOH A . F 3 HOH 334 2334 2334 HOH HOH A . F 3 HOH 335 2335 2335 HOH HOH A . F 3 HOH 336 2336 2336 HOH HOH A . F 3 HOH 337 2337 2337 HOH HOH A . F 3 HOH 338 2338 2338 HOH HOH A . F 3 HOH 339 2339 2339 HOH HOH A . F 3 HOH 340 2340 2340 HOH HOH A . F 3 HOH 341 2341 2341 HOH HOH A . F 3 HOH 342 2342 2342 HOH HOH A . F 3 HOH 343 2343 2343 HOH HOH A . F 3 HOH 344 2344 2344 HOH HOH A . F 3 HOH 345 2345 2345 HOH HOH A . F 3 HOH 346 2346 2346 HOH HOH A . F 3 HOH 347 2347 2347 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 22 ? A HIS 22 ? 1_555 FE ? D HEM . ? A HEM 1001 ? 1_555 NA ? D HEM . ? A HEM 1001 ? 1_555 92.4 ? 2 NE2 ? A HIS 22 ? A HIS 22 ? 1_555 FE ? D HEM . ? A HEM 1001 ? 1_555 NB ? D HEM . ? A HEM 1001 ? 1_555 91.0 ? 3 NA ? D HEM . ? A HEM 1001 ? 1_555 FE ? D HEM . ? A HEM 1001 ? 1_555 NB ? D HEM . ? A HEM 1001 ? 1_555 91.1 ? 4 NE2 ? A HIS 22 ? A HIS 22 ? 1_555 FE ? D HEM . ? A HEM 1001 ? 1_555 NC ? D HEM . ? A HEM 1001 ? 1_555 89.3 ? 5 NA ? D HEM . ? A HEM 1001 ? 1_555 FE ? D HEM . ? A HEM 1001 ? 1_555 NC ? D HEM . ? A HEM 1001 ? 1_555 178.0 ? 6 NB ? D HEM . ? A HEM 1001 ? 1_555 FE ? D HEM . ? A HEM 1001 ? 1_555 NC ? D HEM . ? A HEM 1001 ? 1_555 90.1 ? 7 NE2 ? A HIS 22 ? A HIS 22 ? 1_555 FE ? D HEM . ? A HEM 1001 ? 1_555 ND ? D HEM . ? A HEM 1001 ? 1_555 89.9 ? 8 NA ? D HEM . ? A HEM 1001 ? 1_555 FE ? D HEM . ? A HEM 1001 ? 1_555 ND ? D HEM . ? A HEM 1001 ? 1_555 89.4 ? 9 NB ? D HEM . ? A HEM 1001 ? 1_555 FE ? D HEM . ? A HEM 1001 ? 1_555 ND ? D HEM . ? A HEM 1001 ? 1_555 179.0 ? 10 NC ? D HEM . ? A HEM 1001 ? 1_555 FE ? D HEM . ? A HEM 1001 ? 1_555 ND ? D HEM . ? A HEM 1001 ? 1_555 89.4 ? 11 NE2 ? A HIS 22 ? A HIS 22 ? 1_555 FE ? D HEM . ? A HEM 1001 ? 1_555 NE2 ? A HIS 34 ? A HIS 34 ? 1_555 178.6 ? 12 NA ? D HEM . ? A HEM 1001 ? 1_555 FE ? D HEM . ? A HEM 1001 ? 1_555 NE2 ? A HIS 34 ? A HIS 34 ? 1_555 88.2 ? 13 NB ? D HEM . ? A HEM 1001 ? 1_555 FE ? D HEM . ? A HEM 1001 ? 1_555 NE2 ? A HIS 34 ? A HIS 34 ? 1_555 90.3 ? 14 NC ? D HEM . ? A HEM 1001 ? 1_555 FE ? D HEM . ? A HEM 1001 ? 1_555 NE2 ? A HIS 34 ? A HIS 34 ? 1_555 90.2 ? 15 ND ? D HEM . ? A HEM 1001 ? 1_555 FE ? D HEM . ? A HEM 1001 ? 1_555 NE2 ? A HIS 34 ? A HIS 34 ? 1_555 88.8 ? 16 NE2 ? A HIS 25 ? A HIS 25 ? 1_555 FE ? E HEM . ? A HEM 1003 ? 1_555 NA ? E HEM . ? A HEM 1003 ? 1_555 90.9 ? 17 NE2 ? A HIS 25 ? A HIS 25 ? 1_555 FE ? E HEM . ? A HEM 1003 ? 1_555 NB ? E HEM . ? A HEM 1003 ? 1_555 90.9 ? 18 NA ? E HEM . ? A HEM 1003 ? 1_555 FE ? E HEM . ? A HEM 1003 ? 1_555 NB ? E HEM . ? A HEM 1003 ? 1_555 89.3 ? 19 NE2 ? A HIS 25 ? A HIS 25 ? 1_555 FE ? E HEM . ? A HEM 1003 ? 1_555 NC ? E HEM . ? A HEM 1003 ? 1_555 90.8 ? 20 NA ? E HEM . ? A HEM 1003 ? 1_555 FE ? E HEM . ? A HEM 1003 ? 1_555 NC ? E HEM . ? A HEM 1003 ? 1_555 178.3 ? 21 NB ? E HEM . ? A HEM 1003 ? 1_555 FE ? E HEM . ? A HEM 1003 ? 1_555 NC ? E HEM . ? A HEM 1003 ? 1_555 90.8 ? 22 NE2 ? A HIS 25 ? A HIS 25 ? 1_555 FE ? E HEM . ? A HEM 1003 ? 1_555 ND ? E HEM . ? A HEM 1003 ? 1_555 89.1 ? 23 NA ? E HEM . ? A HEM 1003 ? 1_555 FE ? E HEM . ? A HEM 1003 ? 1_555 ND ? E HEM . ? A HEM 1003 ? 1_555 90.3 ? 24 NB ? E HEM . ? A HEM 1003 ? 1_555 FE ? E HEM . ? A HEM 1003 ? 1_555 ND ? E HEM . ? A HEM 1003 ? 1_555 179.6 ? 25 NC ? E HEM . ? A HEM 1003 ? 1_555 FE ? E HEM . ? A HEM 1003 ? 1_555 ND ? E HEM . ? A HEM 1003 ? 1_555 89.6 ? 26 NE2 ? A HIS 25 ? A HIS 25 ? 1_555 FE ? E HEM . ? A HEM 1003 ? 1_555 NE2 ? A HIS 83 ? A HIS 83 ? 1_555 176.8 ? 27 NA ? E HEM . ? A HEM 1003 ? 1_555 FE ? E HEM . ? A HEM 1003 ? 1_555 NE2 ? A HIS 83 ? A HIS 83 ? 1_555 87.1 ? 28 NB ? E HEM . ? A HEM 1003 ? 1_555 FE ? E HEM . ? A HEM 1003 ? 1_555 NE2 ? A HIS 83 ? A HIS 83 ? 1_555 91.6 ? 29 NC ? E HEM . ? A HEM 1003 ? 1_555 FE ? E HEM . ? A HEM 1003 ? 1_555 NE2 ? A HIS 83 ? A HIS 83 ? 1_555 91.2 ? 30 ND ? E HEM . ? A HEM 1003 ? 1_555 FE ? E HEM . ? A HEM 1003 ? 1_555 NE2 ? A HIS 83 ? A HIS 83 ? 1_555 88.3 ? 31 NE2 ? A HIS 35 ? A HIS 35 ? 1_555 FE ? C HEM . ? A HEM 1002 ? 1_555 NA ? C HEM . ? A HEM 1002 ? 1_555 89.5 ? 32 NE2 ? A HIS 35 ? A HIS 35 ? 1_555 FE ? C HEM . ? A HEM 1002 ? 1_555 NB ? C HEM . ? A HEM 1002 ? 1_555 91.9 ? 33 NA ? C HEM . ? A HEM 1002 ? 1_555 FE ? C HEM . ? A HEM 1002 ? 1_555 NB ? C HEM . ? A HEM 1002 ? 1_555 90.5 ? 34 NE2 ? A HIS 35 ? A HIS 35 ? 1_555 FE ? C HEM . ? A HEM 1002 ? 1_555 NC ? C HEM . ? A HEM 1002 ? 1_555 90.4 ? 35 NA ? C HEM . ? A HEM 1002 ? 1_555 FE ? C HEM . ? A HEM 1002 ? 1_555 NC ? C HEM . ? A HEM 1002 ? 1_555 179.8 ? 36 NB ? C HEM . ? A HEM 1002 ? 1_555 FE ? C HEM . ? A HEM 1002 ? 1_555 NC ? C HEM . ? A HEM 1002 ? 1_555 89.3 ? 37 NE2 ? A HIS 35 ? A HIS 35 ? 1_555 FE ? C HEM . ? A HEM 1002 ? 1_555 ND ? C HEM . ? A HEM 1002 ? 1_555 88.9 ? 38 NA ? C HEM . ? A HEM 1002 ? 1_555 FE ? C HEM . ? A HEM 1002 ? 1_555 ND ? C HEM . ? A HEM 1002 ? 1_555 90.2 ? 39 NB ? C HEM . ? A HEM 1002 ? 1_555 FE ? C HEM . ? A HEM 1002 ? 1_555 ND ? C HEM . ? A HEM 1002 ? 1_555 179.0 ? 40 NC ? C HEM . ? A HEM 1002 ? 1_555 FE ? C HEM . ? A HEM 1002 ? 1_555 ND ? C HEM . ? A HEM 1002 ? 1_555 90.0 ? 41 NE2 ? A HIS 35 ? A HIS 35 ? 1_555 FE ? C HEM . ? A HEM 1002 ? 1_555 NE2 ? A HIS 52 ? A HIS 52 ? 1_555 177.4 ? 42 NA ? C HEM . ? A HEM 1002 ? 1_555 FE ? C HEM . ? A HEM 1002 ? 1_555 NE2 ? A HIS 52 ? A HIS 52 ? 1_555 88.3 ? 43 NB ? C HEM . ? A HEM 1002 ? 1_555 FE ? C HEM . ? A HEM 1002 ? 1_555 NE2 ? A HIS 52 ? A HIS 52 ? 1_555 89.5 ? 44 NC ? C HEM . ? A HEM 1002 ? 1_555 FE ? C HEM . ? A HEM 1002 ? 1_555 NE2 ? A HIS 52 ? A HIS 52 ? 1_555 91.8 ? 45 ND ? C HEM . ? A HEM 1002 ? 1_555 FE ? C HEM . ? A HEM 1002 ? 1_555 NE2 ? A HIS 52 ? A HIS 52 ? 1_555 89.8 ? 46 NE2 ? A HIS 70 ? A HIS 70 ? 1_555 FE ? B HEM . ? A HEM 1004 ? 1_555 NA ? B HEM . ? A HEM 1004 ? 1_555 92.9 ? 47 NE2 ? A HIS 70 ? A HIS 70 ? 1_555 FE ? B HEM . ? A HEM 1004 ? 1_555 NB ? B HEM . ? A HEM 1004 ? 1_555 88.6 ? 48 NA ? B HEM . ? A HEM 1004 ? 1_555 FE ? B HEM . ? A HEM 1004 ? 1_555 NB ? B HEM . ? A HEM 1004 ? 1_555 91.4 ? 49 NE2 ? A HIS 70 ? A HIS 70 ? 1_555 FE ? B HEM . ? A HEM 1004 ? 1_555 NC ? B HEM . ? A HEM 1004 ? 1_555 89.9 ? 50 NA ? B HEM . ? A HEM 1004 ? 1_555 FE ? B HEM . ? A HEM 1004 ? 1_555 NC ? B HEM . ? A HEM 1004 ? 1_555 177.3 ? 51 NB ? B HEM . ? A HEM 1004 ? 1_555 FE ? B HEM . ? A HEM 1004 ? 1_555 NC ? B HEM . ? A HEM 1004 ? 1_555 88.9 ? 52 NE2 ? A HIS 70 ? A HIS 70 ? 1_555 FE ? B HEM . ? A HEM 1004 ? 1_555 ND ? B HEM . ? A HEM 1004 ? 1_555 87.7 ? 53 NA ? B HEM . ? A HEM 1004 ? 1_555 FE ? B HEM . ? A HEM 1004 ? 1_555 ND ? B HEM . ? A HEM 1004 ? 1_555 88.8 ? 54 NB ? B HEM . ? A HEM 1004 ? 1_555 FE ? B HEM . ? A HEM 1004 ? 1_555 ND ? B HEM . ? A HEM 1004 ? 1_555 176.4 ? 55 NC ? B HEM . ? A HEM 1004 ? 1_555 FE ? B HEM . ? A HEM 1004 ? 1_555 ND ? B HEM . ? A HEM 1004 ? 1_555 91.0 ? 56 NE2 ? A HIS 70 ? A HIS 70 ? 1_555 FE ? B HEM . ? A HEM 1004 ? 1_555 NE2 ? A HIS 106 ? A HIS 106 ? 1_555 177.4 ? 57 NA ? B HEM . ? A HEM 1004 ? 1_555 FE ? B HEM . ? A HEM 1004 ? 1_555 NE2 ? A HIS 106 ? A HIS 106 ? 1_555 89.5 ? 58 NB ? B HEM . ? A HEM 1004 ? 1_555 FE ? B HEM . ? A HEM 1004 ? 1_555 NE2 ? A HIS 106 ? A HIS 106 ? 1_555 92.4 ? 59 NC ? B HEM . ? A HEM 1004 ? 1_555 FE ? B HEM . ? A HEM 1004 ? 1_555 NE2 ? A HIS 106 ? A HIS 106 ? 1_555 87.7 ? 60 ND ? B HEM . ? A HEM 1004 ? 1_555 FE ? B HEM . ? A HEM 1004 ? 1_555 NE2 ? A HIS 106 ? A HIS 106 ? 1_555 91.3 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-11-28 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-11-10 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_struct_conn_angle 3 4 'Structure model' struct_conn 4 4 'Structure model' struct_conn_type 5 4 'Structure model' struct_ref_seq_dif 6 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.value' 12 4 'Structure model' '_struct_conn.conn_type_id' 13 4 'Structure model' '_struct_conn.id' 14 4 'Structure model' '_struct_conn.pdbx_dist_value' 15 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 16 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 17 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 18 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 19 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 22 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 23 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 24 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 25 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 27 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 28 4 'Structure model' '_struct_conn_type.id' 29 4 'Structure model' '_struct_ref_seq_dif.details' 30 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 31 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 32 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal SHELX 'model building' . ? 1 SHELXL-97 refinement . ? 2 HKL-2000 'data reduction' . ? 3 CCP4 'data scaling' '(SCALA)' ? 4 SHELX phasing . ? 5 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id CYS _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 51 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -97.77 _pdbx_validate_torsion.psi -125.56 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'PROTOPORPHYRIN IX CONTAINING FE' HEM 3 water HOH #