data_2FB0
# 
_entry.id   2FB0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.398 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2FB0         pdb_00002fb0 10.2210/pdb2fb0/pdb 
RCSB  RCSB035668   ?            ?                   
WWPDB D_1000035668 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-01-24 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-18 
5 'Structure model' 1 4 2024-10-30 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Source and taxonomy'       
4 3 'Structure model' 'Version format compliance' 
5 4 'Structure model' 'Refinement description'    
6 5 'Structure model' 'Data collection'           
7 5 'Structure model' 'Database references'       
8 5 'Structure model' 'Derived calculations'      
9 5 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' software                  
2 5 'Structure model' chem_comp_atom            
3 5 'Structure model' chem_comp_bond            
4 5 'Structure model' database_2                
5 5 'Structure model' pdbx_entry_details        
6 5 'Structure model' pdbx_modification_feature 
7 5 'Structure model' struct_conn               
8 5 'Structure model' struct_ref_seq_dif        
9 5 'Structure model' struct_site               
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_software.classification'            
2 4 'Structure model' '_software.name'                      
3 5 'Structure model' '_database_2.pdbx_DOI'                
4 5 'Structure model' '_database_2.pdbx_database_accession' 
5 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 
6 5 'Structure model' '_struct_ref_seq_dif.details'         
7 5 'Structure model' '_struct_site.pdbx_auth_asym_id'      
8 5 'Structure model' '_struct_site.pdbx_auth_comp_id'      
9 5 'Structure model' '_struct_site.pdbx_auth_seq_id'       
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2FB0 
_pdbx_database_status.recvd_initial_deposition_date   2005-12-08 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB      1x7v     'CRYSTAL STRUCTURE OF PA3566 FROM PSEUDOMONAS AERUGINOSA' unspecified 
TargetDB APC81531 .                                                         unspecified 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Nocek, B.'                                     1 
'Hatzos, C.'                                    2 
'Abdullah, J.'                                  3 
'Collart, F.'                                   4 
'Joachimiak, A.'                                5 
'Midwest Center for Structural Genomics (MCSG)' 6 
# 
_citation.id                        primary 
_citation.title                     
;Crystal structure of conserved hypothetical protein from Bacteroides thetaiotaomicron VPI-5482   
at 2.10 resolution
;
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Nocek, B.'      1 ? 
primary 'Hatzos, C.'     2 ? 
primary 'Abdullah, J.'   3 ? 
primary 'Collart, F.'    4 ? 
primary 'Joachimiak, A.' 5 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'conserved hypothetical protein' 10961.977 1  ? ? ? ? 
2 non-polymer syn 'ACETATE ION'                    59.044    1  ? ? ? ? 
3 non-polymer syn GLYCEROL                         92.094    4  ? ? ? ? 
4 water       nat water                            18.015    86 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;ANS(MSE)IRLNVFVRVNETNREKAIEAAKELTACSLKEEGCIAYDTFESSTRRDVF(MSE)ICETWQNAEVLAAHEKTA
HFAQYVGIIQELAE(MSE)KLEKFEF
;
_entity_poly.pdbx_seq_one_letter_code_can   
;ANSMIRLNVFVRVNETNREKAIEAAKELTACSLKEEGCIAYDTFESSTRRDVFMICETWQNAEVLAAHEKTAHFAQYVGI
IQELAEMKLEKFEF
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         APC81531 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ACETATE ION' ACT 
3 GLYCEROL      GOL 
4 water         HOH 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ALA n 
1 2  ASN n 
1 3  SER n 
1 4  MSE n 
1 5  ILE n 
1 6  ARG n 
1 7  LEU n 
1 8  ASN n 
1 9  VAL n 
1 10 PHE n 
1 11 VAL n 
1 12 ARG n 
1 13 VAL n 
1 14 ASN n 
1 15 GLU n 
1 16 THR n 
1 17 ASN n 
1 18 ARG n 
1 19 GLU n 
1 20 LYS n 
1 21 ALA n 
1 22 ILE n 
1 23 GLU n 
1 24 ALA n 
1 25 ALA n 
1 26 LYS n 
1 27 GLU n 
1 28 LEU n 
1 29 THR n 
1 30 ALA n 
1 31 CYS n 
1 32 SER n 
1 33 LEU n 
1 34 LYS n 
1 35 GLU n 
1 36 GLU n 
1 37 GLY n 
1 38 CYS n 
1 39 ILE n 
1 40 ALA n 
1 41 TYR n 
1 42 ASP n 
1 43 THR n 
1 44 PHE n 
1 45 GLU n 
1 46 SER n 
1 47 SER n 
1 48 THR n 
1 49 ARG n 
1 50 ARG n 
1 51 ASP n 
1 52 VAL n 
1 53 PHE n 
1 54 MSE n 
1 55 ILE n 
1 56 CYS n 
1 57 GLU n 
1 58 THR n 
1 59 TRP n 
1 60 GLN n 
1 61 ASN n 
1 62 ALA n 
1 63 GLU n 
1 64 VAL n 
1 65 LEU n 
1 66 ALA n 
1 67 ALA n 
1 68 HIS n 
1 69 GLU n 
1 70 LYS n 
1 71 THR n 
1 72 ALA n 
1 73 HIS n 
1 74 PHE n 
1 75 ALA n 
1 76 GLN n 
1 77 TYR n 
1 78 VAL n 
1 79 GLY n 
1 80 ILE n 
1 81 ILE n 
1 82 GLN n 
1 83 GLU n 
1 84 LEU n 
1 85 ALA n 
1 86 GLU n 
1 87 MSE n 
1 88 LYS n 
1 89 LEU n 
1 90 GLU n 
1 91 LYS n 
1 92 PHE n 
1 93 GLU n 
1 94 PHE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Bacteroides 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   'Bacteroides thetaiotaomicron' 
_entity_src_gen.gene_src_strain                    VPI-5482 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Bacteroides thetaiotaomicron' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     226186 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'Bl21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       peT15b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACT non-polymer         . 'ACETATE ION'    ?                               'C2 H3 O2 -1'    59.044  
ALA 'L-peptide linking' y ALANINE          ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE         ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE       ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'  ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE         ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE        ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'  ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE          ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL         'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE        ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER            ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE       ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE          ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE           ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE       ?                               'C5 H11 N O2 S'  149.211 
MSE 'L-peptide linking' n SELENOMETHIONINE ?                               'C5 H11 N O2 Se' 196.106 
PHE 'L-peptide linking' y PHENYLALANINE    ?                               'C9 H11 N O2'    165.189 
SER 'L-peptide linking' y SERINE           ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE        ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN       ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE         ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE           ?                               'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  ALA 1  -2 -2 ALA ALA A . n 
A 1 2  ASN 2  -1 -1 ASN ASN A . n 
A 1 3  SER 3  0  0  SER SER A . n 
A 1 4  MSE 4  1  1  MSE MSE A . n 
A 1 5  ILE 5  2  2  ILE ILE A . n 
A 1 6  ARG 6  3  3  ARG ARG A . n 
A 1 7  LEU 7  4  4  LEU LEU A . n 
A 1 8  ASN 8  5  5  ASN ASN A . n 
A 1 9  VAL 9  6  6  VAL VAL A . n 
A 1 10 PHE 10 7  7  PHE PHE A . n 
A 1 11 VAL 11 8  8  VAL VAL A . n 
A 1 12 ARG 12 9  9  ARG ARG A . n 
A 1 13 VAL 13 10 10 VAL VAL A . n 
A 1 14 ASN 14 11 11 ASN ASN A . n 
A 1 15 GLU 15 12 12 GLU GLU A . n 
A 1 16 THR 16 13 13 THR THR A . n 
A 1 17 ASN 17 14 14 ASN ASN A . n 
A 1 18 ARG 18 15 15 ARG ARG A . n 
A 1 19 GLU 19 16 16 GLU GLU A . n 
A 1 20 LYS 20 17 17 LYS LYS A . n 
A 1 21 ALA 21 18 18 ALA ALA A . n 
A 1 22 ILE 22 19 19 ILE ILE A . n 
A 1 23 GLU 23 20 20 GLU GLU A . n 
A 1 24 ALA 24 21 21 ALA ALA A . n 
A 1 25 ALA 25 22 22 ALA ALA A . n 
A 1 26 LYS 26 23 23 LYS LYS A . n 
A 1 27 GLU 27 24 24 GLU GLU A . n 
A 1 28 LEU 28 25 25 LEU LEU A . n 
A 1 29 THR 29 26 26 THR THR A . n 
A 1 30 ALA 30 27 27 ALA ALA A . n 
A 1 31 CYS 31 28 28 CYS CYS A . n 
A 1 32 SER 32 29 29 SER SER A . n 
A 1 33 LEU 33 30 30 LEU LEU A . n 
A 1 34 LYS 34 31 31 LYS LYS A . n 
A 1 35 GLU 35 32 32 GLU GLU A . n 
A 1 36 GLU 36 33 33 GLU GLU A . n 
A 1 37 GLY 37 34 34 GLY GLY A . n 
A 1 38 CYS 38 35 35 CYS CYS A . n 
A 1 39 ILE 39 36 36 ILE ILE A . n 
A 1 40 ALA 40 37 37 ALA ALA A . n 
A 1 41 TYR 41 38 38 TYR TYR A . n 
A 1 42 ASP 42 39 39 ASP ASP A . n 
A 1 43 THR 43 40 40 THR THR A . n 
A 1 44 PHE 44 41 41 PHE PHE A . n 
A 1 45 GLU 45 42 42 GLU GLU A . n 
A 1 46 SER 46 43 43 SER SER A . n 
A 1 47 SER 47 44 44 SER SER A . n 
A 1 48 THR 48 45 45 THR THR A . n 
A 1 49 ARG 49 46 46 ARG ARG A . n 
A 1 50 ARG 50 47 47 ARG ARG A . n 
A 1 51 ASP 51 48 48 ASP ASP A . n 
A 1 52 VAL 52 49 49 VAL VAL A . n 
A 1 53 PHE 53 50 50 PHE PHE A . n 
A 1 54 MSE 54 51 51 MSE MSE A . n 
A 1 55 ILE 55 52 52 ILE ILE A . n 
A 1 56 CYS 56 53 53 CYS CYS A . n 
A 1 57 GLU 57 54 54 GLU GLU A . n 
A 1 58 THR 58 55 55 THR THR A . n 
A 1 59 TRP 59 56 56 TRP TRP A . n 
A 1 60 GLN 60 57 57 GLN GLN A . n 
A 1 61 ASN 61 58 58 ASN ASN A . n 
A 1 62 ALA 62 59 59 ALA ALA A . n 
A 1 63 GLU 63 60 60 GLU GLU A . n 
A 1 64 VAL 64 61 61 VAL VAL A . n 
A 1 65 LEU 65 62 62 LEU LEU A . n 
A 1 66 ALA 66 63 63 ALA ALA A . n 
A 1 67 ALA 67 64 64 ALA ALA A . n 
A 1 68 HIS 68 65 65 HIS HIS A . n 
A 1 69 GLU 69 66 66 GLU GLU A . n 
A 1 70 LYS 70 67 67 LYS LYS A . n 
A 1 71 THR 71 68 68 THR THR A . n 
A 1 72 ALA 72 69 69 ALA ALA A . n 
A 1 73 HIS 73 70 70 HIS HIS A . n 
A 1 74 PHE 74 71 71 PHE PHE A . n 
A 1 75 ALA 75 72 72 ALA ALA A . n 
A 1 76 GLN 76 73 73 GLN GLN A . n 
A 1 77 TYR 77 74 74 TYR TYR A . n 
A 1 78 VAL 78 75 75 VAL VAL A . n 
A 1 79 GLY 79 76 76 GLY GLY A . n 
A 1 80 ILE 80 77 77 ILE ILE A . n 
A 1 81 ILE 81 78 78 ILE ILE A . n 
A 1 82 GLN 82 79 79 GLN GLN A . n 
A 1 83 GLU 83 80 80 GLU GLU A . n 
A 1 84 LEU 84 81 81 LEU LEU A . n 
A 1 85 ALA 85 82 82 ALA ALA A . n 
A 1 86 GLU 86 83 83 GLU GLU A . n 
A 1 87 MSE 87 84 84 MSE MSE A . n 
A 1 88 LYS 88 85 85 LYS LYS A . n 
A 1 89 LEU 89 86 86 LEU LEU A . n 
A 1 90 GLU 90 87 87 GLU GLU A . n 
A 1 91 LYS 91 88 88 LYS LYS A . n 
A 1 92 PHE 92 89 89 PHE PHE A . n 
A 1 93 GLU 93 90 90 GLU GLU A . n 
A 1 94 PHE 94 91 91 PHE PHE A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 ACT 1  901 901 ACT ACT A . 
C 3 GOL 1  801 801 GOL GOL A . 
D 3 GOL 1  802 802 GOL GOL A . 
E 3 GOL 1  803 803 GOL GOL A . 
F 3 GOL 1  804 804 GOL GOL A . 
G 4 HOH 1  93  93  HOH HOH A . 
G 4 HOH 2  95  95  HOH HOH A . 
G 4 HOH 3  97  97  HOH HOH A . 
G 4 HOH 4  98  98  HOH HOH A . 
G 4 HOH 5  99  99  HOH HOH A . 
G 4 HOH 6  100 100 HOH HOH A . 
G 4 HOH 7  101 101 HOH HOH A . 
G 4 HOH 8  102 102 HOH HOH A . 
G 4 HOH 9  103 103 HOH HOH A . 
G 4 HOH 10 104 104 HOH HOH A . 
G 4 HOH 11 105 105 HOH HOH A . 
G 4 HOH 12 106 106 HOH HOH A . 
G 4 HOH 13 107 107 HOH HOH A . 
G 4 HOH 14 108 108 HOH HOH A . 
G 4 HOH 15 110 110 HOH HOH A . 
G 4 HOH 16 111 111 HOH HOH A . 
G 4 HOH 17 112 112 HOH HOH A . 
G 4 HOH 18 113 113 HOH HOH A . 
G 4 HOH 19 114 114 HOH HOH A . 
G 4 HOH 20 115 115 HOH HOH A . 
G 4 HOH 21 116 116 HOH HOH A . 
G 4 HOH 22 117 117 HOH HOH A . 
G 4 HOH 23 118 118 HOH HOH A . 
G 4 HOH 24 119 119 HOH HOH A . 
G 4 HOH 25 120 120 HOH HOH A . 
G 4 HOH 26 121 121 HOH HOH A . 
G 4 HOH 27 122 122 HOH HOH A . 
G 4 HOH 28 123 123 HOH HOH A . 
G 4 HOH 29 124 124 HOH HOH A . 
G 4 HOH 30 125 125 HOH HOH A . 
G 4 HOH 31 126 126 HOH HOH A . 
G 4 HOH 32 127 127 HOH HOH A . 
G 4 HOH 33 128 128 HOH HOH A . 
G 4 HOH 34 129 129 HOH HOH A . 
G 4 HOH 35 130 130 HOH HOH A . 
G 4 HOH 36 131 131 HOH HOH A . 
G 4 HOH 37 132 132 HOH HOH A . 
G 4 HOH 38 133 133 HOH HOH A . 
G 4 HOH 39 134 134 HOH HOH A . 
G 4 HOH 40 135 135 HOH HOH A . 
G 4 HOH 41 136 136 HOH HOH A . 
G 4 HOH 42 137 137 HOH HOH A . 
G 4 HOH 43 138 138 HOH HOH A . 
G 4 HOH 44 139 139 HOH HOH A . 
G 4 HOH 45 140 140 HOH HOH A . 
G 4 HOH 46 141 141 HOH HOH A . 
G 4 HOH 47 142 142 HOH HOH A . 
G 4 HOH 48 143 143 HOH HOH A . 
G 4 HOH 49 144 144 HOH HOH A . 
G 4 HOH 50 145 145 HOH HOH A . 
G 4 HOH 51 147 147 HOH HOH A . 
G 4 HOH 52 148 148 HOH HOH A . 
G 4 HOH 53 149 149 HOH HOH A . 
G 4 HOH 54 150 150 HOH HOH A . 
G 4 HOH 55 151 151 HOH HOH A . 
G 4 HOH 56 152 152 HOH HOH A . 
G 4 HOH 57 153 153 HOH HOH A . 
G 4 HOH 58 156 156 HOH HOH A . 
G 4 HOH 59 157 157 HOH HOH A . 
G 4 HOH 60 159 159 HOH HOH A . 
G 4 HOH 61 160 160 HOH HOH A . 
G 4 HOH 62 161 161 HOH HOH A . 
G 4 HOH 63 162 162 HOH HOH A . 
G 4 HOH 64 163 163 HOH HOH A . 
G 4 HOH 65 164 164 HOH HOH A . 
G 4 HOH 66 165 165 HOH HOH A . 
G 4 HOH 67 166 166 HOH HOH A . 
G 4 HOH 68 167 167 HOH HOH A . 
G 4 HOH 69 168 168 HOH HOH A . 
G 4 HOH 70 171 171 HOH HOH A . 
G 4 HOH 71 173 173 HOH HOH A . 
G 4 HOH 72 174 174 HOH HOH A . 
G 4 HOH 73 175 175 HOH HOH A . 
G 4 HOH 74 176 176 HOH HOH A . 
G 4 HOH 75 177 177 HOH HOH A . 
G 4 HOH 76 178 178 HOH HOH A . 
G 4 HOH 77 179 179 HOH HOH A . 
G 4 HOH 78 180 180 HOH HOH A . 
G 4 HOH 79 181 181 HOH HOH A . 
G 4 HOH 80 182 182 HOH HOH A . 
G 4 HOH 81 183 183 HOH HOH A . 
G 4 HOH 82 184 184 HOH HOH A . 
G 4 HOH 83 185 185 HOH HOH A . 
G 4 HOH 84 186 186 HOH HOH A . 
G 4 HOH 85 187 187 HOH HOH A . 
G 4 HOH 86 188 188 HOH HOH A . 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC      refinement        5.2.0005 ? 1 
SBC-Collect 'data collection' .        ? 2 
HKL-2000    'data scaling'    .        ? 3 
HKL-3000    phasing           .        ? 4 
SHELX       phasing           .        ? 5 
CCP4        phasing           .        ? 6 
ARP/wARP    'model building'  .        ? 7 
SOLVE       phasing           .        ? 8 
RESOLVE     phasing           .        ? 9 
# 
_cell.entry_id           2FB0 
_cell.length_a           118.360 
_cell.length_b           118.360 
_cell.length_c           118.360 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              24 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2FB0 
_symmetry.space_group_name_H-M             'P 41 3 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                213 
_symmetry.space_group_name_Hall            ? 
# 
_exptl.entry_id          2FB0 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.5 
_exptl_crystal_grow.pdbx_details    '2M Ammonium Acetate, pH 4.5, VAPOR DIFFUSION, SITTING DROP, temperature 291K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2005-11-04 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si 111 channel' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9795 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9795 
# 
_reflns.entry_id                     2FB0 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.10 
_reflns.number_obs                   17077 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         100 
_reflns.pdbx_Rmerge_I_obs            0.11 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        36.23 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              24.8 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.10 
_reflns_shell.d_res_low              2.157 
_reflns_shell.percent_possible_all   99.92 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2FB0 
_refine.ls_number_reflns_obs                     16187 
_refine.ls_number_reflns_all                     17053 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             50.00 
_refine.ls_d_res_high                            2.10 
_refine.ls_percent_reflns_obs                    99.85 
_refine.ls_R_factor_obs                          0.19864 
_refine.ls_R_factor_all                          0.1986 
_refine.ls_R_factor_R_work                       0.19723 
_refine.ls_R_factor_R_free                       0.2244 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  866 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.947 
_refine.correlation_coeff_Fo_to_Fc_free          0.932 
_refine.B_iso_mean                               30.572 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.114 
_refine.pdbx_overall_ESU_R_Free                  0.114 
_refine.overall_SU_ML                            0.071 
_refine.overall_SU_B                             2.577 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        757 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         28 
_refine_hist.number_atoms_solvent             86 
_refine_hist.number_atoms_total               871 
_refine_hist.d_res_high                       2.10 
_refine_hist.d_res_low                        50.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.011  0.022  ? 832  'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.120  1.959  ? 1117 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.551  5.000  ? 101  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       32.733 24.651 ? 43   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       12.357 15.000 ? 152  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       11.302 15.000 ? 6    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.086  0.200  ? 121  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.005  0.020  ? 626  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.185  0.200  ? 376  'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.294  0.200  ? 572  'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.132  0.200  ? 78   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.199  0.200  ? 37   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.133  0.200  ? 16   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.856  1.500  ? 515  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.391  2.000  ? 798  'X-RAY DIFFRACTION' ? 
r_scbond_it                  2.193  3.000  ? 357  'X-RAY DIFFRACTION' ? 
r_scangle_it                 3.529  4.500  ? 319  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.102 
_refine_ls_shell.d_res_low                        2.157 
_refine_ls_shell.number_reflns_R_work             1170 
_refine_ls_shell.R_factor_R_work                  0.23 
_refine_ls_shell.percent_reflns_obs               99.92 
_refine_ls_shell.R_factor_R_free                  0.274 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             57 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_database_PDB_matrix.entry_id          2FB0 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_struct.entry_id                  2FB0 
_struct.title                     
;Crystal Structure of Conserved Protein of Unknown Function from Bacteroides thetaiotaomicron VPI-5482 at 2.10 A Resolution, Possible Oxidoreductase
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2FB0 
_struct_keywords.pdbx_keywords   'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' 
_struct_keywords.text            
;Conserved hypothetical protein, SAD, Bacteroides thetaiotaomicron, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    GB 
_struct_ref.db_code                    AAO76535 
_struct_ref.pdbx_db_accession          29338735 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MIRLNVFVRVNETNREKAIEAAKELTACSLKEEGCIAYDTFESSTRRDVFMICETWQNAEVLAAHEKTAHFAQYVGIIQE
LAEMKLEKFEF
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2FB0 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 4 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 94 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             29338735 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  91 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       91 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2FB0 ALA A 1  ? GB 29338735 ?   ?  'cloning artifact' -2 1 
1 2FB0 ASN A 2  ? GB 29338735 ?   ?  'cloning artifact' -1 2 
1 2FB0 SER A 3  ? GB 29338735 ?   ?  'cloning artifact' 0  3 
1 2FB0 MSE A 4  ? GB 29338735 MET 1  'modified residue' 1  4 
1 2FB0 MSE A 54 ? GB 29338735 MET 51 'modified residue' 51 5 
1 2FB0 MSE A 87 ? GB 29338735 MET 84 'modified residue' 84 6 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA,PQS 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3330 ? 
1 MORE         -16  ? 
1 'SSA (A^2)'  9750 ? 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555  x,y,z                1.0000000000 0.0000000000 0.0000000000  0.0000000000  0.0000000000 
1.0000000000  0.0000000000 0.0000000000  0.0000000000  0.0000000000 1.0000000000 0.0000000000  
2 'crystal symmetry operation' 24_555 -z+3/4,-y+3/4,-x+3/4 0.0000000000 0.0000000000 -1.0000000000 88.7700000000 0.0000000000 
-1.0000000000 0.0000000000 88.7700000000 -1.0000000000 0.0000000000 0.0000000000 88.7700000000 
# 
_struct_biol.id                    1 
_struct_biol.details               'Based on the analysis of crystal packing homodimer seems to be the biological unit' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASN A 17 ? LEU A 33 ? ASN A 14 LEU A 30 1 ? 17 
HELX_P HELX_P2 2 ASN A 61 ? GLU A 69 ? ASN A 58 GLU A 66 1 ? 9  
HELX_P HELX_P3 3 THR A 71 ? ALA A 85 ? THR A 68 ALA A 82 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1 covale both ? A SER 3  C ? ? ? 1_555 A MSE 4  N ? ? A SER 0  A MSE 1  1_555 ? ? ? ? ? ? ? 1.334 ? ? 
covale2 covale both ? A MSE 4  C ? ? ? 1_555 A ILE 5  N A ? A MSE 1  A ILE 2  1_555 ? ? ? ? ? ? ? 1.327 ? ? 
covale3 covale both ? A MSE 4  C ? ? ? 1_555 A ILE 5  N B ? A MSE 1  A ILE 2  1_555 ? ? ? ? ? ? ? 1.329 ? ? 
covale4 covale both ? A PHE 53 C ? ? ? 1_555 A MSE 54 N ? ? A PHE 50 A MSE 51 1_555 ? ? ? ? ? ? ? 1.331 ? ? 
covale5 covale both ? A MSE 54 C ? ? ? 1_555 A ILE 55 N ? ? A MSE 51 A ILE 52 1_555 ? ? ? ? ? ? ? 1.325 ? ? 
covale6 covale both ? A GLU 86 C ? ? ? 1_555 A MSE 87 N ? ? A GLU 83 A MSE 84 1_555 ? ? ? ? ? ? ? 1.327 ? ? 
covale7 covale both ? A MSE 87 C ? ? ? 1_555 A LYS 88 N ? ? A MSE 84 A LYS 85 1_555 ? ? ? ? ? ? ? 1.332 ? ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_pdbx_modification_feature.ordinal 
_pdbx_modification_feature.label_comp_id 
_pdbx_modification_feature.label_asym_id 
_pdbx_modification_feature.label_seq_id 
_pdbx_modification_feature.label_alt_id 
_pdbx_modification_feature.modified_residue_label_comp_id 
_pdbx_modification_feature.modified_residue_label_asym_id 
_pdbx_modification_feature.modified_residue_label_seq_id 
_pdbx_modification_feature.modified_residue_label_alt_id 
_pdbx_modification_feature.auth_comp_id 
_pdbx_modification_feature.auth_asym_id 
_pdbx_modification_feature.auth_seq_id 
_pdbx_modification_feature.PDB_ins_code 
_pdbx_modification_feature.symmetry 
_pdbx_modification_feature.modified_residue_auth_comp_id 
_pdbx_modification_feature.modified_residue_auth_asym_id 
_pdbx_modification_feature.modified_residue_auth_seq_id 
_pdbx_modification_feature.modified_residue_PDB_ins_code 
_pdbx_modification_feature.modified_residue_symmetry 
_pdbx_modification_feature.comp_id_linking_atom 
_pdbx_modification_feature.modified_residue_id_linking_atom 
_pdbx_modification_feature.modified_residue_id 
_pdbx_modification_feature.ref_pcm_id 
_pdbx_modification_feature.ref_comp_id 
_pdbx_modification_feature.type 
_pdbx_modification_feature.category 
1 MSE A 4  ? . . . . MSE A 1  ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 
2 MSE A 54 ? . . . . MSE A 51 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 
3 MSE A 87 ? . . . . MSE A 84 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          ALA 
_struct_mon_prot_cis.label_seq_id           1 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           ALA 
_struct_mon_prot_cis.auth_seq_id            -2 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   ASN 
_struct_mon_prot_cis.pdbx_label_seq_id_2    2 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    ASN 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     -1 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -9.81 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   4 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 CYS A 38 ? GLU A 45 ? CYS A 35 GLU A 42 
A 2 VAL A 52 ? TRP A 59 ? VAL A 49 TRP A 56 
A 3 ILE A 5  ? ARG A 12 ? ILE A 2  ARG A 9  
A 4 GLU A 86 ? GLU A 93 ? GLU A 83 GLU A 90 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N PHE A 44 ? N PHE A 41 O MSE A 54 ? O MSE A 51 
A 2 3 O ILE A 55 ? O ILE A 52 N VAL A 9  ? N VAL A 6  
A 3 4 N ARG A 6  ? N ARG A 3  O PHE A 92 ? O PHE A 89 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ACT 901 ? 4 'BINDING SITE FOR RESIDUE ACT A 901' 
AC2 Software A GOL 801 ? 3 'BINDING SITE FOR RESIDUE GOL A 801' 
AC3 Software A GOL 802 ? 2 'BINDING SITE FOR RESIDUE GOL A 802' 
AC4 Software A GOL 803 ? 4 'BINDING SITE FOR RESIDUE GOL A 803' 
AC5 Software A GOL 804 ? 5 'BINDING SITE FOR RESIDUE GOL A 804' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 TYR A 41 ? TYR A 38  . ? 1_555  ? 
2  AC1 4 GLU A 57 ? GLU A 54  . ? 1_555  ? 
3  AC1 4 HIS A 68 ? HIS A 65  . ? 1_555  ? 
4  AC1 4 PHE A 74 ? PHE A 71  . ? 1_555  ? 
5  AC2 3 ALA A 72 ? ALA A 69  . ? 1_555  ? 
6  AC2 3 HIS A 73 ? HIS A 70  . ? 1_555  ? 
7  AC2 3 HOH G .  ? HOH A 168 . ? 1_555  ? 
8  AC3 2 ARG A 50 ? ARG A 47  . ? 1_555  ? 
9  AC3 2 HOH G .  ? HOH A 103 . ? 1_555  ? 
10 AC4 4 ARG A 12 ? ARG A 9   . ? 1_555  ? 
11 AC4 4 ASN A 14 ? ASN A 11  . ? 7_564  ? 
12 AC4 4 ARG A 49 ? ARG A 46  . ? 1_555  ? 
13 AC4 4 ASP A 51 ? ASP A 48  . ? 1_555  ? 
14 AC5 5 GLU A 90 ? GLU A 87  . ? 1_555  ? 
15 AC5 5 LYS A 91 ? LYS A 88  . ? 1_555  ? 
16 AC5 5 PHE A 92 ? PHE A 89  . ? 1_555  ? 
17 AC5 5 PHE A 94 ? PHE A 91  . ? 24_555 ? 
18 AC5 5 HOH G .  ? HOH A 174 . ? 1_555  ? 
# 
_pdbx_entry_details.entry_id                   2FB0 
_pdbx_entry_details.compound_details           ? 
_pdbx_entry_details.source_details             ? 
_pdbx_entry_details.nonpolymer_details         ? 
_pdbx_entry_details.sequence_details           ? 
_pdbx_entry_details.has_ligand_of_interest     ? 
_pdbx_entry_details.has_protein_modification   Y 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OE1 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   GLU 
_pdbx_validate_close_contact.auth_seq_id_1    24 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   A 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    131 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.15 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          'PSI, Protein Structure Initiative' 
_pdbx_SG_project.full_name_of_center   'Midwest Center for Structural Genomics' 
_pdbx_SG_project.initial_of_center     MCSG 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A MSE 4  A MSE 1  ? MET SELENOMETHIONINE 
2 A MSE 54 A MSE 51 ? MET SELENOMETHIONINE 
3 A MSE 87 A MSE 84 ? MET SELENOMETHIONINE 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ACT C    C  N N 1   
ACT O    O  N N 2   
ACT OXT  O  N N 3   
ACT CH3  C  N N 4   
ACT H1   H  N N 5   
ACT H2   H  N N 6   
ACT H3   H  N N 7   
ALA N    N  N N 8   
ALA CA   C  N S 9   
ALA C    C  N N 10  
ALA O    O  N N 11  
ALA CB   C  N N 12  
ALA OXT  O  N N 13  
ALA H    H  N N 14  
ALA H2   H  N N 15  
ALA HA   H  N N 16  
ALA HB1  H  N N 17  
ALA HB2  H  N N 18  
ALA HB3  H  N N 19  
ALA HXT  H  N N 20  
ARG N    N  N N 21  
ARG CA   C  N S 22  
ARG C    C  N N 23  
ARG O    O  N N 24  
ARG CB   C  N N 25  
ARG CG   C  N N 26  
ARG CD   C  N N 27  
ARG NE   N  N N 28  
ARG CZ   C  N N 29  
ARG NH1  N  N N 30  
ARG NH2  N  N N 31  
ARG OXT  O  N N 32  
ARG H    H  N N 33  
ARG H2   H  N N 34  
ARG HA   H  N N 35  
ARG HB2  H  N N 36  
ARG HB3  H  N N 37  
ARG HG2  H  N N 38  
ARG HG3  H  N N 39  
ARG HD2  H  N N 40  
ARG HD3  H  N N 41  
ARG HE   H  N N 42  
ARG HH11 H  N N 43  
ARG HH12 H  N N 44  
ARG HH21 H  N N 45  
ARG HH22 H  N N 46  
ARG HXT  H  N N 47  
ASN N    N  N N 48  
ASN CA   C  N S 49  
ASN C    C  N N 50  
ASN O    O  N N 51  
ASN CB   C  N N 52  
ASN CG   C  N N 53  
ASN OD1  O  N N 54  
ASN ND2  N  N N 55  
ASN OXT  O  N N 56  
ASN H    H  N N 57  
ASN H2   H  N N 58  
ASN HA   H  N N 59  
ASN HB2  H  N N 60  
ASN HB3  H  N N 61  
ASN HD21 H  N N 62  
ASN HD22 H  N N 63  
ASN HXT  H  N N 64  
ASP N    N  N N 65  
ASP CA   C  N S 66  
ASP C    C  N N 67  
ASP O    O  N N 68  
ASP CB   C  N N 69  
ASP CG   C  N N 70  
ASP OD1  O  N N 71  
ASP OD2  O  N N 72  
ASP OXT  O  N N 73  
ASP H    H  N N 74  
ASP H2   H  N N 75  
ASP HA   H  N N 76  
ASP HB2  H  N N 77  
ASP HB3  H  N N 78  
ASP HD2  H  N N 79  
ASP HXT  H  N N 80  
CYS N    N  N N 81  
CYS CA   C  N R 82  
CYS C    C  N N 83  
CYS O    O  N N 84  
CYS CB   C  N N 85  
CYS SG   S  N N 86  
CYS OXT  O  N N 87  
CYS H    H  N N 88  
CYS H2   H  N N 89  
CYS HA   H  N N 90  
CYS HB2  H  N N 91  
CYS HB3  H  N N 92  
CYS HG   H  N N 93  
CYS HXT  H  N N 94  
GLN N    N  N N 95  
GLN CA   C  N S 96  
GLN C    C  N N 97  
GLN O    O  N N 98  
GLN CB   C  N N 99  
GLN CG   C  N N 100 
GLN CD   C  N N 101 
GLN OE1  O  N N 102 
GLN NE2  N  N N 103 
GLN OXT  O  N N 104 
GLN H    H  N N 105 
GLN H2   H  N N 106 
GLN HA   H  N N 107 
GLN HB2  H  N N 108 
GLN HB3  H  N N 109 
GLN HG2  H  N N 110 
GLN HG3  H  N N 111 
GLN HE21 H  N N 112 
GLN HE22 H  N N 113 
GLN HXT  H  N N 114 
GLU N    N  N N 115 
GLU CA   C  N S 116 
GLU C    C  N N 117 
GLU O    O  N N 118 
GLU CB   C  N N 119 
GLU CG   C  N N 120 
GLU CD   C  N N 121 
GLU OE1  O  N N 122 
GLU OE2  O  N N 123 
GLU OXT  O  N N 124 
GLU H    H  N N 125 
GLU H2   H  N N 126 
GLU HA   H  N N 127 
GLU HB2  H  N N 128 
GLU HB3  H  N N 129 
GLU HG2  H  N N 130 
GLU HG3  H  N N 131 
GLU HE2  H  N N 132 
GLU HXT  H  N N 133 
GLY N    N  N N 134 
GLY CA   C  N N 135 
GLY C    C  N N 136 
GLY O    O  N N 137 
GLY OXT  O  N N 138 
GLY H    H  N N 139 
GLY H2   H  N N 140 
GLY HA2  H  N N 141 
GLY HA3  H  N N 142 
GLY HXT  H  N N 143 
GOL C1   C  N N 144 
GOL O1   O  N N 145 
GOL C2   C  N N 146 
GOL O2   O  N N 147 
GOL C3   C  N N 148 
GOL O3   O  N N 149 
GOL H11  H  N N 150 
GOL H12  H  N N 151 
GOL HO1  H  N N 152 
GOL H2   H  N N 153 
GOL HO2  H  N N 154 
GOL H31  H  N N 155 
GOL H32  H  N N 156 
GOL HO3  H  N N 157 
HIS N    N  N N 158 
HIS CA   C  N S 159 
HIS C    C  N N 160 
HIS O    O  N N 161 
HIS CB   C  N N 162 
HIS CG   C  Y N 163 
HIS ND1  N  Y N 164 
HIS CD2  C  Y N 165 
HIS CE1  C  Y N 166 
HIS NE2  N  Y N 167 
HIS OXT  O  N N 168 
HIS H    H  N N 169 
HIS H2   H  N N 170 
HIS HA   H  N N 171 
HIS HB2  H  N N 172 
HIS HB3  H  N N 173 
HIS HD1  H  N N 174 
HIS HD2  H  N N 175 
HIS HE1  H  N N 176 
HIS HE2  H  N N 177 
HIS HXT  H  N N 178 
HOH O    O  N N 179 
HOH H1   H  N N 180 
HOH H2   H  N N 181 
ILE N    N  N N 182 
ILE CA   C  N S 183 
ILE C    C  N N 184 
ILE O    O  N N 185 
ILE CB   C  N S 186 
ILE CG1  C  N N 187 
ILE CG2  C  N N 188 
ILE CD1  C  N N 189 
ILE OXT  O  N N 190 
ILE H    H  N N 191 
ILE H2   H  N N 192 
ILE HA   H  N N 193 
ILE HB   H  N N 194 
ILE HG12 H  N N 195 
ILE HG13 H  N N 196 
ILE HG21 H  N N 197 
ILE HG22 H  N N 198 
ILE HG23 H  N N 199 
ILE HD11 H  N N 200 
ILE HD12 H  N N 201 
ILE HD13 H  N N 202 
ILE HXT  H  N N 203 
LEU N    N  N N 204 
LEU CA   C  N S 205 
LEU C    C  N N 206 
LEU O    O  N N 207 
LEU CB   C  N N 208 
LEU CG   C  N N 209 
LEU CD1  C  N N 210 
LEU CD2  C  N N 211 
LEU OXT  O  N N 212 
LEU H    H  N N 213 
LEU H2   H  N N 214 
LEU HA   H  N N 215 
LEU HB2  H  N N 216 
LEU HB3  H  N N 217 
LEU HG   H  N N 218 
LEU HD11 H  N N 219 
LEU HD12 H  N N 220 
LEU HD13 H  N N 221 
LEU HD21 H  N N 222 
LEU HD22 H  N N 223 
LEU HD23 H  N N 224 
LEU HXT  H  N N 225 
LYS N    N  N N 226 
LYS CA   C  N S 227 
LYS C    C  N N 228 
LYS O    O  N N 229 
LYS CB   C  N N 230 
LYS CG   C  N N 231 
LYS CD   C  N N 232 
LYS CE   C  N N 233 
LYS NZ   N  N N 234 
LYS OXT  O  N N 235 
LYS H    H  N N 236 
LYS H2   H  N N 237 
LYS HA   H  N N 238 
LYS HB2  H  N N 239 
LYS HB3  H  N N 240 
LYS HG2  H  N N 241 
LYS HG3  H  N N 242 
LYS HD2  H  N N 243 
LYS HD3  H  N N 244 
LYS HE2  H  N N 245 
LYS HE3  H  N N 246 
LYS HZ1  H  N N 247 
LYS HZ2  H  N N 248 
LYS HZ3  H  N N 249 
LYS HXT  H  N N 250 
MET N    N  N N 251 
MET CA   C  N S 252 
MET C    C  N N 253 
MET O    O  N N 254 
MET CB   C  N N 255 
MET CG   C  N N 256 
MET SD   S  N N 257 
MET CE   C  N N 258 
MET OXT  O  N N 259 
MET H    H  N N 260 
MET H2   H  N N 261 
MET HA   H  N N 262 
MET HB2  H  N N 263 
MET HB3  H  N N 264 
MET HG2  H  N N 265 
MET HG3  H  N N 266 
MET HE1  H  N N 267 
MET HE2  H  N N 268 
MET HE3  H  N N 269 
MET HXT  H  N N 270 
MSE N    N  N N 271 
MSE CA   C  N S 272 
MSE C    C  N N 273 
MSE O    O  N N 274 
MSE OXT  O  N N 275 
MSE CB   C  N N 276 
MSE CG   C  N N 277 
MSE SE   SE N N 278 
MSE CE   C  N N 279 
MSE H    H  N N 280 
MSE H2   H  N N 281 
MSE HA   H  N N 282 
MSE HXT  H  N N 283 
MSE HB2  H  N N 284 
MSE HB3  H  N N 285 
MSE HG2  H  N N 286 
MSE HG3  H  N N 287 
MSE HE1  H  N N 288 
MSE HE2  H  N N 289 
MSE HE3  H  N N 290 
PHE N    N  N N 291 
PHE CA   C  N S 292 
PHE C    C  N N 293 
PHE O    O  N N 294 
PHE CB   C  N N 295 
PHE CG   C  Y N 296 
PHE CD1  C  Y N 297 
PHE CD2  C  Y N 298 
PHE CE1  C  Y N 299 
PHE CE2  C  Y N 300 
PHE CZ   C  Y N 301 
PHE OXT  O  N N 302 
PHE H    H  N N 303 
PHE H2   H  N N 304 
PHE HA   H  N N 305 
PHE HB2  H  N N 306 
PHE HB3  H  N N 307 
PHE HD1  H  N N 308 
PHE HD2  H  N N 309 
PHE HE1  H  N N 310 
PHE HE2  H  N N 311 
PHE HZ   H  N N 312 
PHE HXT  H  N N 313 
SER N    N  N N 314 
SER CA   C  N S 315 
SER C    C  N N 316 
SER O    O  N N 317 
SER CB   C  N N 318 
SER OG   O  N N 319 
SER OXT  O  N N 320 
SER H    H  N N 321 
SER H2   H  N N 322 
SER HA   H  N N 323 
SER HB2  H  N N 324 
SER HB3  H  N N 325 
SER HG   H  N N 326 
SER HXT  H  N N 327 
THR N    N  N N 328 
THR CA   C  N S 329 
THR C    C  N N 330 
THR O    O  N N 331 
THR CB   C  N R 332 
THR OG1  O  N N 333 
THR CG2  C  N N 334 
THR OXT  O  N N 335 
THR H    H  N N 336 
THR H2   H  N N 337 
THR HA   H  N N 338 
THR HB   H  N N 339 
THR HG1  H  N N 340 
THR HG21 H  N N 341 
THR HG22 H  N N 342 
THR HG23 H  N N 343 
THR HXT  H  N N 344 
TRP N    N  N N 345 
TRP CA   C  N S 346 
TRP C    C  N N 347 
TRP O    O  N N 348 
TRP CB   C  N N 349 
TRP CG   C  Y N 350 
TRP CD1  C  Y N 351 
TRP CD2  C  Y N 352 
TRP NE1  N  Y N 353 
TRP CE2  C  Y N 354 
TRP CE3  C  Y N 355 
TRP CZ2  C  Y N 356 
TRP CZ3  C  Y N 357 
TRP CH2  C  Y N 358 
TRP OXT  O  N N 359 
TRP H    H  N N 360 
TRP H2   H  N N 361 
TRP HA   H  N N 362 
TRP HB2  H  N N 363 
TRP HB3  H  N N 364 
TRP HD1  H  N N 365 
TRP HE1  H  N N 366 
TRP HE3  H  N N 367 
TRP HZ2  H  N N 368 
TRP HZ3  H  N N 369 
TRP HH2  H  N N 370 
TRP HXT  H  N N 371 
TYR N    N  N N 372 
TYR CA   C  N S 373 
TYR C    C  N N 374 
TYR O    O  N N 375 
TYR CB   C  N N 376 
TYR CG   C  Y N 377 
TYR CD1  C  Y N 378 
TYR CD2  C  Y N 379 
TYR CE1  C  Y N 380 
TYR CE2  C  Y N 381 
TYR CZ   C  Y N 382 
TYR OH   O  N N 383 
TYR OXT  O  N N 384 
TYR H    H  N N 385 
TYR H2   H  N N 386 
TYR HA   H  N N 387 
TYR HB2  H  N N 388 
TYR HB3  H  N N 389 
TYR HD1  H  N N 390 
TYR HD2  H  N N 391 
TYR HE1  H  N N 392 
TYR HE2  H  N N 393 
TYR HH   H  N N 394 
TYR HXT  H  N N 395 
VAL N    N  N N 396 
VAL CA   C  N S 397 
VAL C    C  N N 398 
VAL O    O  N N 399 
VAL CB   C  N N 400 
VAL CG1  C  N N 401 
VAL CG2  C  N N 402 
VAL OXT  O  N N 403 
VAL H    H  N N 404 
VAL H2   H  N N 405 
VAL HA   H  N N 406 
VAL HB   H  N N 407 
VAL HG11 H  N N 408 
VAL HG12 H  N N 409 
VAL HG13 H  N N 410 
VAL HG21 H  N N 411 
VAL HG22 H  N N 412 
VAL HG23 H  N N 413 
VAL HXT  H  N N 414 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ACT C   O    doub N N 1   
ACT C   OXT  sing N N 2   
ACT C   CH3  sing N N 3   
ACT CH3 H1   sing N N 4   
ACT CH3 H2   sing N N 5   
ACT CH3 H3   sing N N 6   
ALA N   CA   sing N N 7   
ALA N   H    sing N N 8   
ALA N   H2   sing N N 9   
ALA CA  C    sing N N 10  
ALA CA  CB   sing N N 11  
ALA CA  HA   sing N N 12  
ALA C   O    doub N N 13  
ALA C   OXT  sing N N 14  
ALA CB  HB1  sing N N 15  
ALA CB  HB2  sing N N 16  
ALA CB  HB3  sing N N 17  
ALA OXT HXT  sing N N 18  
ARG N   CA   sing N N 19  
ARG N   H    sing N N 20  
ARG N   H2   sing N N 21  
ARG CA  C    sing N N 22  
ARG CA  CB   sing N N 23  
ARG CA  HA   sing N N 24  
ARG C   O    doub N N 25  
ARG C   OXT  sing N N 26  
ARG CB  CG   sing N N 27  
ARG CB  HB2  sing N N 28  
ARG CB  HB3  sing N N 29  
ARG CG  CD   sing N N 30  
ARG CG  HG2  sing N N 31  
ARG CG  HG3  sing N N 32  
ARG CD  NE   sing N N 33  
ARG CD  HD2  sing N N 34  
ARG CD  HD3  sing N N 35  
ARG NE  CZ   sing N N 36  
ARG NE  HE   sing N N 37  
ARG CZ  NH1  sing N N 38  
ARG CZ  NH2  doub N N 39  
ARG NH1 HH11 sing N N 40  
ARG NH1 HH12 sing N N 41  
ARG NH2 HH21 sing N N 42  
ARG NH2 HH22 sing N N 43  
ARG OXT HXT  sing N N 44  
ASN N   CA   sing N N 45  
ASN N   H    sing N N 46  
ASN N   H2   sing N N 47  
ASN CA  C    sing N N 48  
ASN CA  CB   sing N N 49  
ASN CA  HA   sing N N 50  
ASN C   O    doub N N 51  
ASN C   OXT  sing N N 52  
ASN CB  CG   sing N N 53  
ASN CB  HB2  sing N N 54  
ASN CB  HB3  sing N N 55  
ASN CG  OD1  doub N N 56  
ASN CG  ND2  sing N N 57  
ASN ND2 HD21 sing N N 58  
ASN ND2 HD22 sing N N 59  
ASN OXT HXT  sing N N 60  
ASP N   CA   sing N N 61  
ASP N   H    sing N N 62  
ASP N   H2   sing N N 63  
ASP CA  C    sing N N 64  
ASP CA  CB   sing N N 65  
ASP CA  HA   sing N N 66  
ASP C   O    doub N N 67  
ASP C   OXT  sing N N 68  
ASP CB  CG   sing N N 69  
ASP CB  HB2  sing N N 70  
ASP CB  HB3  sing N N 71  
ASP CG  OD1  doub N N 72  
ASP CG  OD2  sing N N 73  
ASP OD2 HD2  sing N N 74  
ASP OXT HXT  sing N N 75  
CYS N   CA   sing N N 76  
CYS N   H    sing N N 77  
CYS N   H2   sing N N 78  
CYS CA  C    sing N N 79  
CYS CA  CB   sing N N 80  
CYS CA  HA   sing N N 81  
CYS C   O    doub N N 82  
CYS C   OXT  sing N N 83  
CYS CB  SG   sing N N 84  
CYS CB  HB2  sing N N 85  
CYS CB  HB3  sing N N 86  
CYS SG  HG   sing N N 87  
CYS OXT HXT  sing N N 88  
GLN N   CA   sing N N 89  
GLN N   H    sing N N 90  
GLN N   H2   sing N N 91  
GLN CA  C    sing N N 92  
GLN CA  CB   sing N N 93  
GLN CA  HA   sing N N 94  
GLN C   O    doub N N 95  
GLN C   OXT  sing N N 96  
GLN CB  CG   sing N N 97  
GLN CB  HB2  sing N N 98  
GLN CB  HB3  sing N N 99  
GLN CG  CD   sing N N 100 
GLN CG  HG2  sing N N 101 
GLN CG  HG3  sing N N 102 
GLN CD  OE1  doub N N 103 
GLN CD  NE2  sing N N 104 
GLN NE2 HE21 sing N N 105 
GLN NE2 HE22 sing N N 106 
GLN OXT HXT  sing N N 107 
GLU N   CA   sing N N 108 
GLU N   H    sing N N 109 
GLU N   H2   sing N N 110 
GLU CA  C    sing N N 111 
GLU CA  CB   sing N N 112 
GLU CA  HA   sing N N 113 
GLU C   O    doub N N 114 
GLU C   OXT  sing N N 115 
GLU CB  CG   sing N N 116 
GLU CB  HB2  sing N N 117 
GLU CB  HB3  sing N N 118 
GLU CG  CD   sing N N 119 
GLU CG  HG2  sing N N 120 
GLU CG  HG3  sing N N 121 
GLU CD  OE1  doub N N 122 
GLU CD  OE2  sing N N 123 
GLU OE2 HE2  sing N N 124 
GLU OXT HXT  sing N N 125 
GLY N   CA   sing N N 126 
GLY N   H    sing N N 127 
GLY N   H2   sing N N 128 
GLY CA  C    sing N N 129 
GLY CA  HA2  sing N N 130 
GLY CA  HA3  sing N N 131 
GLY C   O    doub N N 132 
GLY C   OXT  sing N N 133 
GLY OXT HXT  sing N N 134 
GOL C1  O1   sing N N 135 
GOL C1  C2   sing N N 136 
GOL C1  H11  sing N N 137 
GOL C1  H12  sing N N 138 
GOL O1  HO1  sing N N 139 
GOL C2  O2   sing N N 140 
GOL C2  C3   sing N N 141 
GOL C2  H2   sing N N 142 
GOL O2  HO2  sing N N 143 
GOL C3  O3   sing N N 144 
GOL C3  H31  sing N N 145 
GOL C3  H32  sing N N 146 
GOL O3  HO3  sing N N 147 
HIS N   CA   sing N N 148 
HIS N   H    sing N N 149 
HIS N   H2   sing N N 150 
HIS CA  C    sing N N 151 
HIS CA  CB   sing N N 152 
HIS CA  HA   sing N N 153 
HIS C   O    doub N N 154 
HIS C   OXT  sing N N 155 
HIS CB  CG   sing N N 156 
HIS CB  HB2  sing N N 157 
HIS CB  HB3  sing N N 158 
HIS CG  ND1  sing Y N 159 
HIS CG  CD2  doub Y N 160 
HIS ND1 CE1  doub Y N 161 
HIS ND1 HD1  sing N N 162 
HIS CD2 NE2  sing Y N 163 
HIS CD2 HD2  sing N N 164 
HIS CE1 NE2  sing Y N 165 
HIS CE1 HE1  sing N N 166 
HIS NE2 HE2  sing N N 167 
HIS OXT HXT  sing N N 168 
HOH O   H1   sing N N 169 
HOH O   H2   sing N N 170 
ILE N   CA   sing N N 171 
ILE N   H    sing N N 172 
ILE N   H2   sing N N 173 
ILE CA  C    sing N N 174 
ILE CA  CB   sing N N 175 
ILE CA  HA   sing N N 176 
ILE C   O    doub N N 177 
ILE C   OXT  sing N N 178 
ILE CB  CG1  sing N N 179 
ILE CB  CG2  sing N N 180 
ILE CB  HB   sing N N 181 
ILE CG1 CD1  sing N N 182 
ILE CG1 HG12 sing N N 183 
ILE CG1 HG13 sing N N 184 
ILE CG2 HG21 sing N N 185 
ILE CG2 HG22 sing N N 186 
ILE CG2 HG23 sing N N 187 
ILE CD1 HD11 sing N N 188 
ILE CD1 HD12 sing N N 189 
ILE CD1 HD13 sing N N 190 
ILE OXT HXT  sing N N 191 
LEU N   CA   sing N N 192 
LEU N   H    sing N N 193 
LEU N   H2   sing N N 194 
LEU CA  C    sing N N 195 
LEU CA  CB   sing N N 196 
LEU CA  HA   sing N N 197 
LEU C   O    doub N N 198 
LEU C   OXT  sing N N 199 
LEU CB  CG   sing N N 200 
LEU CB  HB2  sing N N 201 
LEU CB  HB3  sing N N 202 
LEU CG  CD1  sing N N 203 
LEU CG  CD2  sing N N 204 
LEU CG  HG   sing N N 205 
LEU CD1 HD11 sing N N 206 
LEU CD1 HD12 sing N N 207 
LEU CD1 HD13 sing N N 208 
LEU CD2 HD21 sing N N 209 
LEU CD2 HD22 sing N N 210 
LEU CD2 HD23 sing N N 211 
LEU OXT HXT  sing N N 212 
LYS N   CA   sing N N 213 
LYS N   H    sing N N 214 
LYS N   H2   sing N N 215 
LYS CA  C    sing N N 216 
LYS CA  CB   sing N N 217 
LYS CA  HA   sing N N 218 
LYS C   O    doub N N 219 
LYS C   OXT  sing N N 220 
LYS CB  CG   sing N N 221 
LYS CB  HB2  sing N N 222 
LYS CB  HB3  sing N N 223 
LYS CG  CD   sing N N 224 
LYS CG  HG2  sing N N 225 
LYS CG  HG3  sing N N 226 
LYS CD  CE   sing N N 227 
LYS CD  HD2  sing N N 228 
LYS CD  HD3  sing N N 229 
LYS CE  NZ   sing N N 230 
LYS CE  HE2  sing N N 231 
LYS CE  HE3  sing N N 232 
LYS NZ  HZ1  sing N N 233 
LYS NZ  HZ2  sing N N 234 
LYS NZ  HZ3  sing N N 235 
LYS OXT HXT  sing N N 236 
MET N   CA   sing N N 237 
MET N   H    sing N N 238 
MET N   H2   sing N N 239 
MET CA  C    sing N N 240 
MET CA  CB   sing N N 241 
MET CA  HA   sing N N 242 
MET C   O    doub N N 243 
MET C   OXT  sing N N 244 
MET CB  CG   sing N N 245 
MET CB  HB2  sing N N 246 
MET CB  HB3  sing N N 247 
MET CG  SD   sing N N 248 
MET CG  HG2  sing N N 249 
MET CG  HG3  sing N N 250 
MET SD  CE   sing N N 251 
MET CE  HE1  sing N N 252 
MET CE  HE2  sing N N 253 
MET CE  HE3  sing N N 254 
MET OXT HXT  sing N N 255 
MSE N   CA   sing N N 256 
MSE N   H    sing N N 257 
MSE N   H2   sing N N 258 
MSE CA  C    sing N N 259 
MSE CA  CB   sing N N 260 
MSE CA  HA   sing N N 261 
MSE C   O    doub N N 262 
MSE C   OXT  sing N N 263 
MSE OXT HXT  sing N N 264 
MSE CB  CG   sing N N 265 
MSE CB  HB2  sing N N 266 
MSE CB  HB3  sing N N 267 
MSE CG  SE   sing N N 268 
MSE CG  HG2  sing N N 269 
MSE CG  HG3  sing N N 270 
MSE SE  CE   sing N N 271 
MSE CE  HE1  sing N N 272 
MSE CE  HE2  sing N N 273 
MSE CE  HE3  sing N N 274 
PHE N   CA   sing N N 275 
PHE N   H    sing N N 276 
PHE N   H2   sing N N 277 
PHE CA  C    sing N N 278 
PHE CA  CB   sing N N 279 
PHE CA  HA   sing N N 280 
PHE C   O    doub N N 281 
PHE C   OXT  sing N N 282 
PHE CB  CG   sing N N 283 
PHE CB  HB2  sing N N 284 
PHE CB  HB3  sing N N 285 
PHE CG  CD1  doub Y N 286 
PHE CG  CD2  sing Y N 287 
PHE CD1 CE1  sing Y N 288 
PHE CD1 HD1  sing N N 289 
PHE CD2 CE2  doub Y N 290 
PHE CD2 HD2  sing N N 291 
PHE CE1 CZ   doub Y N 292 
PHE CE1 HE1  sing N N 293 
PHE CE2 CZ   sing Y N 294 
PHE CE2 HE2  sing N N 295 
PHE CZ  HZ   sing N N 296 
PHE OXT HXT  sing N N 297 
SER N   CA   sing N N 298 
SER N   H    sing N N 299 
SER N   H2   sing N N 300 
SER CA  C    sing N N 301 
SER CA  CB   sing N N 302 
SER CA  HA   sing N N 303 
SER C   O    doub N N 304 
SER C   OXT  sing N N 305 
SER CB  OG   sing N N 306 
SER CB  HB2  sing N N 307 
SER CB  HB3  sing N N 308 
SER OG  HG   sing N N 309 
SER OXT HXT  sing N N 310 
THR N   CA   sing N N 311 
THR N   H    sing N N 312 
THR N   H2   sing N N 313 
THR CA  C    sing N N 314 
THR CA  CB   sing N N 315 
THR CA  HA   sing N N 316 
THR C   O    doub N N 317 
THR C   OXT  sing N N 318 
THR CB  OG1  sing N N 319 
THR CB  CG2  sing N N 320 
THR CB  HB   sing N N 321 
THR OG1 HG1  sing N N 322 
THR CG2 HG21 sing N N 323 
THR CG2 HG22 sing N N 324 
THR CG2 HG23 sing N N 325 
THR OXT HXT  sing N N 326 
TRP N   CA   sing N N 327 
TRP N   H    sing N N 328 
TRP N   H2   sing N N 329 
TRP CA  C    sing N N 330 
TRP CA  CB   sing N N 331 
TRP CA  HA   sing N N 332 
TRP C   O    doub N N 333 
TRP C   OXT  sing N N 334 
TRP CB  CG   sing N N 335 
TRP CB  HB2  sing N N 336 
TRP CB  HB3  sing N N 337 
TRP CG  CD1  doub Y N 338 
TRP CG  CD2  sing Y N 339 
TRP CD1 NE1  sing Y N 340 
TRP CD1 HD1  sing N N 341 
TRP CD2 CE2  doub Y N 342 
TRP CD2 CE3  sing Y N 343 
TRP NE1 CE2  sing Y N 344 
TRP NE1 HE1  sing N N 345 
TRP CE2 CZ2  sing Y N 346 
TRP CE3 CZ3  doub Y N 347 
TRP CE3 HE3  sing N N 348 
TRP CZ2 CH2  doub Y N 349 
TRP CZ2 HZ2  sing N N 350 
TRP CZ3 CH2  sing Y N 351 
TRP CZ3 HZ3  sing N N 352 
TRP CH2 HH2  sing N N 353 
TRP OXT HXT  sing N N 354 
TYR N   CA   sing N N 355 
TYR N   H    sing N N 356 
TYR N   H2   sing N N 357 
TYR CA  C    sing N N 358 
TYR CA  CB   sing N N 359 
TYR CA  HA   sing N N 360 
TYR C   O    doub N N 361 
TYR C   OXT  sing N N 362 
TYR CB  CG   sing N N 363 
TYR CB  HB2  sing N N 364 
TYR CB  HB3  sing N N 365 
TYR CG  CD1  doub Y N 366 
TYR CG  CD2  sing Y N 367 
TYR CD1 CE1  sing Y N 368 
TYR CD1 HD1  sing N N 369 
TYR CD2 CE2  doub Y N 370 
TYR CD2 HD2  sing N N 371 
TYR CE1 CZ   doub Y N 372 
TYR CE1 HE1  sing N N 373 
TYR CE2 CZ   sing Y N 374 
TYR CE2 HE2  sing N N 375 
TYR CZ  OH   sing N N 376 
TYR OH  HH   sing N N 377 
TYR OXT HXT  sing N N 378 
VAL N   CA   sing N N 379 
VAL N   H    sing N N 380 
VAL N   H2   sing N N 381 
VAL CA  C    sing N N 382 
VAL CA  CB   sing N N 383 
VAL CA  HA   sing N N 384 
VAL C   O    doub N N 385 
VAL C   OXT  sing N N 386 
VAL CB  CG1  sing N N 387 
VAL CB  CG2  sing N N 388 
VAL CB  HB   sing N N 389 
VAL CG1 HG11 sing N N 390 
VAL CG1 HG12 sing N N 391 
VAL CG1 HG13 sing N N 392 
VAL CG2 HG21 sing N N 393 
VAL CG2 HG22 sing N N 394 
VAL CG2 HG23 sing N N 395 
VAL OXT HXT  sing N N 396 
# 
_atom_sites.entry_id                    2FB0 
_atom_sites.fract_transf_matrix[1][1]   0.008449 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008449 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008449 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
SE 
# 
loop_