data_2FN4 # _entry.id 2FN4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.377 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2FN4 pdb_00002fn4 10.2210/pdb2fn4/pdb RCSB RCSB036073 ? ? WWPDB D_1000036073 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2FN4 _pdbx_database_status.recvd_initial_deposition_date 2006-01-10 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Turnbull, A.P.' 1 'Elkins, J.M.' 2 'Gileadi, C.' 3 'Burgess, N.' 4 'Salah, E.' 5 'Papagrigoriou, E.' 6 'Debreczeni, J.' 7 'von Delft, F.' 8 'Weigelt, J.' 9 'Edwards, A.' 10 'Arrowsmith, C.' 11 'Sundstrom, M.' 12 'Doyle, D.' 13 'Structural Genomics Consortium (SGC)' 14 # _citation.id primary _citation.title 'The crystal structure of human Ras-related protein, RRAS, in the GDP-bound state' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Turnbull, A.P.' 1 ? primary 'Elkins, J.M.' 2 ? primary 'Gileadi, C.' 3 ? primary 'Burgess, N.' 4 ? primary 'Salah, E.' 5 ? primary 'Papagrigoriou, E.' 6 ? primary 'Debreczeni, J.' 7 ? primary 'von Delft, F.' 8 ? primary 'Weigelt, J.' 9 ? primary 'Edwards, A.' 10 ? primary 'Arrowsmith, C.' 11 ? primary 'Sundstrom, M.' 12 ? primary 'Doyle, D.' 13 ? # _cell.entry_id 2FN4 _cell.length_a 43.152 _cell.length_b 43.152 _cell.length_c 155.499 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2FN4 _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Ras-related protein R-Ras' 20150.609 1 ? ? 'residues 23-201' ? 2 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 3 non-polymer syn "GUANOSINE-5'-DIPHOSPHATE" 443.201 1 ? ? ? ? 4 water nat water 18.015 94 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name p23 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SMDPPPSETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICSVDGIPARLDILDTAGQEEFGAMREQYMRA GHGFLLVFAINDRQSFNEVGKLFTQILRVKDRDDFPVVLVGNKADLESQRQVPRSEASAFGASHHVAYFEASAKLRLNVD EAFEQLVRAVRKYQEQELPPS ; _entity_poly.pdbx_seq_one_letter_code_can ;SMDPPPSETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICSVDGIPARLDILDTAGQEEFGAMREQYMRA GHGFLLVFAINDRQSFNEVGKLFTQILRVKDRDDFPVVLVGNKADLESQRQVPRSEASAFGASHHVAYFEASAKLRLNVD EAFEQLVRAVRKYQEQELPPS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 MET n 1 3 ASP n 1 4 PRO n 1 5 PRO n 1 6 PRO n 1 7 SER n 1 8 GLU n 1 9 THR n 1 10 HIS n 1 11 LYS n 1 12 LEU n 1 13 VAL n 1 14 VAL n 1 15 VAL n 1 16 GLY n 1 17 GLY n 1 18 GLY n 1 19 GLY n 1 20 VAL n 1 21 GLY n 1 22 LYS n 1 23 SER n 1 24 ALA n 1 25 LEU n 1 26 THR n 1 27 ILE n 1 28 GLN n 1 29 PHE n 1 30 ILE n 1 31 GLN n 1 32 SER n 1 33 TYR n 1 34 PHE n 1 35 VAL n 1 36 SER n 1 37 ASP n 1 38 TYR n 1 39 ASP n 1 40 PRO n 1 41 THR n 1 42 ILE n 1 43 GLU n 1 44 ASP n 1 45 SER n 1 46 TYR n 1 47 THR n 1 48 LYS n 1 49 ILE n 1 50 CYS n 1 51 SER n 1 52 VAL n 1 53 ASP n 1 54 GLY n 1 55 ILE n 1 56 PRO n 1 57 ALA n 1 58 ARG n 1 59 LEU n 1 60 ASP n 1 61 ILE n 1 62 LEU n 1 63 ASP n 1 64 THR n 1 65 ALA n 1 66 GLY n 1 67 GLN n 1 68 GLU n 1 69 GLU n 1 70 PHE n 1 71 GLY n 1 72 ALA n 1 73 MET n 1 74 ARG n 1 75 GLU n 1 76 GLN n 1 77 TYR n 1 78 MET n 1 79 ARG n 1 80 ALA n 1 81 GLY n 1 82 HIS n 1 83 GLY n 1 84 PHE n 1 85 LEU n 1 86 LEU n 1 87 VAL n 1 88 PHE n 1 89 ALA n 1 90 ILE n 1 91 ASN n 1 92 ASP n 1 93 ARG n 1 94 GLN n 1 95 SER n 1 96 PHE n 1 97 ASN n 1 98 GLU n 1 99 VAL n 1 100 GLY n 1 101 LYS n 1 102 LEU n 1 103 PHE n 1 104 THR n 1 105 GLN n 1 106 ILE n 1 107 LEU n 1 108 ARG n 1 109 VAL n 1 110 LYS n 1 111 ASP n 1 112 ARG n 1 113 ASP n 1 114 ASP n 1 115 PHE n 1 116 PRO n 1 117 VAL n 1 118 VAL n 1 119 LEU n 1 120 VAL n 1 121 GLY n 1 122 ASN n 1 123 LYS n 1 124 ALA n 1 125 ASP n 1 126 LEU n 1 127 GLU n 1 128 SER n 1 129 GLN n 1 130 ARG n 1 131 GLN n 1 132 VAL n 1 133 PRO n 1 134 ARG n 1 135 SER n 1 136 GLU n 1 137 ALA n 1 138 SER n 1 139 ALA n 1 140 PHE n 1 141 GLY n 1 142 ALA n 1 143 SER n 1 144 HIS n 1 145 HIS n 1 146 VAL n 1 147 ALA n 1 148 TYR n 1 149 PHE n 1 150 GLU n 1 151 ALA n 1 152 SER n 1 153 ALA n 1 154 LYS n 1 155 LEU n 1 156 ARG n 1 157 LEU n 1 158 ASN n 1 159 VAL n 1 160 ASP n 1 161 GLU n 1 162 ALA n 1 163 PHE n 1 164 GLU n 1 165 GLN n 1 166 LEU n 1 167 VAL n 1 168 ARG n 1 169 ALA n 1 170 VAL n 1 171 ARG n 1 172 LYS n 1 173 TYR n 1 174 GLN n 1 175 GLU n 1 176 GLN n 1 177 GLU n 1 178 LEU n 1 179 PRO n 1 180 PRO n 1 181 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene RRAS _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL-21(DE3)R3' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pNIC28-Bsa4 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RRAS_HUMAN _struct_ref.pdbx_db_accession P10301 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;DPPPSETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICSVDGIPARLDILDTAGQEEFGAMREQYMRAGH GFLLVFAINDRQSFNEVGKLFTQILRVKDRDDFPVVLVGNKADLESQRQVPRSEASAFGASHHVAYFEASAKLRLNVDEA FEQLVRAVRKYQEQELPPS ; _struct_ref.pdbx_align_begin 23 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2FN4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 181 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P10301 _struct_ref_seq.db_align_beg 23 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 201 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 23 _struct_ref_seq.pdbx_auth_seq_align_end 201 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2FN4 SER A 1 ? UNP P10301 ? ? 'cloning artifact' 21 1 1 2FN4 MET A 2 ? UNP P10301 ? ? 'cloning artifact' 22 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GDP 'RNA linking' n "GUANOSINE-5'-DIPHOSPHATE" ? 'C10 H15 N5 O11 P2' 443.201 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2FN4 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.07 _exptl_crystal.density_percent_sol 40.67 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pdbx_details '1.6M Na/KPO4, 0.1M HEPES, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'MARMOSAIC 225 mm CCD' _diffrn_detector.pdbx_collection_date 2005-12-09 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Si (111)' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.00008 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'SLS BEAMLINE X10SA' _diffrn_source.pdbx_synchrotron_site SLS _diffrn_source.pdbx_synchrotron_beamline X10SA _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.00008 # _reflns.entry_id 2FN4 _reflns.observed_criterion_sigma_I 0 _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 50 _reflns.d_resolution_high 1.65 _reflns.number_obs 20362 _reflns.number_all ? _reflns.percent_possible_obs 95.7 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 6.1 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.65 _reflns_shell.d_res_low 1.71 _reflns_shell.percent_possible_all 100.0 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy 5.1 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 2FN4 _refine.ls_number_reflns_obs 19180 _refine.ls_number_reflns_all 19180 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 37.4 _refine.ls_d_res_high 1.65 _refine.ls_percent_reflns_obs 95.69 _refine.ls_R_factor_obs 0.2165 _refine.ls_R_factor_all 0.2165 _refine.ls_R_factor_R_work 0.21468 _refine.ls_R_factor_R_free 0.2506 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.1 _refine.ls_number_reflns_R_free 1039 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.962 _refine.correlation_coeff_Fo_to_Fc_free 0.949 _refine.B_iso_mean 30.889 _refine.aniso_B[1][1] 0.33 _refine.aniso_B[2][2] 0.33 _refine.aniso_B[3][3] -0.49 _refine.aniso_B[1][2] 0.16 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model 2ERY.pdb _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.122 _refine.pdbx_overall_ESU_R_Free 0.118 _refine.overall_SU_ML 0.095 _refine.overall_SU_B 5.224 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag 'LIKELY RESIDUAL' _refine.pdbx_diffrn_id 1 _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1344 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 29 _refine_hist.number_atoms_solvent 94 _refine_hist.number_atoms_total 1467 _refine_hist.d_res_high 1.65 _refine_hist.d_res_low 37.4 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.012 0.022 ? 1411 'X-RAY DIFFRACTION' ? r_bond_other_d 0.002 0.020 ? 949 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.390 1.974 ? 1917 'X-RAY DIFFRACTION' ? r_angle_other_deg 0.936 3.000 ? 2295 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 6.168 5.000 ? 174 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 29.789 23.571 ? 70 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 13.135 15.000 ? 223 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 15.926 15.000 ? 12 'X-RAY DIFFRACTION' ? r_chiral_restr 0.088 0.200 ? 210 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.005 0.020 ? 1588 'X-RAY DIFFRACTION' ? r_gen_planes_other 0.001 0.020 ? 308 'X-RAY DIFFRACTION' ? r_nbd_refined 0.211 0.200 ? 281 'X-RAY DIFFRACTION' ? r_nbd_other 0.205 0.200 ? 1033 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.179 0.200 ? 700 'X-RAY DIFFRACTION' ? r_nbtor_other 0.083 0.200 ? 742 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.163 0.200 ? 84 'X-RAY DIFFRACTION' ? r_metal_ion_refined 0.160 0.200 ? 1 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.184 0.200 ? 10 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other 0.224 0.200 ? 23 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.183 0.200 ? 9 'X-RAY DIFFRACTION' ? r_mcbond_it 0.776 1.500 ? 927 'X-RAY DIFFRACTION' ? r_mcbond_other 0.198 1.500 ? 355 'X-RAY DIFFRACTION' ? r_mcangle_it 1.077 2.000 ? 1384 'X-RAY DIFFRACTION' ? r_scbond_it 1.741 3.000 ? 599 'X-RAY DIFFRACTION' ? r_scangle_it 2.585 4.500 ? 532 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.650 _refine_ls_shell.d_res_low 1.693 _refine_ls_shell.number_reflns_R_work 1446 _refine_ls_shell.R_factor_R_work 0.27 _refine_ls_shell.percent_reflns_obs 100.00 _refine_ls_shell.R_factor_R_free 0.304 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 85 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 2FN4 _struct.title 'The crystal structure of human Ras-related protein, RRAS, in the GDP-bound state' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2FN4 _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text 'RRAS, GDP/GTP binding, GTP hydrolysis, Structural Genomics, Structural Genomics Consortium, SGC, SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 21 ? SER A 32 ? GLY A 41 SER A 52 1 ? 12 HELX_P HELX_P2 2 MET A 73 ? GLY A 81 ? MET A 93 GLY A 101 1 ? 9 HELX_P HELX_P3 3 ASP A 92 ? ASP A 111 ? ASP A 112 ASP A 131 1 ? 20 HELX_P HELX_P4 4 LYS A 123 ? ARG A 130 ? LYS A 143 ARG A 150 5 ? 8 HELX_P HELX_P5 5 PRO A 133 ? HIS A 144 ? PRO A 153 HIS A 164 1 ? 12 HELX_P HELX_P6 6 ASN A 158 ? GLN A 174 ? ASN A 178 GLN A 194 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? C GDP . O2B ? ? ? 1_555 B MG . MG ? ? A GDP 1 A MG 2 1_555 ? ? ? ? ? ? ? 2.076 ? ? metalc2 metalc ? ? B MG . MG ? ? ? 1_555 A SER 23 OG ? ? A MG 2 A SER 43 1_555 ? ? ? ? ? ? ? 2.108 ? ? metalc3 metalc ? ? B MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 2 A HOH 230 1_555 ? ? ? ? ? ? ? 2.079 ? ? metalc4 metalc ? ? B MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 2 A HOH 236 1_555 ? ? ? ? ? ? ? 2.383 ? ? metalc5 metalc ? ? B MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 2 A HOH 240 1_555 ? ? ? ? ? ? ? 2.165 ? ? metalc6 metalc ? ? B MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 2 A HOH 249 1_555 ? ? ? ? ? ? ? 1.830 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel A 5 6 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ASP A 44 ? VAL A 52 ? ASP A 64 VAL A 72 A 2 ILE A 55 ? ASP A 63 ? ILE A 75 ASP A 83 A 3 THR A 9 ? GLY A 16 ? THR A 29 GLY A 36 A 4 GLY A 83 ? ALA A 89 ? GLY A 103 ALA A 109 A 5 VAL A 117 ? ASN A 122 ? VAL A 137 ASN A 142 A 6 ALA A 147 ? GLU A 150 ? ALA A 167 GLU A 170 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LYS A 48 ? N LYS A 68 O LEU A 59 ? O LEU A 79 A 2 3 O ARG A 58 ? O ARG A 78 N HIS A 10 ? N HIS A 30 A 3 4 N VAL A 15 ? N VAL A 35 O VAL A 87 ? O VAL A 107 A 4 5 N PHE A 88 ? N PHE A 108 O ASN A 122 ? O ASN A 142 A 5 6 N GLY A 121 ? N GLY A 141 O PHE A 149 ? O PHE A 169 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A MG 2 ? 6 'BINDING SITE FOR RESIDUE MG A 2' AC2 Software A GDP 1 ? 24 'BINDING SITE FOR RESIDUE GDP A 1' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 GDP C . ? GDP A 1 . ? 1_555 ? 2 AC1 6 SER A 23 ? SER A 43 . ? 1_555 ? 3 AC1 6 HOH D . ? HOH A 230 . ? 1_555 ? 4 AC1 6 HOH D . ? HOH A 236 . ? 1_555 ? 5 AC1 6 HOH D . ? HOH A 240 . ? 1_555 ? 6 AC1 6 HOH D . ? HOH A 249 . ? 1_555 ? 7 AC2 24 MG B . ? MG A 2 . ? 1_555 ? 8 AC2 24 GLY A 19 ? GLY A 39 . ? 1_555 ? 9 AC2 24 VAL A 20 ? VAL A 40 . ? 1_555 ? 10 AC2 24 GLY A 21 ? GLY A 41 . ? 1_555 ? 11 AC2 24 LYS A 22 ? LYS A 42 . ? 1_555 ? 12 AC2 24 SER A 23 ? SER A 43 . ? 1_555 ? 13 AC2 24 ALA A 24 ? ALA A 44 . ? 1_555 ? 14 AC2 24 SER A 36 ? SER A 56 . ? 1_555 ? 15 AC2 24 ASN A 122 ? ASN A 142 . ? 1_555 ? 16 AC2 24 LYS A 123 ? LYS A 143 . ? 1_555 ? 17 AC2 24 ASP A 125 ? ASP A 145 . ? 1_555 ? 18 AC2 24 LEU A 126 ? LEU A 146 . ? 1_555 ? 19 AC2 24 SER A 152 ? SER A 172 . ? 1_555 ? 20 AC2 24 ALA A 153 ? ALA A 173 . ? 1_555 ? 21 AC2 24 LYS A 154 ? LYS A 174 . ? 1_555 ? 22 AC2 24 HOH D . ? HOH A 230 . ? 1_555 ? 23 AC2 24 HOH D . ? HOH A 236 . ? 1_555 ? 24 AC2 24 HOH D . ? HOH A 249 . ? 1_555 ? 25 AC2 24 HOH D . ? HOH A 251 . ? 1_555 ? 26 AC2 24 HOH D . ? HOH A 267 . ? 1_555 ? 27 AC2 24 HOH D . ? HOH A 268 . ? 1_555 ? 28 AC2 24 HOH D . ? HOH A 277 . ? 1_555 ? 29 AC2 24 HOH D . ? HOH A 283 . ? 1_445 ? 30 AC2 24 HOH D . ? HOH A 293 . ? 1_555 ? # _database_PDB_matrix.entry_id 2FN4 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2FN4 _atom_sites.fract_transf_matrix[1][1] 0.023174 _atom_sites.fract_transf_matrix[1][2] 0.013379 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.026759 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006431 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C MG N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 21 ? ? ? A . n A 1 2 MET 2 22 ? ? ? A . n A 1 3 ASP 3 23 ? ? ? A . n A 1 4 PRO 4 24 24 PRO PRO A . n A 1 5 PRO 5 25 25 PRO PRO A . n A 1 6 PRO 6 26 26 PRO PRO A . n A 1 7 SER 7 27 27 SER SER A . n A 1 8 GLU 8 28 28 GLU GLU A . n A 1 9 THR 9 29 29 THR THR A . n A 1 10 HIS 10 30 30 HIS HIS A . n A 1 11 LYS 11 31 31 LYS LYS A . n A 1 12 LEU 12 32 32 LEU LEU A . n A 1 13 VAL 13 33 33 VAL VAL A . n A 1 14 VAL 14 34 34 VAL VAL A . n A 1 15 VAL 15 35 35 VAL VAL A . n A 1 16 GLY 16 36 36 GLY GLY A . n A 1 17 GLY 17 37 37 GLY GLY A . n A 1 18 GLY 18 38 38 GLY GLY A . n A 1 19 GLY 19 39 39 GLY GLY A . n A 1 20 VAL 20 40 40 VAL VAL A . n A 1 21 GLY 21 41 41 GLY GLY A . n A 1 22 LYS 22 42 42 LYS LYS A . n A 1 23 SER 23 43 43 SER SER A . n A 1 24 ALA 24 44 44 ALA ALA A . n A 1 25 LEU 25 45 45 LEU LEU A . n A 1 26 THR 26 46 46 THR THR A . n A 1 27 ILE 27 47 47 ILE ILE A . n A 1 28 GLN 28 48 48 GLN GLN A . n A 1 29 PHE 29 49 49 PHE PHE A . n A 1 30 ILE 30 50 50 ILE ILE A . n A 1 31 GLN 31 51 51 GLN GLN A . n A 1 32 SER 32 52 52 SER SER A . n A 1 33 TYR 33 53 53 TYR TYR A . n A 1 34 PHE 34 54 54 PHE PHE A . n A 1 35 VAL 35 55 55 VAL VAL A . n A 1 36 SER 36 56 56 SER SER A . n A 1 37 ASP 37 57 57 ASP ASP A . n A 1 38 TYR 38 58 58 TYR TYR A . n A 1 39 ASP 39 59 59 ASP ASP A . n A 1 40 PRO 40 60 60 PRO PRO A . n A 1 41 THR 41 61 61 THR THR A . n A 1 42 ILE 42 62 62 ILE ILE A . n A 1 43 GLU 43 63 63 GLU GLU A . n A 1 44 ASP 44 64 64 ASP ASP A . n A 1 45 SER 45 65 65 SER SER A . n A 1 46 TYR 46 66 66 TYR TYR A . n A 1 47 THR 47 67 67 THR THR A . n A 1 48 LYS 48 68 68 LYS LYS A . n A 1 49 ILE 49 69 69 ILE ILE A . n A 1 50 CYS 50 70 70 CYS CYS A . n A 1 51 SER 51 71 71 SER SER A . n A 1 52 VAL 52 72 72 VAL VAL A . n A 1 53 ASP 53 73 73 ASP ASP A . n A 1 54 GLY 54 74 74 GLY GLY A . n A 1 55 ILE 55 75 75 ILE ILE A . n A 1 56 PRO 56 76 76 PRO PRO A . n A 1 57 ALA 57 77 77 ALA ALA A . n A 1 58 ARG 58 78 78 ARG ARG A . n A 1 59 LEU 59 79 79 LEU LEU A . n A 1 60 ASP 60 80 80 ASP ASP A . n A 1 61 ILE 61 81 81 ILE ILE A . n A 1 62 LEU 62 82 82 LEU LEU A . n A 1 63 ASP 63 83 83 ASP ASP A . n A 1 64 THR 64 84 84 THR THR A . n A 1 65 ALA 65 85 85 ALA ALA A . n A 1 66 GLY 66 86 86 GLY GLY A . n A 1 67 GLN 67 87 87 GLN GLN A . n A 1 68 GLU 68 88 88 GLU GLU A . n A 1 69 GLU 69 89 89 GLU GLU A . n A 1 70 PHE 70 90 90 PHE PHE A . n A 1 71 GLY 71 91 91 GLY GLY A . n A 1 72 ALA 72 92 92 ALA ALA A . n A 1 73 MET 73 93 93 MET MET A . n A 1 74 ARG 74 94 94 ARG ARG A . n A 1 75 GLU 75 95 95 GLU GLU A . n A 1 76 GLN 76 96 96 GLN GLN A . n A 1 77 TYR 77 97 97 TYR TYR A . n A 1 78 MET 78 98 98 MET MET A . n A 1 79 ARG 79 99 99 ARG ARG A . n A 1 80 ALA 80 100 100 ALA ALA A . n A 1 81 GLY 81 101 101 GLY GLY A . n A 1 82 HIS 82 102 102 HIS HIS A . n A 1 83 GLY 83 103 103 GLY GLY A . n A 1 84 PHE 84 104 104 PHE PHE A . n A 1 85 LEU 85 105 105 LEU LEU A . n A 1 86 LEU 86 106 106 LEU LEU A . n A 1 87 VAL 87 107 107 VAL VAL A . n A 1 88 PHE 88 108 108 PHE PHE A . n A 1 89 ALA 89 109 109 ALA ALA A . n A 1 90 ILE 90 110 110 ILE ILE A . n A 1 91 ASN 91 111 111 ASN ASN A . n A 1 92 ASP 92 112 112 ASP ASP A . n A 1 93 ARG 93 113 113 ARG ARG A . n A 1 94 GLN 94 114 114 GLN GLN A . n A 1 95 SER 95 115 115 SER SER A . n A 1 96 PHE 96 116 116 PHE PHE A . n A 1 97 ASN 97 117 117 ASN ASN A . n A 1 98 GLU 98 118 118 GLU GLU A . n A 1 99 VAL 99 119 119 VAL VAL A . n A 1 100 GLY 100 120 120 GLY GLY A . n A 1 101 LYS 101 121 121 LYS LYS A . n A 1 102 LEU 102 122 122 LEU LEU A . n A 1 103 PHE 103 123 123 PHE PHE A . n A 1 104 THR 104 124 124 THR THR A . n A 1 105 GLN 105 125 125 GLN GLN A . n A 1 106 ILE 106 126 126 ILE ILE A . n A 1 107 LEU 107 127 127 LEU LEU A . n A 1 108 ARG 108 128 128 ARG ARG A . n A 1 109 VAL 109 129 129 VAL VAL A . n A 1 110 LYS 110 130 130 LYS LYS A . n A 1 111 ASP 111 131 131 ASP ASP A . n A 1 112 ARG 112 132 132 ARG ARG A . n A 1 113 ASP 113 133 133 ASP ASP A . n A 1 114 ASP 114 134 134 ASP ASP A . n A 1 115 PHE 115 135 135 PHE PHE A . n A 1 116 PRO 116 136 136 PRO PRO A . n A 1 117 VAL 117 137 137 VAL VAL A . n A 1 118 VAL 118 138 138 VAL VAL A . n A 1 119 LEU 119 139 139 LEU LEU A . n A 1 120 VAL 120 140 140 VAL VAL A . n A 1 121 GLY 121 141 141 GLY GLY A . n A 1 122 ASN 122 142 142 ASN ASN A . n A 1 123 LYS 123 143 143 LYS LYS A . n A 1 124 ALA 124 144 144 ALA ALA A . n A 1 125 ASP 125 145 145 ASP ASP A . n A 1 126 LEU 126 146 146 LEU LEU A . n A 1 127 GLU 127 147 147 GLU GLU A . n A 1 128 SER 128 148 148 SER SER A . n A 1 129 GLN 129 149 149 GLN GLN A . n A 1 130 ARG 130 150 150 ARG ARG A . n A 1 131 GLN 131 151 151 GLN GLN A . n A 1 132 VAL 132 152 152 VAL VAL A . n A 1 133 PRO 133 153 153 PRO PRO A . n A 1 134 ARG 134 154 154 ARG ARG A . n A 1 135 SER 135 155 155 SER SER A . n A 1 136 GLU 136 156 156 GLU GLU A . n A 1 137 ALA 137 157 157 ALA ALA A . n A 1 138 SER 138 158 158 SER SER A . n A 1 139 ALA 139 159 159 ALA ALA A . n A 1 140 PHE 140 160 160 PHE PHE A . n A 1 141 GLY 141 161 161 GLY GLY A . n A 1 142 ALA 142 162 162 ALA ALA A . n A 1 143 SER 143 163 163 SER SER A . n A 1 144 HIS 144 164 164 HIS HIS A . n A 1 145 HIS 145 165 165 HIS HIS A . n A 1 146 VAL 146 166 166 VAL VAL A . n A 1 147 ALA 147 167 167 ALA ALA A . n A 1 148 TYR 148 168 168 TYR TYR A . n A 1 149 PHE 149 169 169 PHE PHE A . n A 1 150 GLU 150 170 170 GLU GLU A . n A 1 151 ALA 151 171 171 ALA ALA A . n A 1 152 SER 152 172 172 SER SER A . n A 1 153 ALA 153 173 173 ALA ALA A . n A 1 154 LYS 154 174 174 LYS LYS A . n A 1 155 LEU 155 175 175 LEU LEU A . n A 1 156 ARG 156 176 176 ARG ARG A . n A 1 157 LEU 157 177 177 LEU LEU A . n A 1 158 ASN 158 178 178 ASN ASN A . n A 1 159 VAL 159 179 179 VAL VAL A . n A 1 160 ASP 160 180 180 ASP ASP A . n A 1 161 GLU 161 181 181 GLU GLU A . n A 1 162 ALA 162 182 182 ALA ALA A . n A 1 163 PHE 163 183 183 PHE PHE A . n A 1 164 GLU 164 184 184 GLU GLU A . n A 1 165 GLN 165 185 185 GLN GLN A . n A 1 166 LEU 166 186 186 LEU LEU A . n A 1 167 VAL 167 187 187 VAL VAL A . n A 1 168 ARG 168 188 188 ARG ARG A . n A 1 169 ALA 169 189 189 ALA ALA A . n A 1 170 VAL 170 190 190 VAL VAL A . n A 1 171 ARG 171 191 191 ARG ARG A . n A 1 172 LYS 172 192 192 LYS LYS A . n A 1 173 TYR 173 193 193 TYR TYR A . n A 1 174 GLN 174 194 194 GLN GLN A . n A 1 175 GLU 175 195 195 GLU GLU A . n A 1 176 GLN 176 196 196 GLN GLN A . n A 1 177 GLU 177 197 ? ? ? A . n A 1 178 LEU 178 198 ? ? ? A . n A 1 179 PRO 179 199 ? ? ? A . n A 1 180 PRO 180 200 ? ? ? A . n A 1 181 SER 181 201 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'Structural Genomics Consortium' _pdbx_SG_project.initial_of_center SGC # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MG 1 2 1 MG MG A . C 3 GDP 1 1 1 GDP GDP A . D 4 HOH 1 202 5 HOH HOH A . D 4 HOH 2 203 7 HOH HOH A . D 4 HOH 3 204 10 HOH HOH A . D 4 HOH 4 205 11 HOH HOH A . D 4 HOH 5 206 13 HOH HOH A . D 4 HOH 6 207 14 HOH HOH A . D 4 HOH 7 208 15 HOH HOH A . D 4 HOH 8 209 18 HOH HOH A . D 4 HOH 9 210 19 HOH HOH A . D 4 HOH 10 211 23 HOH HOH A . D 4 HOH 11 212 26 HOH HOH A . D 4 HOH 12 213 30 HOH HOH A . D 4 HOH 13 214 31 HOH HOH A . D 4 HOH 14 215 37 HOH HOH A . D 4 HOH 15 216 38 HOH HOH A . D 4 HOH 16 217 39 HOH HOH A . D 4 HOH 17 218 40 HOH HOH A . D 4 HOH 18 219 44 HOH HOH A . D 4 HOH 19 220 45 HOH HOH A . D 4 HOH 20 221 47 HOH HOH A . D 4 HOH 21 222 49 HOH HOH A . D 4 HOH 22 223 50 HOH HOH A . D 4 HOH 23 224 54 HOH HOH A . D 4 HOH 24 225 57 HOH HOH A . D 4 HOH 25 226 59 HOH HOH A . D 4 HOH 26 227 66 HOH HOH A . D 4 HOH 27 228 67 HOH HOH A . D 4 HOH 28 229 68 HOH HOH A . D 4 HOH 29 230 69 HOH HOH A . D 4 HOH 30 231 70 HOH HOH A . D 4 HOH 31 232 71 HOH HOH A . D 4 HOH 32 233 72 HOH HOH A . D 4 HOH 33 234 79 HOH HOH A . D 4 HOH 34 235 83 HOH HOH A . D 4 HOH 35 236 84 HOH HOH A . D 4 HOH 36 237 85 HOH HOH A . D 4 HOH 37 238 86 HOH HOH A . D 4 HOH 38 239 89 HOH HOH A . D 4 HOH 39 240 90 HOH HOH A . D 4 HOH 40 241 93 HOH HOH A . D 4 HOH 41 242 104 HOH HOH A . D 4 HOH 42 243 105 HOH HOH A . D 4 HOH 43 244 106 HOH HOH A . D 4 HOH 44 245 108 HOH HOH A . D 4 HOH 45 246 111 HOH HOH A . D 4 HOH 46 247 112 HOH HOH A . D 4 HOH 47 248 115 HOH HOH A . D 4 HOH 48 249 116 HOH HOH A . D 4 HOH 49 250 119 HOH HOH A . D 4 HOH 50 251 120 HOH HOH A . D 4 HOH 51 252 121 HOH HOH A . D 4 HOH 52 253 122 HOH HOH A . D 4 HOH 53 254 123 HOH HOH A . D 4 HOH 54 255 124 HOH HOH A . D 4 HOH 55 256 125 HOH HOH A . D 4 HOH 56 257 126 HOH HOH A . D 4 HOH 57 258 127 HOH HOH A . D 4 HOH 58 259 128 HOH HOH A . D 4 HOH 59 260 129 HOH HOH A . D 4 HOH 60 261 132 HOH HOH A . D 4 HOH 61 262 134 HOH HOH A . D 4 HOH 62 263 135 HOH HOH A . D 4 HOH 63 264 137 HOH HOH A . D 4 HOH 64 265 138 HOH HOH A . D 4 HOH 65 266 139 HOH HOH A . D 4 HOH 66 267 202 HOH HOH A . D 4 HOH 67 268 204 HOH HOH A . D 4 HOH 68 269 205 HOH HOH A . D 4 HOH 69 270 211 HOH HOH A . D 4 HOH 70 271 212 HOH HOH A . D 4 HOH 71 272 213 HOH HOH A . D 4 HOH 72 273 214 HOH HOH A . D 4 HOH 73 274 215 HOH HOH A . D 4 HOH 74 275 218 HOH HOH A . D 4 HOH 75 276 220 HOH HOH A . D 4 HOH 76 277 222 HOH HOH A . D 4 HOH 77 278 224 HOH HOH A . D 4 HOH 78 279 225 HOH HOH A . D 4 HOH 79 280 226 HOH HOH A . D 4 HOH 80 281 228 HOH HOH A . D 4 HOH 81 282 229 HOH HOH A . D 4 HOH 82 283 230 HOH HOH A . D 4 HOH 83 284 231 HOH HOH A . D 4 HOH 84 285 234 HOH HOH A . D 4 HOH 85 286 237 HOH HOH A . D 4 HOH 86 287 240 HOH HOH A . D 4 HOH 87 288 241 HOH HOH A . D 4 HOH 88 289 242 HOH HOH A . D 4 HOH 89 290 243 HOH HOH A . D 4 HOH 90 291 244 HOH HOH A . D 4 HOH 91 292 245 HOH HOH A . D 4 HOH 92 293 248 HOH HOH A . D 4 HOH 93 294 249 HOH HOH A . D 4 HOH 94 295 250 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O2B ? C GDP . ? A GDP 1 ? 1_555 MG ? B MG . ? A MG 2 ? 1_555 OG ? A SER 23 ? A SER 43 ? 1_555 88.4 ? 2 O2B ? C GDP . ? A GDP 1 ? 1_555 MG ? B MG . ? A MG 2 ? 1_555 O ? D HOH . ? A HOH 230 ? 1_555 87.8 ? 3 OG ? A SER 23 ? A SER 43 ? 1_555 MG ? B MG . ? A MG 2 ? 1_555 O ? D HOH . ? A HOH 230 ? 1_555 176.1 ? 4 O2B ? C GDP . ? A GDP 1 ? 1_555 MG ? B MG . ? A MG 2 ? 1_555 O ? D HOH . ? A HOH 236 ? 1_555 86.5 ? 5 OG ? A SER 23 ? A SER 43 ? 1_555 MG ? B MG . ? A MG 2 ? 1_555 O ? D HOH . ? A HOH 236 ? 1_555 84.1 ? 6 O ? D HOH . ? A HOH 230 ? 1_555 MG ? B MG . ? A MG 2 ? 1_555 O ? D HOH . ? A HOH 236 ? 1_555 94.7 ? 7 O2B ? C GDP . ? A GDP 1 ? 1_555 MG ? B MG . ? A MG 2 ? 1_555 O ? D HOH . ? A HOH 240 ? 1_555 175.5 ? 8 OG ? A SER 23 ? A SER 43 ? 1_555 MG ? B MG . ? A MG 2 ? 1_555 O ? D HOH . ? A HOH 240 ? 1_555 93.3 ? 9 O ? D HOH . ? A HOH 230 ? 1_555 MG ? B MG . ? A MG 2 ? 1_555 O ? D HOH . ? A HOH 240 ? 1_555 90.5 ? 10 O ? D HOH . ? A HOH 236 ? 1_555 MG ? B MG . ? A MG 2 ? 1_555 O ? D HOH . ? A HOH 240 ? 1_555 89.6 ? 11 O2B ? C GDP . ? A GDP 1 ? 1_555 MG ? B MG . ? A MG 2 ? 1_555 O ? D HOH . ? A HOH 249 ? 1_555 99.9 ? 12 OG ? A SER 23 ? A SER 43 ? 1_555 MG ? B MG . ? A MG 2 ? 1_555 O ? D HOH . ? A HOH 249 ? 1_555 86.9 ? 13 O ? D HOH . ? A HOH 230 ? 1_555 MG ? B MG . ? A MG 2 ? 1_555 O ? D HOH . ? A HOH 249 ? 1_555 94.7 ? 14 O ? D HOH . ? A HOH 236 ? 1_555 MG ? B MG . ? A MG 2 ? 1_555 O ? D HOH . ? A HOH 249 ? 1_555 168.8 ? 15 O ? D HOH . ? A HOH 240 ? 1_555 MG ? B MG . ? A MG 2 ? 1_555 O ? D HOH . ? A HOH 249 ? 1_555 84.3 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-01-31 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2023-08-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' Advisory 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 4 'Structure model' 'Derived calculations' 7 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' chem_comp_atom 2 4 'Structure model' chem_comp_bond 3 4 'Structure model' database_2 4 4 'Structure model' pdbx_initial_refinement_model 5 4 'Structure model' pdbx_struct_conn_angle 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_ref_seq_dif 8 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.value' 16 4 'Structure model' '_struct_conn.pdbx_dist_value' 17 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 18 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 19 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 22 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 23 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 24 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 25 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 27 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 28 4 'Structure model' '_struct_ref_seq_dif.details' 29 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 30 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 31 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.pdbx_refine_id 1 ? refined 7.7335 29.4233 18.2970 -0.0680 0.2258 -0.1171 0.0281 0.0285 0.0963 3.6860 3.2040 3.5745 0.2655 -0.1999 0.0325 0.0678 -1.0051 -0.1337 0.5134 -0.1210 -0.1763 0.2643 0.4944 0.0533 'X-RAY DIFFRACTION' 2 ? refined 2.8945 38.1252 9.0429 -0.2168 -0.0565 -0.1530 -0.0015 0.0508 -0.0245 3.7043 3.0817 3.2264 1.0275 -0.5214 -0.1257 0.1143 -0.5526 0.3133 0.1285 -0.2222 0.0964 -0.2167 0.3086 0.1079 'X-RAY DIFFRACTION' # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.selection_details 1 1 A 24 A 4 A 96 A 76 ? 'X-RAY DIFFRACTION' ? 2 2 A 97 A 77 A 196 A 176 ? 'X-RAY DIFFRACTION' ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.2.0019 ? 1 HKL-2000 'data reduction' . ? 2 SCALEPACK 'data scaling' . ? 3 PHASER phasing . ? 4 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OD1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ASP _pdbx_validate_close_contact.auth_seq_id_1 73 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 265 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.11 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 25 ? ? -47.40 160.03 2 1 PRO A 26 ? ? -87.10 -110.88 3 1 GLU A 28 ? ? -95.13 39.92 4 1 ASP A 57 ? ? -143.24 49.47 5 1 ASP A 59 ? ? -17.53 102.56 6 1 GLU A 89 ? ? -136.84 -42.13 7 1 LYS A 143 ? ? 72.01 37.67 8 1 LEU A 146 ? ? -109.91 44.62 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 31 ? CD ? A LYS 11 CD 2 1 Y 1 A LYS 31 ? CE ? A LYS 11 CE 3 1 Y 1 A LYS 31 ? NZ ? A LYS 11 NZ 4 1 Y 1 A GLN 96 ? CD ? A GLN 76 CD 5 1 Y 1 A GLN 96 ? OE1 ? A GLN 76 OE1 6 1 Y 1 A GLN 96 ? NE2 ? A GLN 76 NE2 7 1 Y 1 A GLN 114 ? CG ? A GLN 94 CG 8 1 Y 1 A GLN 114 ? CD ? A GLN 94 CD 9 1 Y 1 A GLN 114 ? OE1 ? A GLN 94 OE1 10 1 Y 1 A GLN 114 ? NE2 ? A GLN 94 NE2 11 1 Y 1 A LYS 121 ? CD ? A LYS 101 CD 12 1 Y 1 A LYS 121 ? CE ? A LYS 101 CE 13 1 Y 1 A LYS 121 ? NZ ? A LYS 101 NZ 14 1 Y 1 A LYS 192 ? CD ? A LYS 172 CD 15 1 Y 1 A LYS 192 ? CE ? A LYS 172 CE 16 1 Y 1 A LYS 192 ? NZ ? A LYS 172 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 21 ? A SER 1 2 1 Y 1 A MET 22 ? A MET 2 3 1 Y 1 A ASP 23 ? A ASP 3 4 1 Y 1 A GLU 197 ? A GLU 177 5 1 Y 1 A LEU 198 ? A LEU 178 6 1 Y 1 A PRO 199 ? A PRO 179 7 1 Y 1 A PRO 200 ? A PRO 180 8 1 Y 1 A SER 201 ? A SER 181 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GDP PB P N N 88 GDP O1B O N N 89 GDP O2B O N N 90 GDP O3B O N N 91 GDP O3A O N N 92 GDP PA P N N 93 GDP O1A O N N 94 GDP O2A O N N 95 GDP "O5'" O N N 96 GDP "C5'" C N N 97 GDP "C4'" C N R 98 GDP "O4'" O N N 99 GDP "C3'" C N S 100 GDP "O3'" O N N 101 GDP "C2'" C N R 102 GDP "O2'" O N N 103 GDP "C1'" C N R 104 GDP N9 N Y N 105 GDP C8 C Y N 106 GDP N7 N Y N 107 GDP C5 C Y N 108 GDP C6 C N N 109 GDP O6 O N N 110 GDP N1 N N N 111 GDP C2 C N N 112 GDP N2 N N N 113 GDP N3 N N N 114 GDP C4 C Y N 115 GDP HOB2 H N N 116 GDP HOB3 H N N 117 GDP HOA2 H N N 118 GDP "H5'" H N N 119 GDP "H5''" H N N 120 GDP "H4'" H N N 121 GDP "H3'" H N N 122 GDP "HO3'" H N N 123 GDP "H2'" H N N 124 GDP "HO2'" H N N 125 GDP "H1'" H N N 126 GDP H8 H N N 127 GDP HN1 H N N 128 GDP HN21 H N N 129 GDP HN22 H N N 130 GLN N N N N 131 GLN CA C N S 132 GLN C C N N 133 GLN O O N N 134 GLN CB C N N 135 GLN CG C N N 136 GLN CD C N N 137 GLN OE1 O N N 138 GLN NE2 N N N 139 GLN OXT O N N 140 GLN H H N N 141 GLN H2 H N N 142 GLN HA H N N 143 GLN HB2 H N N 144 GLN HB3 H N N 145 GLN HG2 H N N 146 GLN HG3 H N N 147 GLN HE21 H N N 148 GLN HE22 H N N 149 GLN HXT H N N 150 GLU N N N N 151 GLU CA C N S 152 GLU C C N N 153 GLU O O N N 154 GLU CB C N N 155 GLU CG C N N 156 GLU CD C N N 157 GLU OE1 O N N 158 GLU OE2 O N N 159 GLU OXT O N N 160 GLU H H N N 161 GLU H2 H N N 162 GLU HA H N N 163 GLU HB2 H N N 164 GLU HB3 H N N 165 GLU HG2 H N N 166 GLU HG3 H N N 167 GLU HE2 H N N 168 GLU HXT H N N 169 GLY N N N N 170 GLY CA C N N 171 GLY C C N N 172 GLY O O N N 173 GLY OXT O N N 174 GLY H H N N 175 GLY H2 H N N 176 GLY HA2 H N N 177 GLY HA3 H N N 178 GLY HXT H N N 179 HIS N N N N 180 HIS CA C N S 181 HIS C C N N 182 HIS O O N N 183 HIS CB C N N 184 HIS CG C Y N 185 HIS ND1 N Y N 186 HIS CD2 C Y N 187 HIS CE1 C Y N 188 HIS NE2 N Y N 189 HIS OXT O N N 190 HIS H H N N 191 HIS H2 H N N 192 HIS HA H N N 193 HIS HB2 H N N 194 HIS HB3 H N N 195 HIS HD1 H N N 196 HIS HD2 H N N 197 HIS HE1 H N N 198 HIS HE2 H N N 199 HIS HXT H N N 200 HOH O O N N 201 HOH H1 H N N 202 HOH H2 H N N 203 ILE N N N N 204 ILE CA C N S 205 ILE C C N N 206 ILE O O N N 207 ILE CB C N S 208 ILE CG1 C N N 209 ILE CG2 C N N 210 ILE CD1 C N N 211 ILE OXT O N N 212 ILE H H N N 213 ILE H2 H N N 214 ILE HA H N N 215 ILE HB H N N 216 ILE HG12 H N N 217 ILE HG13 H N N 218 ILE HG21 H N N 219 ILE HG22 H N N 220 ILE HG23 H N N 221 ILE HD11 H N N 222 ILE HD12 H N N 223 ILE HD13 H N N 224 ILE HXT H N N 225 LEU N N N N 226 LEU CA C N S 227 LEU C C N N 228 LEU O O N N 229 LEU CB C N N 230 LEU CG C N N 231 LEU CD1 C N N 232 LEU CD2 C N N 233 LEU OXT O N N 234 LEU H H N N 235 LEU H2 H N N 236 LEU HA H N N 237 LEU HB2 H N N 238 LEU HB3 H N N 239 LEU HG H N N 240 LEU HD11 H N N 241 LEU HD12 H N N 242 LEU HD13 H N N 243 LEU HD21 H N N 244 LEU HD22 H N N 245 LEU HD23 H N N 246 LEU HXT H N N 247 LYS N N N N 248 LYS CA C N S 249 LYS C C N N 250 LYS O O N N 251 LYS CB C N N 252 LYS CG C N N 253 LYS CD C N N 254 LYS CE C N N 255 LYS NZ N N N 256 LYS OXT O N N 257 LYS H H N N 258 LYS H2 H N N 259 LYS HA H N N 260 LYS HB2 H N N 261 LYS HB3 H N N 262 LYS HG2 H N N 263 LYS HG3 H N N 264 LYS HD2 H N N 265 LYS HD3 H N N 266 LYS HE2 H N N 267 LYS HE3 H N N 268 LYS HZ1 H N N 269 LYS HZ2 H N N 270 LYS HZ3 H N N 271 LYS HXT H N N 272 MET N N N N 273 MET CA C N S 274 MET C C N N 275 MET O O N N 276 MET CB C N N 277 MET CG C N N 278 MET SD S N N 279 MET CE C N N 280 MET OXT O N N 281 MET H H N N 282 MET H2 H N N 283 MET HA H N N 284 MET HB2 H N N 285 MET HB3 H N N 286 MET HG2 H N N 287 MET HG3 H N N 288 MET HE1 H N N 289 MET HE2 H N N 290 MET HE3 H N N 291 MET HXT H N N 292 MG MG MG N N 293 PHE N N N N 294 PHE CA C N S 295 PHE C C N N 296 PHE O O N N 297 PHE CB C N N 298 PHE CG C Y N 299 PHE CD1 C Y N 300 PHE CD2 C Y N 301 PHE CE1 C Y N 302 PHE CE2 C Y N 303 PHE CZ C Y N 304 PHE OXT O N N 305 PHE H H N N 306 PHE H2 H N N 307 PHE HA H N N 308 PHE HB2 H N N 309 PHE HB3 H N N 310 PHE HD1 H N N 311 PHE HD2 H N N 312 PHE HE1 H N N 313 PHE HE2 H N N 314 PHE HZ H N N 315 PHE HXT H N N 316 PRO N N N N 317 PRO CA C N S 318 PRO C C N N 319 PRO O O N N 320 PRO CB C N N 321 PRO CG C N N 322 PRO CD C N N 323 PRO OXT O N N 324 PRO H H N N 325 PRO HA H N N 326 PRO HB2 H N N 327 PRO HB3 H N N 328 PRO HG2 H N N 329 PRO HG3 H N N 330 PRO HD2 H N N 331 PRO HD3 H N N 332 PRO HXT H N N 333 SER N N N N 334 SER CA C N S 335 SER C C N N 336 SER O O N N 337 SER CB C N N 338 SER OG O N N 339 SER OXT O N N 340 SER H H N N 341 SER H2 H N N 342 SER HA H N N 343 SER HB2 H N N 344 SER HB3 H N N 345 SER HG H N N 346 SER HXT H N N 347 THR N N N N 348 THR CA C N S 349 THR C C N N 350 THR O O N N 351 THR CB C N R 352 THR OG1 O N N 353 THR CG2 C N N 354 THR OXT O N N 355 THR H H N N 356 THR H2 H N N 357 THR HA H N N 358 THR HB H N N 359 THR HG1 H N N 360 THR HG21 H N N 361 THR HG22 H N N 362 THR HG23 H N N 363 THR HXT H N N 364 TYR N N N N 365 TYR CA C N S 366 TYR C C N N 367 TYR O O N N 368 TYR CB C N N 369 TYR CG C Y N 370 TYR CD1 C Y N 371 TYR CD2 C Y N 372 TYR CE1 C Y N 373 TYR CE2 C Y N 374 TYR CZ C Y N 375 TYR OH O N N 376 TYR OXT O N N 377 TYR H H N N 378 TYR H2 H N N 379 TYR HA H N N 380 TYR HB2 H N N 381 TYR HB3 H N N 382 TYR HD1 H N N 383 TYR HD2 H N N 384 TYR HE1 H N N 385 TYR HE2 H N N 386 TYR HH H N N 387 TYR HXT H N N 388 VAL N N N N 389 VAL CA C N S 390 VAL C C N N 391 VAL O O N N 392 VAL CB C N N 393 VAL CG1 C N N 394 VAL CG2 C N N 395 VAL OXT O N N 396 VAL H H N N 397 VAL H2 H N N 398 VAL HA H N N 399 VAL HB H N N 400 VAL HG11 H N N 401 VAL HG12 H N N 402 VAL HG13 H N N 403 VAL HG21 H N N 404 VAL HG22 H N N 405 VAL HG23 H N N 406 VAL HXT H N N 407 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GDP PB O1B doub N N 83 GDP PB O2B sing N N 84 GDP PB O3B sing N N 85 GDP PB O3A sing N N 86 GDP O2B HOB2 sing N N 87 GDP O3B HOB3 sing N N 88 GDP O3A PA sing N N 89 GDP PA O1A doub N N 90 GDP PA O2A sing N N 91 GDP PA "O5'" sing N N 92 GDP O2A HOA2 sing N N 93 GDP "O5'" "C5'" sing N N 94 GDP "C5'" "C4'" sing N N 95 GDP "C5'" "H5'" sing N N 96 GDP "C5'" "H5''" sing N N 97 GDP "C4'" "O4'" sing N N 98 GDP "C4'" "C3'" sing N N 99 GDP "C4'" "H4'" sing N N 100 GDP "O4'" "C1'" sing N N 101 GDP "C3'" "O3'" sing N N 102 GDP "C3'" "C2'" sing N N 103 GDP "C3'" "H3'" sing N N 104 GDP "O3'" "HO3'" sing N N 105 GDP "C2'" "O2'" sing N N 106 GDP "C2'" "C1'" sing N N 107 GDP "C2'" "H2'" sing N N 108 GDP "O2'" "HO2'" sing N N 109 GDP "C1'" N9 sing N N 110 GDP "C1'" "H1'" sing N N 111 GDP N9 C8 sing Y N 112 GDP N9 C4 sing Y N 113 GDP C8 N7 doub Y N 114 GDP C8 H8 sing N N 115 GDP N7 C5 sing Y N 116 GDP C5 C6 sing N N 117 GDP C5 C4 doub Y N 118 GDP C6 O6 doub N N 119 GDP C6 N1 sing N N 120 GDP N1 C2 sing N N 121 GDP N1 HN1 sing N N 122 GDP C2 N2 sing N N 123 GDP C2 N3 doub N N 124 GDP N2 HN21 sing N N 125 GDP N2 HN22 sing N N 126 GDP N3 C4 sing N N 127 GLN N CA sing N N 128 GLN N H sing N N 129 GLN N H2 sing N N 130 GLN CA C sing N N 131 GLN CA CB sing N N 132 GLN CA HA sing N N 133 GLN C O doub N N 134 GLN C OXT sing N N 135 GLN CB CG sing N N 136 GLN CB HB2 sing N N 137 GLN CB HB3 sing N N 138 GLN CG CD sing N N 139 GLN CG HG2 sing N N 140 GLN CG HG3 sing N N 141 GLN CD OE1 doub N N 142 GLN CD NE2 sing N N 143 GLN NE2 HE21 sing N N 144 GLN NE2 HE22 sing N N 145 GLN OXT HXT sing N N 146 GLU N CA sing N N 147 GLU N H sing N N 148 GLU N H2 sing N N 149 GLU CA C sing N N 150 GLU CA CB sing N N 151 GLU CA HA sing N N 152 GLU C O doub N N 153 GLU C OXT sing N N 154 GLU CB CG sing N N 155 GLU CB HB2 sing N N 156 GLU CB HB3 sing N N 157 GLU CG CD sing N N 158 GLU CG HG2 sing N N 159 GLU CG HG3 sing N N 160 GLU CD OE1 doub N N 161 GLU CD OE2 sing N N 162 GLU OE2 HE2 sing N N 163 GLU OXT HXT sing N N 164 GLY N CA sing N N 165 GLY N H sing N N 166 GLY N H2 sing N N 167 GLY CA C sing N N 168 GLY CA HA2 sing N N 169 GLY CA HA3 sing N N 170 GLY C O doub N N 171 GLY C OXT sing N N 172 GLY OXT HXT sing N N 173 HIS N CA sing N N 174 HIS N H sing N N 175 HIS N H2 sing N N 176 HIS CA C sing N N 177 HIS CA CB sing N N 178 HIS CA HA sing N N 179 HIS C O doub N N 180 HIS C OXT sing N N 181 HIS CB CG sing N N 182 HIS CB HB2 sing N N 183 HIS CB HB3 sing N N 184 HIS CG ND1 sing Y N 185 HIS CG CD2 doub Y N 186 HIS ND1 CE1 doub Y N 187 HIS ND1 HD1 sing N N 188 HIS CD2 NE2 sing Y N 189 HIS CD2 HD2 sing N N 190 HIS CE1 NE2 sing Y N 191 HIS CE1 HE1 sing N N 192 HIS NE2 HE2 sing N N 193 HIS OXT HXT sing N N 194 HOH O H1 sing N N 195 HOH O H2 sing N N 196 ILE N CA sing N N 197 ILE N H sing N N 198 ILE N H2 sing N N 199 ILE CA C sing N N 200 ILE CA CB sing N N 201 ILE CA HA sing N N 202 ILE C O doub N N 203 ILE C OXT sing N N 204 ILE CB CG1 sing N N 205 ILE CB CG2 sing N N 206 ILE CB HB sing N N 207 ILE CG1 CD1 sing N N 208 ILE CG1 HG12 sing N N 209 ILE CG1 HG13 sing N N 210 ILE CG2 HG21 sing N N 211 ILE CG2 HG22 sing N N 212 ILE CG2 HG23 sing N N 213 ILE CD1 HD11 sing N N 214 ILE CD1 HD12 sing N N 215 ILE CD1 HD13 sing N N 216 ILE OXT HXT sing N N 217 LEU N CA sing N N 218 LEU N H sing N N 219 LEU N H2 sing N N 220 LEU CA C sing N N 221 LEU CA CB sing N N 222 LEU CA HA sing N N 223 LEU C O doub N N 224 LEU C OXT sing N N 225 LEU CB CG sing N N 226 LEU CB HB2 sing N N 227 LEU CB HB3 sing N N 228 LEU CG CD1 sing N N 229 LEU CG CD2 sing N N 230 LEU CG HG sing N N 231 LEU CD1 HD11 sing N N 232 LEU CD1 HD12 sing N N 233 LEU CD1 HD13 sing N N 234 LEU CD2 HD21 sing N N 235 LEU CD2 HD22 sing N N 236 LEU CD2 HD23 sing N N 237 LEU OXT HXT sing N N 238 LYS N CA sing N N 239 LYS N H sing N N 240 LYS N H2 sing N N 241 LYS CA C sing N N 242 LYS CA CB sing N N 243 LYS CA HA sing N N 244 LYS C O doub N N 245 LYS C OXT sing N N 246 LYS CB CG sing N N 247 LYS CB HB2 sing N N 248 LYS CB HB3 sing N N 249 LYS CG CD sing N N 250 LYS CG HG2 sing N N 251 LYS CG HG3 sing N N 252 LYS CD CE sing N N 253 LYS CD HD2 sing N N 254 LYS CD HD3 sing N N 255 LYS CE NZ sing N N 256 LYS CE HE2 sing N N 257 LYS CE HE3 sing N N 258 LYS NZ HZ1 sing N N 259 LYS NZ HZ2 sing N N 260 LYS NZ HZ3 sing N N 261 LYS OXT HXT sing N N 262 MET N CA sing N N 263 MET N H sing N N 264 MET N H2 sing N N 265 MET CA C sing N N 266 MET CA CB sing N N 267 MET CA HA sing N N 268 MET C O doub N N 269 MET C OXT sing N N 270 MET CB CG sing N N 271 MET CB HB2 sing N N 272 MET CB HB3 sing N N 273 MET CG SD sing N N 274 MET CG HG2 sing N N 275 MET CG HG3 sing N N 276 MET SD CE sing N N 277 MET CE HE1 sing N N 278 MET CE HE2 sing N N 279 MET CE HE3 sing N N 280 MET OXT HXT sing N N 281 PHE N CA sing N N 282 PHE N H sing N N 283 PHE N H2 sing N N 284 PHE CA C sing N N 285 PHE CA CB sing N N 286 PHE CA HA sing N N 287 PHE C O doub N N 288 PHE C OXT sing N N 289 PHE CB CG sing N N 290 PHE CB HB2 sing N N 291 PHE CB HB3 sing N N 292 PHE CG CD1 doub Y N 293 PHE CG CD2 sing Y N 294 PHE CD1 CE1 sing Y N 295 PHE CD1 HD1 sing N N 296 PHE CD2 CE2 doub Y N 297 PHE CD2 HD2 sing N N 298 PHE CE1 CZ doub Y N 299 PHE CE1 HE1 sing N N 300 PHE CE2 CZ sing Y N 301 PHE CE2 HE2 sing N N 302 PHE CZ HZ sing N N 303 PHE OXT HXT sing N N 304 PRO N CA sing N N 305 PRO N CD sing N N 306 PRO N H sing N N 307 PRO CA C sing N N 308 PRO CA CB sing N N 309 PRO CA HA sing N N 310 PRO C O doub N N 311 PRO C OXT sing N N 312 PRO CB CG sing N N 313 PRO CB HB2 sing N N 314 PRO CB HB3 sing N N 315 PRO CG CD sing N N 316 PRO CG HG2 sing N N 317 PRO CG HG3 sing N N 318 PRO CD HD2 sing N N 319 PRO CD HD3 sing N N 320 PRO OXT HXT sing N N 321 SER N CA sing N N 322 SER N H sing N N 323 SER N H2 sing N N 324 SER CA C sing N N 325 SER CA CB sing N N 326 SER CA HA sing N N 327 SER C O doub N N 328 SER C OXT sing N N 329 SER CB OG sing N N 330 SER CB HB2 sing N N 331 SER CB HB3 sing N N 332 SER OG HG sing N N 333 SER OXT HXT sing N N 334 THR N CA sing N N 335 THR N H sing N N 336 THR N H2 sing N N 337 THR CA C sing N N 338 THR CA CB sing N N 339 THR CA HA sing N N 340 THR C O doub N N 341 THR C OXT sing N N 342 THR CB OG1 sing N N 343 THR CB CG2 sing N N 344 THR CB HB sing N N 345 THR OG1 HG1 sing N N 346 THR CG2 HG21 sing N N 347 THR CG2 HG22 sing N N 348 THR CG2 HG23 sing N N 349 THR OXT HXT sing N N 350 TYR N CA sing N N 351 TYR N H sing N N 352 TYR N H2 sing N N 353 TYR CA C sing N N 354 TYR CA CB sing N N 355 TYR CA HA sing N N 356 TYR C O doub N N 357 TYR C OXT sing N N 358 TYR CB CG sing N N 359 TYR CB HB2 sing N N 360 TYR CB HB3 sing N N 361 TYR CG CD1 doub Y N 362 TYR CG CD2 sing Y N 363 TYR CD1 CE1 sing Y N 364 TYR CD1 HD1 sing N N 365 TYR CD2 CE2 doub Y N 366 TYR CD2 HD2 sing N N 367 TYR CE1 CZ doub Y N 368 TYR CE1 HE1 sing N N 369 TYR CE2 CZ sing Y N 370 TYR CE2 HE2 sing N N 371 TYR CZ OH sing N N 372 TYR OH HH sing N N 373 TYR OXT HXT sing N N 374 VAL N CA sing N N 375 VAL N H sing N N 376 VAL N H2 sing N N 377 VAL CA C sing N N 378 VAL CA CB sing N N 379 VAL CA HA sing N N 380 VAL C O doub N N 381 VAL C OXT sing N N 382 VAL CB CG1 sing N N 383 VAL CB CG2 sing N N 384 VAL CB HB sing N N 385 VAL CG1 HG11 sing N N 386 VAL CG1 HG12 sing N N 387 VAL CG1 HG13 sing N N 388 VAL CG2 HG21 sing N N 389 VAL CG2 HG22 sing N N 390 VAL CG2 HG23 sing N N 391 VAL OXT HXT sing N N 392 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MAGNESIUM ION' MG 3 "GUANOSINE-5'-DIPHOSPHATE" GDP 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2ERY _pdbx_initial_refinement_model.details 2ERY.pdb #