data_2EYX # _entry.id 2EYX # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2EYX pdb_00002eyx 10.2210/pdb2eyx/pdb RCSB RCSB035264 ? ? WWPDB D_1000035264 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 2EYV . unspecified PDB 2EYW . unspecified PDB 2EYY . unspecified PDB 2EYZ . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2EYX _pdbx_database_status.recvd_initial_deposition_date 2005-11-10 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kobashigawa, Y.' 1 'Tanaka, S.' 2 'Inagaki, F.' 3 # _citation.id primary _citation.title 'Structural basis for the transforming activity of human cancer-related signaling adaptor protein CRK.' _citation.journal_abbrev Nat.Struct.Mol.Biol. _citation.journal_volume 14 _citation.page_first 503 _citation.page_last 510 _citation.year 2007 _citation.journal_id_ASTM ? _citation.country US _citation.journal_id_ISSN 1545-9993 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17515907 _citation.pdbx_database_id_DOI 10.1038/nsmb1241 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kobashigawa, Y.' 1 ? primary 'Sakai, M.' 2 ? primary 'Naito, M.' 3 ? primary 'Yokochi, M.' 4 ? primary 'Kumeta, H.' 5 ? primary 'Makino, Y.' 6 ? primary 'Ogura, K.' 7 ? primary 'Tanaka, S.' 8 ? primary 'Inagaki, F.' 9 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'v-crk sarcoma virus CT10 oncogene homolog isoform a' _entity.formula_weight 7571.612 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'C-terminal SH3 domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'CT10-Regulated Kinase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code NLQNGPIYARVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQN _entity_poly.pdbx_seq_one_letter_code_can NLQNGPIYARVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQN _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASN n 1 2 LEU n 1 3 GLN n 1 4 ASN n 1 5 GLY n 1 6 PRO n 1 7 ILE n 1 8 TYR n 1 9 ALA n 1 10 ARG n 1 11 VAL n 1 12 ILE n 1 13 GLN n 1 14 LYS n 1 15 ARG n 1 16 VAL n 1 17 PRO n 1 18 ASN n 1 19 ALA n 1 20 TYR n 1 21 ASP n 1 22 LYS n 1 23 THR n 1 24 ALA n 1 25 LEU n 1 26 ALA n 1 27 LEU n 1 28 GLU n 1 29 VAL n 1 30 GLY n 1 31 GLU n 1 32 LEU n 1 33 VAL n 1 34 LYS n 1 35 VAL n 1 36 THR n 1 37 LYS n 1 38 ILE n 1 39 ASN n 1 40 VAL n 1 41 SER n 1 42 GLY n 1 43 GLN n 1 44 TRP n 1 45 GLU n 1 46 GLY n 1 47 GLU n 1 48 CYS n 1 49 ASN n 1 50 GLY n 1 51 LYS n 1 52 ARG n 1 53 GLY n 1 54 HIS n 1 55 PHE n 1 56 PRO n 1 57 PHE n 1 58 THR n 1 59 HIS n 1 60 VAL n 1 61 ARG n 1 62 LEU n 1 63 LEU n 1 64 ASP n 1 65 GLN n 1 66 GLN n 1 67 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET22 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q96HJ0_HUMAN _struct_ref.pdbx_db_accession Q96HJ0 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 232 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2EYX _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 67 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q96HJ0 _struct_ref_seq.db_align_beg 232 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 298 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 232 _struct_ref_seq.pdbx_auth_seq_align_end 298 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-SEPARATED_NOESY 1 2 1 '3D_ 13C-SEPARATED_NOESY' 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.ionic_strength 250mM _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.0mM C-terminal SH3 U-15N, 13C PHOSPHATE BUFFER NA; 200MM NACL;90%H2O, 10%D2O' _pdbx_nmr_sample_details.solvent_system ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2EYX _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2EYX _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 1 _pdbx_nmr_ensemble.conformer_selection_criteria ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2EYX _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement CYANA 2.0 'Guetntert P.' 1 'structure solution' XEASY ? ? 2 'structure solution' Olivia ? ? 3 'structure solution' NMRPipe ? ? 4 'structure solution' CYANA 2.0 'Guetntert P.' 5 # _exptl.entry_id 2EYX _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2EYX _struct.title 'C-Terminal SH3 domain of CT10-Regulated Kinase' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2EYX _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text 'SH3, SIGNALING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id THR _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 58 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id VAL _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 60 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id THR _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 289 _struct_conf.end_auth_comp_id VAL _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 291 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ALA A 9 ? VAL A 11 ? ALA A 240 VAL A 242 A 2 GLU A 31 ? ILE A 38 ? GLU A 262 ILE A 269 A 3 GLN A 43 ? CYS A 48 ? GLN A 274 CYS A 279 A 4 LYS A 51 ? PRO A 56 ? LYS A 282 PRO A 287 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ALA A 9 ? N ALA A 240 O VAL A 33 ? O VAL A 264 A 2 3 N LYS A 37 ? N LYS A 268 O GLU A 45 ? O GLU A 276 A 3 4 N CYS A 48 ? N CYS A 279 O LYS A 51 ? O LYS A 282 # _database_PDB_matrix.entry_id 2EYX _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2EYX _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASN 1 232 232 ASN ASN A . n A 1 2 LEU 2 233 233 LEU LEU A . n A 1 3 GLN 3 234 234 GLN GLN A . n A 1 4 ASN 4 235 235 ASN ASN A . n A 1 5 GLY 5 236 236 GLY GLY A . n A 1 6 PRO 6 237 237 PRO PRO A . n A 1 7 ILE 7 238 238 ILE ILE A . n A 1 8 TYR 8 239 239 TYR TYR A . n A 1 9 ALA 9 240 240 ALA ALA A . n A 1 10 ARG 10 241 241 ARG ARG A . n A 1 11 VAL 11 242 242 VAL VAL A . n A 1 12 ILE 12 243 243 ILE ILE A . n A 1 13 GLN 13 244 244 GLN GLN A . n A 1 14 LYS 14 245 245 LYS LYS A . n A 1 15 ARG 15 246 246 ARG ARG A . n A 1 16 VAL 16 247 247 VAL VAL A . n A 1 17 PRO 17 248 248 PRO PRO A . n A 1 18 ASN 18 249 249 ASN ASN A . n A 1 19 ALA 19 250 250 ALA ALA A . n A 1 20 TYR 20 251 251 TYR TYR A . n A 1 21 ASP 21 252 252 ASP ASP A . n A 1 22 LYS 22 253 253 LYS LYS A . n A 1 23 THR 23 254 254 THR THR A . n A 1 24 ALA 24 255 255 ALA ALA A . n A 1 25 LEU 25 256 256 LEU LEU A . n A 1 26 ALA 26 257 257 ALA ALA A . n A 1 27 LEU 27 258 258 LEU LEU A . n A 1 28 GLU 28 259 259 GLU GLU A . n A 1 29 VAL 29 260 260 VAL VAL A . n A 1 30 GLY 30 261 261 GLY GLY A . n A 1 31 GLU 31 262 262 GLU GLU A . n A 1 32 LEU 32 263 263 LEU LEU A . n A 1 33 VAL 33 264 264 VAL VAL A . n A 1 34 LYS 34 265 265 LYS LYS A . n A 1 35 VAL 35 266 266 VAL VAL A . n A 1 36 THR 36 267 267 THR THR A . n A 1 37 LYS 37 268 268 LYS LYS A . n A 1 38 ILE 38 269 269 ILE ILE A . n A 1 39 ASN 39 270 270 ASN ASN A . n A 1 40 VAL 40 271 271 VAL VAL A . n A 1 41 SER 41 272 272 SER SER A . n A 1 42 GLY 42 273 273 GLY GLY A . n A 1 43 GLN 43 274 274 GLN GLN A . n A 1 44 TRP 44 275 275 TRP TRP A . n A 1 45 GLU 45 276 276 GLU GLU A . n A 1 46 GLY 46 277 277 GLY GLY A . n A 1 47 GLU 47 278 278 GLU GLU A . n A 1 48 CYS 48 279 279 CYS CYS A . n A 1 49 ASN 49 280 280 ASN ASN A . n A 1 50 GLY 50 281 281 GLY GLY A . n A 1 51 LYS 51 282 282 LYS LYS A . n A 1 52 ARG 52 283 283 ARG ARG A . n A 1 53 GLY 53 284 284 GLY GLY A . n A 1 54 HIS 54 285 285 HIS HIS A . n A 1 55 PHE 55 286 286 PHE PHE A . n A 1 56 PRO 56 287 287 PRO PRO A . n A 1 57 PHE 57 288 288 PHE PHE A . n A 1 58 THR 58 289 289 THR THR A . n A 1 59 HIS 59 290 290 HIS HIS A . n A 1 60 VAL 60 291 291 VAL VAL A . n A 1 61 ARG 61 292 292 ARG ARG A . n A 1 62 LEU 62 293 293 LEU LEU A . n A 1 63 LEU 63 294 294 LEU LEU A . n A 1 64 ASP 64 295 295 ASP ASP A . n A 1 65 GLN 65 296 296 GLN GLN A . n A 1 66 GLN 66 297 297 GLN GLN A . n A 1 67 ASN 67 298 298 ASN ASN A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-11-10 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 251 ? ? -91.61 41.31 2 1 VAL A 260 ? ? -36.00 119.65 3 1 VAL A 266 ? ? -51.25 -163.48 4 1 THR A 267 ? ? -134.20 -39.02 5 1 PRO A 287 ? ? -69.76 97.73 6 1 THR A 289 ? ? -69.83 0.84 #