data_2G0U # _entry.id 2G0U # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2G0U pdb_00002g0u 10.2210/pdb2g0u/pdb RCSB RCSB036546 ? ? WWPDB D_1000036546 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2G0U _pdbx_database_status.recvd_initial_deposition_date 2006-02-13 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Zhang, L.' 1 'Wang, Y.' 2 'Picking, W.L.' 3 'Picking, W.D.' 4 'De Guzman, R.N.' 5 # _citation.id primary _citation.title 'Solution Structure of Monomeric BsaL, the Type III Secretion Needle Protein of Burkholderia pseudomallei.' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 359 _citation.page_first 322 _citation.page_last 330 _citation.year 2006 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16631790 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2006.03.028 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhang, L.' 1 ? primary 'Wang, Y.' 2 ? primary 'Picking, W.L.' 3 ? primary 'Picking, W.D.' 4 ? primary 'De Guzman, R.N.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'type III secretion system needle protein' _entity.formula_weight 10368.455 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment BsaLdelta5 _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSNPPTPLLADYEWSGYLTGIGRAFDDGVKDLNKQLQDAQANLTKNPSDPTALANYQMIMSEYNLYRNAQSSAVKSMKDI DSSILEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MSNPPTPLLADYEWSGYLTGIGRAFDDGVKDLNKQLQDAQANLTKNPSDPTALANYQMIMSEYNLYRNAQSSAVKSMKDI DSSILEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 ASN n 1 4 PRO n 1 5 PRO n 1 6 THR n 1 7 PRO n 1 8 LEU n 1 9 LEU n 1 10 ALA n 1 11 ASP n 1 12 TYR n 1 13 GLU n 1 14 TRP n 1 15 SER n 1 16 GLY n 1 17 TYR n 1 18 LEU n 1 19 THR n 1 20 GLY n 1 21 ILE n 1 22 GLY n 1 23 ARG n 1 24 ALA n 1 25 PHE n 1 26 ASP n 1 27 ASP n 1 28 GLY n 1 29 VAL n 1 30 LYS n 1 31 ASP n 1 32 LEU n 1 33 ASN n 1 34 LYS n 1 35 GLN n 1 36 LEU n 1 37 GLN n 1 38 ASP n 1 39 ALA n 1 40 GLN n 1 41 ALA n 1 42 ASN n 1 43 LEU n 1 44 THR n 1 45 LYS n 1 46 ASN n 1 47 PRO n 1 48 SER n 1 49 ASP n 1 50 PRO n 1 51 THR n 1 52 ALA n 1 53 LEU n 1 54 ALA n 1 55 ASN n 1 56 TYR n 1 57 GLN n 1 58 MET n 1 59 ILE n 1 60 MET n 1 61 SER n 1 62 GLU n 1 63 TYR n 1 64 ASN n 1 65 LEU n 1 66 TYR n 1 67 ARG n 1 68 ASN n 1 69 ALA n 1 70 GLN n 1 71 SER n 1 72 SER n 1 73 ALA n 1 74 VAL n 1 75 LYS n 1 76 SER n 1 77 MET n 1 78 LYS n 1 79 ASP n 1 80 ILE n 1 81 ASP n 1 82 SER n 1 83 SER n 1 84 ILE n 1 85 LEU n 1 86 GLU n 1 87 HIS n 1 88 HIS n 1 89 HIS n 1 90 HIS n 1 91 HIS n 1 92 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Burkholderia _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain E264 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Burkholderia pseudomallei' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 28450 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q63K18_BURPS _struct_ref.pdbx_db_accession Q63K18 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2G0U _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 84 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q63K18 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 84 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 84 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2G0U ALA A 10 ? UNP Q63K18 THR 10 conflict 10 1 1 2G0U ASP A 27 ? UNP Q63K18 THR 27 conflict 27 2 1 2G0U LYS A 34 ? UNP Q63K18 GLN 34 conflict 34 3 1 2G0U LEU A 85 ? UNP Q63K18 ? ? 'expression tag' 85 4 1 2G0U GLU A 86 ? UNP Q63K18 ? ? 'expression tag' 86 5 1 2G0U HIS A 87 ? UNP Q63K18 ? ? 'expression tag' 87 6 1 2G0U HIS A 88 ? UNP Q63K18 ? ? 'expression tag' 88 7 1 2G0U HIS A 89 ? UNP Q63K18 ? ? 'expression tag' 89 8 1 2G0U HIS A 90 ? UNP Q63K18 ? ? 'expression tag' 90 9 1 2G0U HIS A 91 ? UNP Q63K18 ? ? 'expression tag' 91 10 1 2G0U HIS A 92 ? UNP Q63K18 ? ? 'expression tag' 92 11 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 3 1 ? 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 20mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 AVANCE Bruker 800 ? 2 INOVA Varian 600 ? # _pdbx_nmr_refine.entry_id 2G0U _pdbx_nmr_refine.method ;torsion angle dynamics simulated annealing molecular dynamics ; _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2G0U _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations,structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2G0U _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal processing NMRPipe 2005 'Delaglio, F., Grzesiek, S., Vuister, G.W., Zhu, G., Pfeifer, J., and Bax, A.' 1 'data analysis' NMRView 5.0.2 'Johnson, B.A.' 2 refinement CYANA ? 'Guntert, P.' 3 refinement Amber 7 ;Case, D.A., Pearlman, D.A., Caldwell, J.W., Cheatham III, T.E., Wang, J., Ross, W.S., Simmerling, C.L., Darden, T.A., Merz, K.M., Stanton, R.V., Cheng, A.L., Vincent, J.J., Crowley, M., Tsui, V., Gohlke, H., Radmer, R.J., Duan, Y., Pitera, J., Massova, I., Seibel, G.L., Singh, U.C., Weiner, P.K., and Kollman, P.A. ; 4 # _exptl.entry_id 2G0U _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 2G0U _struct.title 'Solution Structure of Monomeric BsaL, the Type III Secretion Needle Protein of Burkholderia pseudomallei' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2G0U _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' _struct_keywords.text 'helix-turn-helix, UNKNOWN FUNCTION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 15 ? ARG A 23 ? SER A 15 ARG A 23 1 ? 9 HELX_P HELX_P2 2 ALA A 24 ? ASP A 26 ? ALA A 24 ASP A 26 5 ? 3 HELX_P HELX_P3 3 VAL A 29 ? ASN A 46 ? VAL A 29 ASN A 46 1 ? 18 HELX_P HELX_P4 4 ASP A 49 ? SER A 76 ? ASP A 49 SER A 76 1 ? 28 HELX_P HELX_P5 5 SER A 76 ? ASP A 81 ? SER A 76 ASP A 81 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 2G0U _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2G0U _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 PRO 4 4 4 PRO PRO A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 TYR 12 12 12 TYR TYR A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 TRP 14 14 14 TRP TRP A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 TYR 17 17 17 TYR TYR A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 ASN 33 33 33 ASN ASN A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 GLN 40 40 40 GLN GLN A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 ASN 46 46 46 ASN ASN A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 TYR 56 56 56 TYR TYR A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 MET 58 58 58 MET MET A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 MET 60 60 60 MET MET A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 TYR 63 63 63 TYR TYR A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 TYR 66 66 66 TYR TYR A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 GLN 70 70 70 GLN GLN A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 MET 77 77 77 MET MET A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 HIS 87 87 87 HIS HIS A . n A 1 88 HIS 88 88 88 HIS HIS A . n A 1 89 HIS 89 89 89 HIS HIS A . n A 1 90 HIS 90 90 90 HIS HIS A . n A 1 91 HIS 91 91 91 HIS HIS A . n A 1 92 HIS 92 92 92 HIS HIS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-05-23 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 3 NE A ARG 23 ? ? CZ A ARG 23 ? ? NH1 A ARG 23 ? ? 123.54 120.30 3.24 0.50 N 2 4 NE A ARG 23 ? ? CZ A ARG 23 ? ? NH1 A ARG 23 ? ? 123.96 120.30 3.66 0.50 N 3 10 NE A ARG 23 ? ? CZ A ARG 23 ? ? NH1 A ARG 23 ? ? 123.74 120.30 3.44 0.50 N 4 11 NE A ARG 23 ? ? CZ A ARG 23 ? ? NH1 A ARG 23 ? ? 123.78 120.30 3.48 0.50 N 5 17 NE A ARG 23 ? ? CZ A ARG 23 ? ? NH1 A ARG 23 ? ? 123.35 120.30 3.05 0.50 N 6 18 NE A ARG 23 ? ? CZ A ARG 23 ? ? NH1 A ARG 23 ? ? 123.48 120.30 3.18 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 8 ? ? -144.85 14.22 2 1 ALA A 10 ? ? -141.43 28.75 3 1 GLU A 13 ? ? -159.65 -40.90 4 1 ASP A 26 ? ? -144.09 18.16 5 1 ASN A 46 ? ? -152.71 86.80 6 1 HIS A 90 ? ? -136.24 -50.10 7 2 TYR A 12 ? ? -61.15 13.44 8 2 THR A 19 ? ? -165.46 -164.42 9 2 ALA A 24 ? ? -141.21 -44.02 10 2 LEU A 85 ? ? -76.72 37.76 11 2 HIS A 88 ? ? -68.44 23.75 12 3 PRO A 5 ? ? -48.59 157.18 13 3 ASP A 26 ? ? -67.98 2.93 14 3 ASN A 46 ? ? -151.23 89.89 15 3 SER A 83 ? ? -140.78 -8.71 16 5 LEU A 9 ? ? -66.52 14.35 17 5 ASP A 26 ? ? -139.73 -43.61 18 5 ASN A 46 ? ? -151.24 86.49 19 6 TRP A 14 ? ? -66.09 28.55 20 6 VAL A 29 ? ? -146.62 -47.33 21 6 ILE A 84 ? ? -145.18 -11.91 22 7 TRP A 14 ? ? -66.09 28.55 23 7 VAL A 29 ? ? -146.62 -47.33 24 7 ILE A 84 ? ? -145.18 -11.91 25 8 ALA A 10 ? ? -154.25 -6.28 26 8 SER A 15 ? ? -57.11 109.92 27 8 THR A 19 ? ? -148.68 29.52 28 8 ILE A 21 ? ? 0.01 71.01 29 9 LEU A 9 ? ? -144.56 -2.39 30 9 ARG A 23 ? ? -145.78 -20.59 31 9 SER A 76 ? ? -140.74 19.55 32 9 SER A 83 ? ? -142.50 -1.94 33 9 HIS A 91 ? ? -147.58 -3.86 34 10 GLU A 13 ? ? -154.00 -41.59 35 10 ASN A 46 ? ? -151.25 89.89 36 11 HIS A 87 ? ? -150.81 -49.39 37 11 HIS A 91 ? ? -150.19 10.74 38 12 PRO A 7 ? ? -52.08 108.37 39 12 TYR A 12 ? ? -55.18 -7.93 40 12 TRP A 14 ? ? -151.34 -24.63 41 12 ILE A 21 ? ? -25.73 118.50 42 13 THR A 6 ? ? 66.76 151.93 43 13 ASP A 11 ? ? -159.08 -44.77 44 13 SER A 83 ? ? -152.12 31.09 45 13 HIS A 89 ? ? -73.64 39.51 46 14 GLU A 13 ? ? -142.51 -4.36 47 14 ASN A 46 ? ? -151.77 87.77 48 14 ILE A 84 ? ? -77.72 42.22 49 15 PRO A 7 ? ? -58.74 -4.29 50 15 ALA A 10 ? ? -144.45 22.92 51 15 GLU A 13 ? ? -77.07 47.49 52 15 HIS A 90 ? ? -57.30 -8.03 53 16 SER A 2 ? ? -157.70 -42.25 54 16 TYR A 12 ? ? -139.51 -31.86 55 18 TRP A 14 ? ? -140.24 16.87 56 18 SER A 15 ? ? -68.41 47.91 57 18 ASP A 26 ? ? -131.59 -64.59 58 18 SER A 82 ? ? -59.82 -8.05 59 18 HIS A 87 ? ? -71.29 30.72 60 19 PRO A 5 ? ? -58.63 172.76 61 19 THR A 19 ? ? -0.03 -53.17 62 19 ASP A 26 ? ? -143.84 -9.73 63 20 TYR A 12 ? ? -142.02 28.46 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 TYR A 56 ? ? 0.100 'SIDE CHAIN' 2 2 TYR A 56 ? ? 0.088 'SIDE CHAIN' 3 3 TYR A 56 ? ? 0.101 'SIDE CHAIN' 4 4 TYR A 56 ? ? 0.084 'SIDE CHAIN' 5 4 TYR A 63 ? ? 0.063 'SIDE CHAIN' 6 5 TYR A 56 ? ? 0.087 'SIDE CHAIN' 7 6 TYR A 56 ? ? 0.099 'SIDE CHAIN' 8 7 TYR A 56 ? ? 0.099 'SIDE CHAIN' 9 8 TYR A 56 ? ? 0.072 'SIDE CHAIN' 10 9 TYR A 56 ? ? 0.079 'SIDE CHAIN' 11 10 TYR A 56 ? ? 0.076 'SIDE CHAIN' 12 11 TYR A 56 ? ? 0.089 'SIDE CHAIN' 13 12 TYR A 56 ? ? 0.078 'SIDE CHAIN' 14 13 TYR A 56 ? ? 0.070 'SIDE CHAIN' 15 14 TYR A 56 ? ? 0.080 'SIDE CHAIN' 16 15 TYR A 56 ? ? 0.078 'SIDE CHAIN' 17 16 TYR A 56 ? ? 0.097 'SIDE CHAIN' 18 17 TYR A 56 ? ? 0.080 'SIDE CHAIN' 19 18 TYR A 56 ? ? 0.082 'SIDE CHAIN' 20 19 TYR A 56 ? ? 0.093 'SIDE CHAIN' 21 20 TYR A 56 ? ? 0.099 'SIDE CHAIN' #