data_2FC8 # _entry.id 2FC8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2FC8 pdb_00002fc8 10.2210/pdb2fc8/pdb RCSB RCSB035706 ? ? WWPDB D_1000035706 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-06-12 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 5 'Structure model' 1 4 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2FC8 _pdbx_database_status.recvd_initial_deposition_date 2005-12-12 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 2FC9 'the different fragment of the same protein' unspecified TargetDB hsi002005757.2 . unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Dang, W.' 1 'Muto, Y.' 2 'Inoue, M.' 3 'Kigawa, T.' 4 'Shirouzu, M.' 5 'Terada, T.' 6 'Yokoyama, S.' 7 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 # _citation.id primary _citation.title 'Solution structure of the RRM_1 domain of NCL protein' _citation.journal_abbrev 'To be published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Dang, W.' 1 ? primary 'Muto, Y.' 2 ? primary 'Inoue, M.' 3 ? primary 'Kigawa, T.' 4 ? primary 'Shirouzu, M.' 5 ? primary 'Terada, T.' 6 ? primary 'Yokoyama, S.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'NCL protein' _entity.formula_weight 10604.348 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'RRM_1 domain, residues 8-96' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGPNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEID GNKVTLDWAKPKGEGGSGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGPNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEID GNKVTLDWAKPKGEGGSGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsi002005757.2 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 PRO n 1 9 ASN n 1 10 ALA n 1 11 ARG n 1 12 SER n 1 13 GLN n 1 14 PRO n 1 15 SER n 1 16 LYS n 1 17 THR n 1 18 LEU n 1 19 PHE n 1 20 VAL n 1 21 LYS n 1 22 GLY n 1 23 LEU n 1 24 SER n 1 25 GLU n 1 26 ASP n 1 27 THR n 1 28 THR n 1 29 GLU n 1 30 GLU n 1 31 THR n 1 32 LEU n 1 33 LYS n 1 34 GLU n 1 35 SER n 1 36 PHE n 1 37 ASP n 1 38 GLY n 1 39 SER n 1 40 VAL n 1 41 ARG n 1 42 ALA n 1 43 ARG n 1 44 ILE n 1 45 VAL n 1 46 THR n 1 47 ASP n 1 48 ARG n 1 49 GLU n 1 50 THR n 1 51 GLY n 1 52 SER n 1 53 SER n 1 54 LYS n 1 55 GLY n 1 56 PHE n 1 57 GLY n 1 58 PHE n 1 59 VAL n 1 60 ASP n 1 61 PHE n 1 62 ASN n 1 63 SER n 1 64 GLU n 1 65 GLU n 1 66 ASP n 1 67 ALA n 1 68 LYS n 1 69 ALA n 1 70 ALA n 1 71 LYS n 1 72 GLU n 1 73 ALA n 1 74 MET n 1 75 GLU n 1 76 ASP n 1 77 GLY n 1 78 GLU n 1 79 ILE n 1 80 ASP n 1 81 GLY n 1 82 ASN n 1 83 LYS n 1 84 VAL n 1 85 THR n 1 86 LEU n 1 87 ASP n 1 88 TRP n 1 89 ALA n 1 90 LYS n 1 91 PRO n 1 92 LYS n 1 93 GLY n 1 94 GLU n 1 95 GLY n 1 96 GLY n 1 97 SER n 1 98 GLY n 1 99 PRO n 1 100 SER n 1 101 SER n 1 102 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'CELL-FREE SYNTHESIS' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050516-05 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 ASN 9 9 9 ASN ASN A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 ARG 48 48 48 ARG ARG A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 PHE 56 56 56 PHE PHE A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 PHE 58 58 58 PHE PHE A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 MET 74 74 74 MET MET A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 THR 85 85 85 THR THR A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 TRP 88 88 88 TRP TRP A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 PRO 91 91 91 PRO PRO A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 SER 97 97 97 SER SER A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 PRO 99 99 99 PRO PRO A . n A 1 100 SER 100 100 100 SER SER A . n A 1 101 SER 101 101 101 SER SER A . n A 1 102 GLY 102 102 102 GLY GLY A . n # _exptl.entry_id 2FC8 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 2FC8 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2FC8 _struct.title 'Solution structure of the RRM_1 domain of NCL protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2FC8 _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN' _struct_keywords.text ;structure genomics, RRM_1 domain, NCL protein, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9BQ02_HUMAN _struct_ref.pdbx_db_accession Q9BQ02 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;PNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLD WAKPKGEGG ; _struct_ref.pdbx_align_begin 336 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2FC8 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 96 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9BQ02 _struct_ref_seq.db_align_beg 336 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 424 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 96 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2FC8 GLY A 1 ? UNP Q9BQ02 ? ? 'expression tag' 1 1 1 2FC8 SER A 2 ? UNP Q9BQ02 ? ? 'expression tag' 2 2 1 2FC8 SER A 3 ? UNP Q9BQ02 ? ? 'expression tag' 3 3 1 2FC8 GLY A 4 ? UNP Q9BQ02 ? ? 'expression tag' 4 4 1 2FC8 SER A 5 ? UNP Q9BQ02 ? ? 'expression tag' 5 5 1 2FC8 SER A 6 ? UNP Q9BQ02 ? ? 'expression tag' 6 6 1 2FC8 GLY A 7 ? UNP Q9BQ02 ? ? 'expression tag' 7 7 1 2FC8 SER A 97 ? UNP Q9BQ02 ? ? 'expression tag' 97 8 1 2FC8 GLY A 98 ? UNP Q9BQ02 ? ? 'expression tag' 98 9 1 2FC8 PRO A 99 ? UNP Q9BQ02 ? ? 'expression tag' 99 10 1 2FC8 SER A 100 ? UNP Q9BQ02 ? ? 'expression tag' 100 11 1 2FC8 SER A 101 ? UNP Q9BQ02 ? ? 'expression tag' 101 12 1 2FC8 GLY A 102 ? UNP Q9BQ02 ? ? 'expression tag' 102 13 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 29 ? SER A 35 ? GLU A 29 SER A 35 1 ? 7 HELX_P HELX_P2 2 GLU A 64 ? MET A 74 ? GLU A 64 MET A 74 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ARG A 41 ? VAL A 45 ? ARG A 41 VAL A 45 A 2 PHE A 56 ? ASP A 60 ? PHE A 56 ASP A 60 A 3 LEU A 18 ? LYS A 21 ? LEU A 18 LYS A 21 A 4 THR A 85 ? TRP A 88 ? THR A 85 TRP A 88 B 1 GLU A 78 ? ILE A 79 ? GLU A 78 ILE A 79 B 2 ASN A 82 ? LYS A 83 ? ASN A 82 LYS A 83 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ARG A 43 ? N ARG A 43 O PHE A 58 ? O PHE A 58 A 2 3 O GLY A 57 ? O GLY A 57 N VAL A 20 ? N VAL A 20 A 3 4 N PHE A 19 ? N PHE A 19 O ASP A 87 ? O ASP A 87 B 1 2 N ILE A 79 ? N ILE A 79 O ASN A 82 ? O ASN A 82 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? -41.51 103.67 2 1 ASN A 9 ? ? 72.68 33.65 3 1 THR A 27 ? ? -38.83 115.32 4 1 SER A 35 ? ? -35.78 -37.06 5 1 ASP A 37 ? ? -69.20 97.92 6 1 SER A 39 ? ? -49.44 165.58 7 1 ALA A 89 ? ? -57.71 91.01 8 1 PRO A 91 ? ? -69.73 -171.41 9 1 LYS A 92 ? ? -134.86 -55.65 10 2 PRO A 14 ? ? -69.75 -172.98 11 2 THR A 27 ? ? -34.86 114.95 12 2 SER A 35 ? ? -38.51 -30.98 13 2 ASP A 37 ? ? -69.37 83.39 14 2 SER A 39 ? ? -47.57 161.04 15 2 SER A 53 ? ? -58.56 103.90 16 2 ALA A 89 ? ? -34.30 144.48 17 3 PRO A 14 ? ? -69.77 -168.74 18 3 THR A 27 ? ? -39.92 110.76 19 3 SER A 35 ? ? -35.27 -31.92 20 3 SER A 39 ? ? -42.95 164.32 21 3 SER A 53 ? ? -53.56 108.01 22 3 TRP A 88 ? ? -57.56 102.39 23 3 ALA A 89 ? ? -33.92 105.34 24 3 PRO A 99 ? ? -69.74 97.26 25 4 SER A 6 ? ? -100.23 77.15 26 4 PRO A 14 ? ? -69.76 -165.99 27 4 THR A 27 ? ? -35.60 120.17 28 4 SER A 35 ? ? -38.47 -34.80 29 4 ASP A 37 ? ? -65.42 90.56 30 4 SER A 39 ? ? -46.29 162.57 31 4 ALA A 89 ? ? -55.21 97.87 32 4 LYS A 92 ? ? -44.44 104.81 33 4 GLU A 94 ? ? -108.78 40.04 34 4 SER A 100 ? ? -45.89 157.26 35 5 PRO A 8 ? ? -69.82 2.89 36 5 ARG A 11 ? ? 35.07 50.70 37 5 THR A 27 ? ? -38.88 116.24 38 5 SER A 35 ? ? -37.60 -36.05 39 5 ASP A 37 ? ? -67.23 99.28 40 5 SER A 39 ? ? -44.04 167.04 41 5 ALA A 89 ? ? -41.15 162.48 42 5 PRO A 91 ? ? -69.76 99.40 43 5 PRO A 99 ? ? -69.77 -179.22 44 6 ALA A 10 ? ? -89.86 39.22 45 6 SER A 12 ? ? -43.63 165.82 46 6 GLN A 13 ? ? -37.28 142.30 47 6 PRO A 14 ? ? -69.82 -166.07 48 6 SER A 39 ? ? -41.70 159.43 49 6 SER A 53 ? ? -56.24 107.49 50 7 ASN A 9 ? ? -83.84 38.55 51 7 PRO A 14 ? ? -69.72 -173.38 52 7 THR A 27 ? ? -38.35 117.08 53 7 SER A 35 ? ? -35.04 -36.84 54 7 SER A 39 ? ? -43.45 159.37 55 7 GLU A 94 ? ? -106.26 41.42 56 7 SER A 97 ? ? -58.29 175.61 57 8 THR A 27 ? ? -34.42 121.21 58 8 SER A 35 ? ? -38.28 -29.70 59 8 SER A 39 ? ? -47.56 164.47 60 8 PRO A 99 ? ? -69.74 0.26 61 9 PRO A 8 ? ? -69.74 87.98 62 9 ASN A 9 ? ? -38.35 147.33 63 9 THR A 27 ? ? -39.31 112.62 64 9 SER A 35 ? ? -38.15 -36.63 65 9 ASP A 37 ? ? -67.40 98.52 66 9 SER A 39 ? ? -44.38 160.68 67 9 ALA A 89 ? ? -37.64 118.89 68 9 PRO A 99 ? ? -69.71 -178.06 69 10 ARG A 11 ? ? -39.35 -27.89 70 10 PRO A 14 ? ? -69.79 -175.26 71 10 THR A 27 ? ? -34.24 120.43 72 10 SER A 35 ? ? -36.41 -31.80 73 10 SER A 39 ? ? -43.73 165.30 74 10 PRO A 99 ? ? -69.85 99.56 75 11 ASN A 9 ? ? -103.24 46.16 76 11 GLN A 13 ? ? -40.18 153.93 77 11 PRO A 14 ? ? -69.75 -174.33 78 11 THR A 27 ? ? -39.11 120.77 79 11 SER A 35 ? ? -34.69 -39.35 80 11 SER A 39 ? ? -44.78 166.22 81 11 SER A 53 ? ? -47.38 106.56 82 12 ARG A 11 ? ? 35.44 34.87 83 12 PRO A 14 ? ? -69.74 -168.02 84 12 THR A 27 ? ? -36.52 121.69 85 12 SER A 35 ? ? -39.40 -26.10 86 12 ASP A 37 ? ? -68.15 94.36 87 12 SER A 39 ? ? -39.42 158.79 88 12 SER A 97 ? ? 71.77 42.73 89 13 ALA A 10 ? ? -34.47 -70.50 90 13 GLN A 13 ? ? -34.21 141.13 91 13 PRO A 14 ? ? -69.84 -170.80 92 13 THR A 27 ? ? -34.54 126.97 93 13 SER A 35 ? ? -38.50 -28.74 94 13 SER A 39 ? ? -47.41 172.34 95 13 LYS A 92 ? ? 32.78 43.00 96 13 GLU A 94 ? ? -97.43 -62.69 97 13 SER A 97 ? ? -42.36 164.98 98 14 PRO A 8 ? ? -69.71 80.54 99 14 PRO A 14 ? ? -69.76 -174.64 100 14 THR A 27 ? ? -35.65 118.95 101 14 SER A 35 ? ? -38.58 -37.45 102 14 ASP A 37 ? ? -68.23 93.15 103 14 SER A 39 ? ? -42.02 156.51 104 14 GLU A 94 ? ? 44.86 29.70 105 15 SER A 2 ? ? -39.53 130.90 106 15 PRO A 8 ? ? -69.81 -172.32 107 15 ARG A 11 ? ? 38.06 29.42 108 15 GLN A 13 ? ? -36.42 149.84 109 15 PRO A 14 ? ? -69.79 -169.14 110 15 THR A 27 ? ? -36.82 123.82 111 15 SER A 35 ? ? -38.46 -31.87 112 15 SER A 39 ? ? -43.25 151.87 113 15 GLU A 94 ? ? -87.01 49.36 114 16 GLN A 13 ? ? -36.00 146.71 115 16 PRO A 14 ? ? -69.73 -164.86 116 16 THR A 27 ? ? -38.61 122.10 117 16 SER A 35 ? ? -34.82 -32.62 118 16 ASP A 37 ? ? -67.80 85.53 119 16 SER A 39 ? ? -45.97 171.94 120 16 PRO A 91 ? ? -69.85 95.64 121 16 SER A 100 ? ? -133.27 -50.66 122 17 SER A 3 ? ? -34.93 96.33 123 17 PRO A 8 ? ? -69.73 2.62 124 17 ALA A 10 ? ? -52.29 172.04 125 17 ARG A 11 ? ? -38.70 -38.77 126 17 THR A 27 ? ? -38.37 115.79 127 17 SER A 35 ? ? -36.12 -37.03 128 17 SER A 39 ? ? -44.54 164.62 129 17 LYS A 90 ? ? -170.79 133.35 130 17 LYS A 92 ? ? -66.95 88.46 131 17 PRO A 99 ? ? -69.79 2.81 132 18 SER A 5 ? ? -42.09 157.63 133 18 SER A 12 ? ? -125.00 -52.24 134 18 PRO A 14 ? ? -69.83 -164.22 135 18 THR A 27 ? ? -34.89 129.50 136 18 SER A 39 ? ? -39.63 151.79 137 18 PRO A 91 ? ? -69.80 96.07 138 19 SER A 5 ? ? -36.90 111.15 139 19 PRO A 14 ? ? -69.79 -164.73 140 19 THR A 27 ? ? -36.17 115.16 141 19 SER A 35 ? ? -38.60 -36.61 142 19 ASP A 37 ? ? -77.27 47.86 143 19 SER A 97 ? ? 35.16 53.69 144 19 PRO A 99 ? ? -69.79 90.06 145 19 SER A 101 ? ? -48.55 156.96 146 20 SER A 12 ? ? -38.05 147.30 147 20 GLN A 13 ? ? -41.36 155.05 148 20 PRO A 14 ? ? -69.72 -170.01 149 20 THR A 27 ? ? -34.31 121.00 150 20 SER A 35 ? ? -36.40 -32.12 151 20 ASP A 37 ? ? -68.74 98.62 152 20 ALA A 89 ? ? -36.91 137.47 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # loop_ _pdbx_database_remark.id _pdbx_database_remark.text 650 ;HELIX DETERMINATION METHOD: AUTHOR DETERMINED ; 700 ;SHEET DETERMINATION METHOD: AUTHOR DETERMINED ; # _pdbx_nmr_ensemble.entry_id 2FC8 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, structures with the lowest energy, target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2FC8 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '20mM d-Tris-HCl(pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90 %H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_refine.entry_id 2FC8 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 2.6 Bruker 1 processing NMRPipe 20031121 Delaglio,F. 2 'data analysis' NMRView 5.0.4 Johnson,B.A. 3 'data analysis' KUJIRA 0.9321 Kobayashi,N. 4 'structure solution' CYANA 2.0.17 Guntert,P. 5 refinement CYANA 2.0.17 Guntert,P. 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 ILE N N N N 123 ILE CA C N S 124 ILE C C N N 125 ILE O O N N 126 ILE CB C N S 127 ILE CG1 C N N 128 ILE CG2 C N N 129 ILE CD1 C N N 130 ILE OXT O N N 131 ILE H H N N 132 ILE H2 H N N 133 ILE HA H N N 134 ILE HB H N N 135 ILE HG12 H N N 136 ILE HG13 H N N 137 ILE HG21 H N N 138 ILE HG22 H N N 139 ILE HG23 H N N 140 ILE HD11 H N N 141 ILE HD12 H N N 142 ILE HD13 H N N 143 ILE HXT H N N 144 LEU N N N N 145 LEU CA C N S 146 LEU C C N N 147 LEU O O N N 148 LEU CB C N N 149 LEU CG C N N 150 LEU CD1 C N N 151 LEU CD2 C N N 152 LEU OXT O N N 153 LEU H H N N 154 LEU H2 H N N 155 LEU HA H N N 156 LEU HB2 H N N 157 LEU HB3 H N N 158 LEU HG H N N 159 LEU HD11 H N N 160 LEU HD12 H N N 161 LEU HD13 H N N 162 LEU HD21 H N N 163 LEU HD22 H N N 164 LEU HD23 H N N 165 LEU HXT H N N 166 LYS N N N N 167 LYS CA C N S 168 LYS C C N N 169 LYS O O N N 170 LYS CB C N N 171 LYS CG C N N 172 LYS CD C N N 173 LYS CE C N N 174 LYS NZ N N N 175 LYS OXT O N N 176 LYS H H N N 177 LYS H2 H N N 178 LYS HA H N N 179 LYS HB2 H N N 180 LYS HB3 H N N 181 LYS HG2 H N N 182 LYS HG3 H N N 183 LYS HD2 H N N 184 LYS HD3 H N N 185 LYS HE2 H N N 186 LYS HE3 H N N 187 LYS HZ1 H N N 188 LYS HZ2 H N N 189 LYS HZ3 H N N 190 LYS HXT H N N 191 MET N N N N 192 MET CA C N S 193 MET C C N N 194 MET O O N N 195 MET CB C N N 196 MET CG C N N 197 MET SD S N N 198 MET CE C N N 199 MET OXT O N N 200 MET H H N N 201 MET H2 H N N 202 MET HA H N N 203 MET HB2 H N N 204 MET HB3 H N N 205 MET HG2 H N N 206 MET HG3 H N N 207 MET HE1 H N N 208 MET HE2 H N N 209 MET HE3 H N N 210 MET HXT H N N 211 PHE N N N N 212 PHE CA C N S 213 PHE C C N N 214 PHE O O N N 215 PHE CB C N N 216 PHE CG C Y N 217 PHE CD1 C Y N 218 PHE CD2 C Y N 219 PHE CE1 C Y N 220 PHE CE2 C Y N 221 PHE CZ C Y N 222 PHE OXT O N N 223 PHE H H N N 224 PHE H2 H N N 225 PHE HA H N N 226 PHE HB2 H N N 227 PHE HB3 H N N 228 PHE HD1 H N N 229 PHE HD2 H N N 230 PHE HE1 H N N 231 PHE HE2 H N N 232 PHE HZ H N N 233 PHE HXT H N N 234 PRO N N N N 235 PRO CA C N S 236 PRO C C N N 237 PRO O O N N 238 PRO CB C N N 239 PRO CG C N N 240 PRO CD C N N 241 PRO OXT O N N 242 PRO H H N N 243 PRO HA H N N 244 PRO HB2 H N N 245 PRO HB3 H N N 246 PRO HG2 H N N 247 PRO HG3 H N N 248 PRO HD2 H N N 249 PRO HD3 H N N 250 PRO HXT H N N 251 SER N N N N 252 SER CA C N S 253 SER C C N N 254 SER O O N N 255 SER CB C N N 256 SER OG O N N 257 SER OXT O N N 258 SER H H N N 259 SER H2 H N N 260 SER HA H N N 261 SER HB2 H N N 262 SER HB3 H N N 263 SER HG H N N 264 SER HXT H N N 265 THR N N N N 266 THR CA C N S 267 THR C C N N 268 THR O O N N 269 THR CB C N R 270 THR OG1 O N N 271 THR CG2 C N N 272 THR OXT O N N 273 THR H H N N 274 THR H2 H N N 275 THR HA H N N 276 THR HB H N N 277 THR HG1 H N N 278 THR HG21 H N N 279 THR HG22 H N N 280 THR HG23 H N N 281 THR HXT H N N 282 TRP N N N N 283 TRP CA C N S 284 TRP C C N N 285 TRP O O N N 286 TRP CB C N N 287 TRP CG C Y N 288 TRP CD1 C Y N 289 TRP CD2 C Y N 290 TRP NE1 N Y N 291 TRP CE2 C Y N 292 TRP CE3 C Y N 293 TRP CZ2 C Y N 294 TRP CZ3 C Y N 295 TRP CH2 C Y N 296 TRP OXT O N N 297 TRP H H N N 298 TRP H2 H N N 299 TRP HA H N N 300 TRP HB2 H N N 301 TRP HB3 H N N 302 TRP HD1 H N N 303 TRP HE1 H N N 304 TRP HE3 H N N 305 TRP HZ2 H N N 306 TRP HZ3 H N N 307 TRP HH2 H N N 308 TRP HXT H N N 309 VAL N N N N 310 VAL CA C N S 311 VAL C C N N 312 VAL O O N N 313 VAL CB C N N 314 VAL CG1 C N N 315 VAL CG2 C N N 316 VAL OXT O N N 317 VAL H H N N 318 VAL H2 H N N 319 VAL HA H N N 320 VAL HB H N N 321 VAL HG11 H N N 322 VAL HG12 H N N 323 VAL HG13 H N N 324 VAL HG21 H N N 325 VAL HG22 H N N 326 VAL HG23 H N N 327 VAL HXT H N N 328 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 ILE N CA sing N N 116 ILE N H sing N N 117 ILE N H2 sing N N 118 ILE CA C sing N N 119 ILE CA CB sing N N 120 ILE CA HA sing N N 121 ILE C O doub N N 122 ILE C OXT sing N N 123 ILE CB CG1 sing N N 124 ILE CB CG2 sing N N 125 ILE CB HB sing N N 126 ILE CG1 CD1 sing N N 127 ILE CG1 HG12 sing N N 128 ILE CG1 HG13 sing N N 129 ILE CG2 HG21 sing N N 130 ILE CG2 HG22 sing N N 131 ILE CG2 HG23 sing N N 132 ILE CD1 HD11 sing N N 133 ILE CD1 HD12 sing N N 134 ILE CD1 HD13 sing N N 135 ILE OXT HXT sing N N 136 LEU N CA sing N N 137 LEU N H sing N N 138 LEU N H2 sing N N 139 LEU CA C sing N N 140 LEU CA CB sing N N 141 LEU CA HA sing N N 142 LEU C O doub N N 143 LEU C OXT sing N N 144 LEU CB CG sing N N 145 LEU CB HB2 sing N N 146 LEU CB HB3 sing N N 147 LEU CG CD1 sing N N 148 LEU CG CD2 sing N N 149 LEU CG HG sing N N 150 LEU CD1 HD11 sing N N 151 LEU CD1 HD12 sing N N 152 LEU CD1 HD13 sing N N 153 LEU CD2 HD21 sing N N 154 LEU CD2 HD22 sing N N 155 LEU CD2 HD23 sing N N 156 LEU OXT HXT sing N N 157 LYS N CA sing N N 158 LYS N H sing N N 159 LYS N H2 sing N N 160 LYS CA C sing N N 161 LYS CA CB sing N N 162 LYS CA HA sing N N 163 LYS C O doub N N 164 LYS C OXT sing N N 165 LYS CB CG sing N N 166 LYS CB HB2 sing N N 167 LYS CB HB3 sing N N 168 LYS CG CD sing N N 169 LYS CG HG2 sing N N 170 LYS CG HG3 sing N N 171 LYS CD CE sing N N 172 LYS CD HD2 sing N N 173 LYS CD HD3 sing N N 174 LYS CE NZ sing N N 175 LYS CE HE2 sing N N 176 LYS CE HE3 sing N N 177 LYS NZ HZ1 sing N N 178 LYS NZ HZ2 sing N N 179 LYS NZ HZ3 sing N N 180 LYS OXT HXT sing N N 181 MET N CA sing N N 182 MET N H sing N N 183 MET N H2 sing N N 184 MET CA C sing N N 185 MET CA CB sing N N 186 MET CA HA sing N N 187 MET C O doub N N 188 MET C OXT sing N N 189 MET CB CG sing N N 190 MET CB HB2 sing N N 191 MET CB HB3 sing N N 192 MET CG SD sing N N 193 MET CG HG2 sing N N 194 MET CG HG3 sing N N 195 MET SD CE sing N N 196 MET CE HE1 sing N N 197 MET CE HE2 sing N N 198 MET CE HE3 sing N N 199 MET OXT HXT sing N N 200 PHE N CA sing N N 201 PHE N H sing N N 202 PHE N H2 sing N N 203 PHE CA C sing N N 204 PHE CA CB sing N N 205 PHE CA HA sing N N 206 PHE C O doub N N 207 PHE C OXT sing N N 208 PHE CB CG sing N N 209 PHE CB HB2 sing N N 210 PHE CB HB3 sing N N 211 PHE CG CD1 doub Y N 212 PHE CG CD2 sing Y N 213 PHE CD1 CE1 sing Y N 214 PHE CD1 HD1 sing N N 215 PHE CD2 CE2 doub Y N 216 PHE CD2 HD2 sing N N 217 PHE CE1 CZ doub Y N 218 PHE CE1 HE1 sing N N 219 PHE CE2 CZ sing Y N 220 PHE CE2 HE2 sing N N 221 PHE CZ HZ sing N N 222 PHE OXT HXT sing N N 223 PRO N CA sing N N 224 PRO N CD sing N N 225 PRO N H sing N N 226 PRO CA C sing N N 227 PRO CA CB sing N N 228 PRO CA HA sing N N 229 PRO C O doub N N 230 PRO C OXT sing N N 231 PRO CB CG sing N N 232 PRO CB HB2 sing N N 233 PRO CB HB3 sing N N 234 PRO CG CD sing N N 235 PRO CG HG2 sing N N 236 PRO CG HG3 sing N N 237 PRO CD HD2 sing N N 238 PRO CD HD3 sing N N 239 PRO OXT HXT sing N N 240 SER N CA sing N N 241 SER N H sing N N 242 SER N H2 sing N N 243 SER CA C sing N N 244 SER CA CB sing N N 245 SER CA HA sing N N 246 SER C O doub N N 247 SER C OXT sing N N 248 SER CB OG sing N N 249 SER CB HB2 sing N N 250 SER CB HB3 sing N N 251 SER OG HG sing N N 252 SER OXT HXT sing N N 253 THR N CA sing N N 254 THR N H sing N N 255 THR N H2 sing N N 256 THR CA C sing N N 257 THR CA CB sing N N 258 THR CA HA sing N N 259 THR C O doub N N 260 THR C OXT sing N N 261 THR CB OG1 sing N N 262 THR CB CG2 sing N N 263 THR CB HB sing N N 264 THR OG1 HG1 sing N N 265 THR CG2 HG21 sing N N 266 THR CG2 HG22 sing N N 267 THR CG2 HG23 sing N N 268 THR OXT HXT sing N N 269 TRP N CA sing N N 270 TRP N H sing N N 271 TRP N H2 sing N N 272 TRP CA C sing N N 273 TRP CA CB sing N N 274 TRP CA HA sing N N 275 TRP C O doub N N 276 TRP C OXT sing N N 277 TRP CB CG sing N N 278 TRP CB HB2 sing N N 279 TRP CB HB3 sing N N 280 TRP CG CD1 doub Y N 281 TRP CG CD2 sing Y N 282 TRP CD1 NE1 sing Y N 283 TRP CD1 HD1 sing N N 284 TRP CD2 CE2 doub Y N 285 TRP CD2 CE3 sing Y N 286 TRP NE1 CE2 sing Y N 287 TRP NE1 HE1 sing N N 288 TRP CE2 CZ2 sing Y N 289 TRP CE3 CZ3 doub Y N 290 TRP CE3 HE3 sing N N 291 TRP CZ2 CH2 doub Y N 292 TRP CZ2 HZ2 sing N N 293 TRP CZ3 CH2 sing Y N 294 TRP CZ3 HZ3 sing N N 295 TRP CH2 HH2 sing N N 296 TRP OXT HXT sing N N 297 VAL N CA sing N N 298 VAL N H sing N N 299 VAL N H2 sing N N 300 VAL CA C sing N N 301 VAL CA CB sing N N 302 VAL CA HA sing N N 303 VAL C O doub N N 304 VAL C OXT sing N N 305 VAL CB CG1 sing N N 306 VAL CB CG2 sing N N 307 VAL CB HB sing N N 308 VAL CG1 HG11 sing N N 309 VAL CG1 HG12 sing N N 310 VAL CG1 HG13 sing N N 311 VAL CG2 HG21 sing N N 312 VAL CG2 HG22 sing N N 313 VAL CG2 HG23 sing N N 314 VAL OXT HXT sing N N 315 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 2FC8 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_