data_2GG0 # _entry.id 2GG0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.377 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2GG0 pdb_00002gg0 10.2210/pdb2gg0/pdb RCSB RCSB037070 ? ? WWPDB D_1000037070 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 2GG2 'Novel bacterial methionine aminopeptidase inhibitors' unspecified PDB 2GG3 'Novel bacterial methionine aminopeptidase inhibitors' unspecified PDB 2GG5 'Novel bacterial methionine aminopeptidase inhibitors' unspecified PDB 2GG7 'Novel bacterial methionine aminopeptidase inhibitors' unspecified PDB 2GG8 'Novel bacterial methionine aminopeptidase inhibitors' unspecified PDB 2GG9 'Novel bacterial methionine aminopeptidase inhibitors' unspecified PDB 2GGB 'Novel bacterial methionine aminopeptidase inhibitors' unspecified PDB 2GGC 'Novel bacterial methionine aminopeptidase inhibitors' unspecified # _pdbx_database_status.entry_id 2GG0 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2006-03-23 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Evdokimov, A.G.' 1 'Pokross, M.E.' 2 'Walter, R.L.' 3 'Mekel, M.' 4 # _citation.id primary _citation.title 'Serendipitous discovery of novel bacterial methionine aminopeptidase inhibitors.' _citation.journal_abbrev Proteins _citation.journal_volume 66 _citation.page_first 538 _citation.page_last 546 _citation.year 2007 _citation.journal_id_ASTM PSFGEY _citation.country US _citation.journal_id_ISSN 0887-3585 _citation.journal_id_CSD 0867 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17120228 _citation.pdbx_database_id_DOI 10.1002/prot.21207 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Evdokimov, A.G.' 1 ? primary 'Pokross, M.' 2 ? primary 'Walter, R.L.' 3 ? primary 'Mekel, M.' 4 ? primary 'Barnett, B.L.' 5 ? primary 'Amburgey, J.' 6 ? primary 'Seibel, W.L.' 7 ? primary 'Soper, S.J.' 8 ? primary 'Djung, J.F.' 9 ? primary 'Fairweather, N.' 10 ? primary 'Diven, C.' 11 ? primary 'Rastogi, V.' 12 ? primary 'Grinius, L.' 13 ? primary 'Klanke, C.' 14 ? primary 'Siehnel, R.' 15 ? primary 'Twinem, T.' 16 ? primary 'Andrews, R.' 17 ? primary 'Curnow, A.' 18 ? # _cell.entry_id 2GG0 _cell.length_a 39.481 _cell.length_b 63.055 _cell.length_c 52.641 _cell.angle_alpha 90.00 _cell.angle_beta 109.88 _cell.angle_gamma 90.00 _cell.Z_PDB 2 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2GG0 _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Methionine aminopeptidase' 29239.643 1 3.4.11.18 ? ? ? 2 non-polymer syn 'COBALT (II) ION' 58.933 2 ? ? ? ? 3 non-polymer syn 'SODIUM ION' 22.990 1 ? ? ? ? 4 non-polymer syn 'METHYL N-{(2S,3R)-3-AMINO-2-HYDROXY-3-[4-(TRIFLUOROMETHYL)PHENYL]PROPANOYL}ALANYLGLYCINATE' 391.342 1 ? ? ? ? 5 water nat water 18.015 393 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'MAP, Peptidase M' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGI PDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEG FSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVT DNGCEILTLRKDDTIPAIISHDE ; _entity_poly.pdbx_seq_one_letter_code_can ;AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGI PDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEG FSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVT DNGCEILTLRKDDTIPAIISHDE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 ILE n 1 3 SER n 1 4 ILE n 1 5 LYS n 1 6 THR n 1 7 PRO n 1 8 GLU n 1 9 ASP n 1 10 ILE n 1 11 GLU n 1 12 LYS n 1 13 MET n 1 14 ARG n 1 15 VAL n 1 16 ALA n 1 17 GLY n 1 18 ARG n 1 19 LEU n 1 20 ALA n 1 21 ALA n 1 22 GLU n 1 23 VAL n 1 24 LEU n 1 25 GLU n 1 26 MET n 1 27 ILE n 1 28 GLU n 1 29 PRO n 1 30 TYR n 1 31 VAL n 1 32 LYS n 1 33 PRO n 1 34 GLY n 1 35 VAL n 1 36 SER n 1 37 THR n 1 38 GLY n 1 39 GLU n 1 40 LEU n 1 41 ASP n 1 42 ARG n 1 43 ILE n 1 44 CYS n 1 45 ASN n 1 46 ASP n 1 47 TYR n 1 48 ILE n 1 49 VAL n 1 50 ASN n 1 51 GLU n 1 52 GLN n 1 53 HIS n 1 54 ALA n 1 55 VAL n 1 56 SER n 1 57 ALA n 1 58 CYS n 1 59 LEU n 1 60 GLY n 1 61 TYR n 1 62 HIS n 1 63 GLY n 1 64 TYR n 1 65 PRO n 1 66 LYS n 1 67 SER n 1 68 VAL n 1 69 CYS n 1 70 ILE n 1 71 SER n 1 72 ILE n 1 73 ASN n 1 74 GLU n 1 75 VAL n 1 76 VAL n 1 77 CYS n 1 78 HIS n 1 79 GLY n 1 80 ILE n 1 81 PRO n 1 82 ASP n 1 83 ASP n 1 84 ALA n 1 85 LYS n 1 86 LEU n 1 87 LEU n 1 88 LYS n 1 89 ASP n 1 90 GLY n 1 91 ASP n 1 92 ILE n 1 93 VAL n 1 94 ASN n 1 95 ILE n 1 96 ASP n 1 97 VAL n 1 98 THR n 1 99 VAL n 1 100 ILE n 1 101 LYS n 1 102 ASP n 1 103 GLY n 1 104 PHE n 1 105 HIS n 1 106 GLY n 1 107 ASP n 1 108 THR n 1 109 SER n 1 110 LYS n 1 111 MET n 1 112 PHE n 1 113 ILE n 1 114 VAL n 1 115 GLY n 1 116 LYS n 1 117 PRO n 1 118 THR n 1 119 ILE n 1 120 MET n 1 121 GLY n 1 122 GLU n 1 123 ARG n 1 124 LEU n 1 125 CYS n 1 126 ARG n 1 127 ILE n 1 128 THR n 1 129 GLN n 1 130 GLU n 1 131 SER n 1 132 LEU n 1 133 TYR n 1 134 LEU n 1 135 ALA n 1 136 LEU n 1 137 ARG n 1 138 MET n 1 139 VAL n 1 140 LYS n 1 141 PRO n 1 142 GLY n 1 143 ILE n 1 144 ASN n 1 145 LEU n 1 146 ARG n 1 147 GLU n 1 148 ILE n 1 149 GLY n 1 150 ALA n 1 151 ALA n 1 152 ILE n 1 153 GLN n 1 154 LYS n 1 155 PHE n 1 156 VAL n 1 157 GLU n 1 158 ALA n 1 159 GLU n 1 160 GLY n 1 161 PHE n 1 162 SER n 1 163 VAL n 1 164 VAL n 1 165 ARG n 1 166 GLU n 1 167 TYR n 1 168 CYS n 1 169 GLY n 1 170 HIS n 1 171 GLY n 1 172 ILE n 1 173 GLY n 1 174 ARG n 1 175 GLY n 1 176 PHE n 1 177 HIS n 1 178 GLU n 1 179 GLU n 1 180 PRO n 1 181 GLN n 1 182 VAL n 1 183 LEU n 1 184 HIS n 1 185 TYR n 1 186 ASP n 1 187 SER n 1 188 ARG n 1 189 GLU n 1 190 THR n 1 191 ASN n 1 192 VAL n 1 193 VAL n 1 194 LEU n 1 195 LYS n 1 196 PRO n 1 197 GLY n 1 198 MET n 1 199 THR n 1 200 PHE n 1 201 THR n 1 202 ILE n 1 203 GLU n 1 204 PRO n 1 205 MET n 1 206 VAL n 1 207 ASN n 1 208 ALA n 1 209 GLY n 1 210 LYS n 1 211 LYS n 1 212 GLU n 1 213 ILE n 1 214 ARG n 1 215 THR n 1 216 MET n 1 217 LYS n 1 218 ASP n 1 219 GLY n 1 220 TRP n 1 221 THR n 1 222 VAL n 1 223 LYS n 1 224 THR n 1 225 LYS n 1 226 ASP n 1 227 ARG n 1 228 SER n 1 229 LEU n 1 230 SER n 1 231 ALA n 1 232 GLN n 1 233 TYR n 1 234 GLU n 1 235 HIS n 1 236 THR n 1 237 ILE n 1 238 VAL n 1 239 VAL n 1 240 THR n 1 241 ASP n 1 242 ASN n 1 243 GLY n 1 244 CYS n 1 245 GLU n 1 246 ILE n 1 247 LEU n 1 248 THR n 1 249 LEU n 1 250 ARG n 1 251 LYS n 1 252 ASP n 1 253 ASP n 1 254 THR n 1 255 ILE n 1 256 PRO n 1 257 ALA n 1 258 ILE n 1 259 ILE n 1 260 SER n 1 261 HIS n 1 262 ASP n 1 263 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Escherichia _entity_src_gen.pdbx_gene_src_gene map _entity_src_gen.gene_src_species 'Escherichia coli' _entity_src_gen.gene_src_strain K-12 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli K12' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83333 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code AMPM_ECOLI _struct_ref.pdbx_db_accession P0AE18 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGI PDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEG FSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVT DNGCEILTLRKDDTIPAIISHDE ; _struct_ref.pdbx_align_begin 2 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2GG0 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 263 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0AE18 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 264 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 264 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CO non-polymer . 'COBALT (II) ION' ? 'Co 2' 58.933 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 U11 non-polymer . 'METHYL N-{(2S,3R)-3-AMINO-2-HYDROXY-3-[4-(TRIFLUOROMETHYL)PHENYL]PROPANOYL}ALANYLGLYCINATE' '{2-[3-AMINO-2-HYDROXY-3-(4-TRIFLUOROMETHYL-PHENYL)-PROPIONYLAMINO]-PROPIONYLAMINO}-ACETIC ACID METHYL ESTER' 'C16 H20 F3 N3 O5' 391.342 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.entry_id 2GG0 _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.11 _exptl_crystal.density_percent_sol 41.61 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method batch _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.temp 298 _exptl_crystal_grow.pdbx_details '10 mg/ml protein, 25% PEG 8000, 100 mM TRIS-HCl, 1-5 mM inhibitor, pH 7.0, batch, temperature 298K' _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 4' _diffrn_detector.pdbx_collection_date 2002-01-01 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator Si _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 17-ID' _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 17-ID # _reflns.entry_id 2GG0 _reflns.observed_criterion_sigma_F 0 _reflns.observed_criterion_sigma_I 0 _reflns.d_resolution_high 1.28 _reflns.d_resolution_low 24.75 _reflns.number_all 57560 _reflns.number_obs 57560 _reflns.percent_possible_obs 93 _reflns.pdbx_Rmerge_I_obs 0.033 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 17.2 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 2.0 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 1.28 _reflns_shell.d_res_low 1.40 _reflns_shell.percent_possible_obs ? _reflns_shell.percent_possible_all 79.3 _reflns_shell.Rmerge_I_obs 0.176 _reflns_shell.meanI_over_sigI_obs 6.3 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_redundancy 1.1 _reflns_shell.number_unique_all 11301 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 2GG0 _refine.ls_d_res_high 1.280 _refine.ls_d_res_low 24.75 _refine.pdbx_ls_sigma_F 0.00 _refine.ls_percent_reflns_obs 92.780 _refine.ls_number_reflns_obs 57560 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.ls_R_factor_all 0.166 _refine.ls_R_factor_R_work 0.163 _refine.ls_R_factor_R_free 0.209 _refine.ls_percent_reflns_R_free 5.100 _refine.ls_number_reflns_R_free 2909 _refine.B_iso_mean 17.439 _refine.aniso_B[1][1] -0.300 _refine.aniso_B[2][2] 0.280 _refine.aniso_B[3][3] -0.030 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] -0.060 _refine.aniso_B[2][3] 0.000 _refine.correlation_coeff_Fo_to_Fc 0.965 _refine.correlation_coeff_Fo_to_Fc_free 0.941 _refine.pdbx_overall_ESU_R 0.062 _refine.pdbx_overall_ESU_R_Free 0.060 _refine.overall_SU_ML 0.037 _refine.overall_SU_B 1.812 _refine.solvent_model_details MASK _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_ls_sigma_I ? _refine.ls_number_reflns_all 57560 _refine.ls_R_factor_obs 0.163 _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'PDB ENTRY 1C27' _refine.pdbx_stereochem_target_val_spec_case ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_isotropic_thermal_model ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2126 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 30 _refine_hist.number_atoms_solvent 393 _refine_hist.number_atoms_total 2549 _refine_hist.d_res_high 1.280 _refine_hist.d_res_low 24.75 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 2204 0.009 0.022 ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 3002 1.499 1.985 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 290 6.527 5.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 96 35.038 24.271 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 409 11.933 15.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 15 20.811 15.000 ? 'X-RAY DIFFRACTION' ? r_chiral_restr 344 0.101 0.200 ? 'X-RAY DIFFRACTION' ? r_gen_planes_refined 1659 0.005 0.020 ? 'X-RAY DIFFRACTION' ? r_nbd_refined 1163 0.218 0.200 ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 1549 0.315 0.200 ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 302 0.182 0.200 ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined 4 0.170 0.200 ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 44 0.377 0.200 ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 56 0.391 0.200 ? 'X-RAY DIFFRACTION' ? r_mcbond_it 1350 2.290 1.500 ? 'X-RAY DIFFRACTION' ? r_mcangle_it 2217 3.154 2.000 ? 'X-RAY DIFFRACTION' ? r_scbond_it 869 4.904 3.000 ? 'X-RAY DIFFRACTION' ? r_scangle_it 772 6.584 4.500 ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.d_res_high 1.283 _refine_ls_shell.d_res_low 1.316 _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.percent_reflns_obs 69.430 _refine_ls_shell.number_reflns_R_work 2992 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_R_work 0.174 _refine_ls_shell.R_factor_R_free 0.234 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 160 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs 3152 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 2GG0 _struct.title 'Novel bacterial methionine aminopeptidase inhibitors' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2GG0 _struct_keywords.text 'methionine amino peptidase, pita-bread fold, MAP inhibitor, antibacterial, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? F N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 6 ? GLU A 28 ? THR A 7 GLU A 29 1 ? 23 HELX_P HELX_P2 2 PRO A 29 ? VAL A 31 ? PRO A 30 VAL A 32 5 ? 3 HELX_P HELX_P3 3 SER A 36 ? GLU A 51 ? SER A 37 GLU A 52 1 ? 16 HELX_P HELX_P4 4 GLY A 60 ? TYR A 64 ? GLY A 61 TYR A 65 5 ? 5 HELX_P HELX_P5 5 THR A 118 ? VAL A 139 ? THR A 119 VAL A 140 1 ? 22 HELX_P HELX_P6 6 ASN A 144 ? GLU A 159 ? ASN A 145 GLU A 160 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASN 73 O ? ? ? 1_555 D NA . NA ? ? A ASN 74 A NA 603 1_555 ? ? ? ? ? ? ? 2.257 ? ? metalc2 metalc ? ? A VAL 75 O ? ? ? 1_555 D NA . NA ? ? A VAL 76 A NA 603 1_555 ? ? ? ? ? ? ? 2.274 ? ? metalc3 metalc ? ? A ASP 96 OD1 ? ? ? 1_555 C CO . CO ? ? A ASP 97 A CO 302 1_555 ? ? ? ? ? ? ? 2.080 ? ? metalc4 metalc ? ? A ASP 96 OD2 ? ? ? 1_555 C CO . CO ? ? A ASP 97 A CO 302 1_555 ? ? ? ? ? ? ? 2.401 ? ? metalc5 metalc ? ? A ASP 107 OD1 ? ? ? 1_555 B CO . CO ? ? A ASP 108 A CO 301 1_555 ? ? ? ? ? ? ? 2.118 ? ? metalc6 metalc ? ? A ASP 107 OD2 ? ? ? 1_555 C CO . CO ? ? A ASP 108 A CO 302 1_555 ? ? ? ? ? ? ? 1.958 ? ? metalc7 metalc ? ? A HIS 170 NE2 ? ? ? 1_555 B CO . CO ? ? A HIS 171 A CO 301 1_555 ? ? ? ? ? ? ? 2.090 ? ? metalc8 metalc ? ? A GLU 203 OE2 ? ? ? 1_555 B CO . CO ? ? A GLU 204 A CO 301 1_555 ? ? ? ? ? ? ? 2.211 ? ? metalc9 metalc ? ? A SER 230 O ? ? ? 1_555 D NA . NA ? ? A SER 231 A NA 603 1_555 ? ? ? ? ? ? ? 2.303 ? ? metalc10 metalc ? ? A GLU 234 OE1 ? ? ? 1_555 B CO . CO ? ? A GLU 235 A CO 301 1_555 ? ? ? ? ? ? ? 2.153 ? ? metalc11 metalc ? ? A GLU 234 OE2 ? ? ? 1_555 C CO . CO ? ? A GLU 235 A CO 302 1_555 ? ? ? ? ? ? ? 2.113 ? ? metalc12 metalc ? ? B CO . CO ? ? ? 1_555 E U11 . O27 ? ? A CO 301 A U11 601 1_555 ? ? ? ? ? ? ? 2.050 ? ? metalc13 metalc ? ? B CO . CO ? ? ? 1_555 E U11 . O31 ? ? A CO 301 A U11 601 1_555 ? ? ? ? ? ? ? 2.326 ? ? metalc14 metalc ? ? C CO . CO ? ? ? 1_555 E U11 . N24 ? ? A CO 302 A U11 601 1_555 ? ? ? ? ? ? ? 2.181 ? ? metalc15 metalc ? ? C CO . CO ? ? ? 1_555 E U11 . O27 ? ? A CO 302 A U11 601 1_555 ? ? ? ? ? ? ? 2.030 ? ? metalc16 metalc ? ? D NA . NA ? ? ? 1_555 F HOH . O ? ? A NA 603 A HOH 680 1_555 ? ? ? ? ? ? ? 2.161 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLU _struct_mon_prot_cis.label_seq_id 179 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLU _struct_mon_prot_cis.auth_seq_id 180 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 180 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 181 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -3.02 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 3 ? C ? 3 ? D ? 3 ? E ? 2 ? F ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel D 1 2 ? anti-parallel D 2 3 ? anti-parallel E 1 2 ? anti-parallel F 1 2 ? anti-parallel F 2 3 ? anti-parallel F 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 55 ? SER A 56 ? VAL A 56 SER A 57 A 2 ILE A 92 ? LYS A 101 ? ILE A 93 LYS A 102 A 3 CYS A 69 ? ILE A 72 ? CYS A 70 ILE A 73 B 1 VAL A 55 ? SER A 56 ? VAL A 56 SER A 57 B 2 ILE A 92 ? LYS A 101 ? ILE A 93 LYS A 102 B 3 PHE A 104 ? ILE A 113 ? PHE A 105 ILE A 114 C 1 VAL A 75 ? CYS A 77 ? VAL A 76 CYS A 78 C 2 VAL A 222 ? THR A 224 ? VAL A 223 THR A 225 C 3 ILE A 213 ? THR A 215 ? ILE A 214 THR A 216 D 1 SER A 162 ? VAL A 163 ? SER A 163 VAL A 164 D 2 MET A 205 ? ASN A 207 ? MET A 206 ASN A 208 D 3 SER A 230 ? GLN A 232 ? SER A 231 GLN A 233 E 1 GLY A 169 ? GLY A 171 ? GLY A 170 GLY A 172 E 2 GLU A 178 ? VAL A 182 ? GLU A 179 VAL A 183 F 1 THR A 199 ? ILE A 202 ? THR A 200 ILE A 203 F 2 HIS A 235 ? VAL A 239 ? HIS A 236 VAL A 240 F 3 GLY A 243 ? ILE A 246 ? GLY A 244 ILE A 247 F 4 ILE A 258 ? SER A 260 ? ILE A 259 SER A 261 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 55 ? N VAL A 56 O ILE A 100 ? O ILE A 101 A 2 3 O ASN A 94 ? O ASN A 95 N SER A 71 ? N SER A 72 B 1 2 N VAL A 55 ? N VAL A 56 O ILE A 100 ? O ILE A 101 B 2 3 N VAL A 97 ? N VAL A 98 O THR A 108 ? O THR A 109 C 1 2 N VAL A 76 ? N VAL A 77 O VAL A 222 ? O VAL A 223 C 2 3 O LYS A 223 ? O LYS A 224 N ARG A 214 ? N ARG A 215 D 1 2 N SER A 162 ? N SER A 163 O ASN A 207 ? O ASN A 208 D 2 3 N VAL A 206 ? N VAL A 207 O ALA A 231 ? O ALA A 232 E 1 2 N GLY A 169 ? N GLY A 170 O VAL A 182 ? O VAL A 183 F 1 2 N PHE A 200 ? N PHE A 201 O ILE A 237 ? O ILE A 238 F 2 3 N VAL A 238 ? N VAL A 239 O GLU A 245 ? O GLU A 246 F 3 4 N CYS A 244 ? N CYS A 245 O ILE A 259 ? O ILE A 260 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CO 301 ? 6 'BINDING SITE FOR RESIDUE CO A 301' AC2 Software A CO 302 ? 5 'BINDING SITE FOR RESIDUE CO A 302' AC3 Software A NA 603 ? 4 'BINDING SITE FOR RESIDUE NA A 603' AC4 Software A U11 601 ? 16 'BINDING SITE FOR RESIDUE U11 A 601' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 ASP A 107 ? ASP A 108 . ? 1_555 ? 2 AC1 6 HIS A 170 ? HIS A 171 . ? 1_555 ? 3 AC1 6 GLU A 203 ? GLU A 204 . ? 1_555 ? 4 AC1 6 GLU A 234 ? GLU A 235 . ? 1_555 ? 5 AC1 6 CO C . ? CO A 302 . ? 1_555 ? 6 AC1 6 U11 E . ? U11 A 601 . ? 1_555 ? 7 AC2 5 ASP A 96 ? ASP A 97 . ? 1_555 ? 8 AC2 5 ASP A 107 ? ASP A 108 . ? 1_555 ? 9 AC2 5 GLU A 234 ? GLU A 235 . ? 1_555 ? 10 AC2 5 CO B . ? CO A 301 . ? 1_555 ? 11 AC2 5 U11 E . ? U11 A 601 . ? 1_555 ? 12 AC3 4 ASN A 73 ? ASN A 74 . ? 1_555 ? 13 AC3 4 VAL A 75 ? VAL A 76 . ? 1_555 ? 14 AC3 4 SER A 230 ? SER A 231 . ? 1_555 ? 15 AC3 4 HOH F . ? HOH A 680 . ? 1_555 ? 16 AC4 16 TYR A 61 ? TYR A 62 . ? 1_555 ? 17 AC4 16 CYS A 69 ? CYS A 70 . ? 1_555 ? 18 AC4 16 HIS A 78 ? HIS A 79 . ? 1_555 ? 19 AC4 16 ASP A 96 ? ASP A 97 . ? 1_555 ? 20 AC4 16 THR A 98 ? THR A 99 . ? 1_555 ? 21 AC4 16 ASP A 107 ? ASP A 108 . ? 1_555 ? 22 AC4 16 TYR A 167 ? TYR A 168 . ? 1_555 ? 23 AC4 16 CYS A 168 ? CYS A 169 . ? 1_555 ? 24 AC4 16 HIS A 170 ? HIS A 171 . ? 1_555 ? 25 AC4 16 PHE A 176 ? PHE A 177 . ? 1_555 ? 26 AC4 16 HIS A 177 ? HIS A 178 . ? 1_555 ? 27 AC4 16 GLU A 203 ? GLU A 204 . ? 1_555 ? 28 AC4 16 GLU A 234 ? GLU A 235 . ? 1_555 ? 29 AC4 16 CO B . ? CO A 301 . ? 1_555 ? 30 AC4 16 CO C . ? CO A 302 . ? 1_555 ? 31 AC4 16 HOH F . ? HOH A 800 . ? 1_555 ? # _atom_sites.entry_id 2GG0 _atom_sites.fract_transf_matrix[1][1] 0.025329 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.009159 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015859 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.020200 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CO F N NA O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 2 ? ? ? A . n A 1 2 ILE 2 3 3 ILE ILE A . n A 1 3 SER 3 4 4 SER SER A . n A 1 4 ILE 4 5 5 ILE ILE A . n A 1 5 LYS 5 6 6 LYS LYS A . n A 1 6 THR 6 7 7 THR THR A . n A 1 7 PRO 7 8 8 PRO PRO A . n A 1 8 GLU 8 9 9 GLU GLU A . n A 1 9 ASP 9 10 10 ASP ASP A . n A 1 10 ILE 10 11 11 ILE ILE A . n A 1 11 GLU 11 12 12 GLU GLU A . n A 1 12 LYS 12 13 13 LYS LYS A . n A 1 13 MET 13 14 14 MET MET A . n A 1 14 ARG 14 15 15 ARG ARG A . n A 1 15 VAL 15 16 16 VAL VAL A . n A 1 16 ALA 16 17 17 ALA ALA A . n A 1 17 GLY 17 18 18 GLY GLY A . n A 1 18 ARG 18 19 19 ARG ARG A . n A 1 19 LEU 19 20 20 LEU LEU A . n A 1 20 ALA 20 21 21 ALA ALA A . n A 1 21 ALA 21 22 22 ALA ALA A . n A 1 22 GLU 22 23 23 GLU GLU A . n A 1 23 VAL 23 24 24 VAL VAL A . n A 1 24 LEU 24 25 25 LEU LEU A . n A 1 25 GLU 25 26 26 GLU GLU A . n A 1 26 MET 26 27 27 MET MET A . n A 1 27 ILE 27 28 28 ILE ILE A . n A 1 28 GLU 28 29 29 GLU GLU A . n A 1 29 PRO 29 30 30 PRO PRO A . n A 1 30 TYR 30 31 31 TYR TYR A . n A 1 31 VAL 31 32 32 VAL VAL A . n A 1 32 LYS 32 33 33 LYS LYS A . n A 1 33 PRO 33 34 34 PRO PRO A . n A 1 34 GLY 34 35 35 GLY GLY A . n A 1 35 VAL 35 36 36 VAL VAL A . n A 1 36 SER 36 37 37 SER SER A . n A 1 37 THR 37 38 38 THR THR A . n A 1 38 GLY 38 39 39 GLY GLY A . n A 1 39 GLU 39 40 40 GLU GLU A . n A 1 40 LEU 40 41 41 LEU LEU A . n A 1 41 ASP 41 42 42 ASP ASP A . n A 1 42 ARG 42 43 43 ARG ARG A . n A 1 43 ILE 43 44 44 ILE ILE A . n A 1 44 CYS 44 45 45 CYS CYS A . n A 1 45 ASN 45 46 46 ASN ASN A . n A 1 46 ASP 46 47 47 ASP ASP A . n A 1 47 TYR 47 48 48 TYR TYR A . n A 1 48 ILE 48 49 49 ILE ILE A . n A 1 49 VAL 49 50 50 VAL VAL A . n A 1 50 ASN 50 51 51 ASN ASN A . n A 1 51 GLU 51 52 52 GLU GLU A . n A 1 52 GLN 52 53 53 GLN GLN A . n A 1 53 HIS 53 54 54 HIS HIS A . n A 1 54 ALA 54 55 55 ALA ALA A . n A 1 55 VAL 55 56 56 VAL VAL A . n A 1 56 SER 56 57 57 SER SER A . n A 1 57 ALA 57 58 58 ALA ALA A . n A 1 58 CYS 58 59 59 CYS CYS A . n A 1 59 LEU 59 60 60 LEU LEU A . n A 1 60 GLY 60 61 61 GLY GLY A . n A 1 61 TYR 61 62 62 TYR TYR A . n A 1 62 HIS 62 63 63 HIS HIS A . n A 1 63 GLY 63 64 64 GLY GLY A . n A 1 64 TYR 64 65 65 TYR TYR A . n A 1 65 PRO 65 66 66 PRO PRO A . n A 1 66 LYS 66 67 67 LYS LYS A . n A 1 67 SER 67 68 68 SER SER A . n A 1 68 VAL 68 69 69 VAL VAL A . n A 1 69 CYS 69 70 70 CYS CYS A . n A 1 70 ILE 70 71 71 ILE ILE A . n A 1 71 SER 71 72 72 SER SER A . n A 1 72 ILE 72 73 73 ILE ILE A . n A 1 73 ASN 73 74 74 ASN ASN A . n A 1 74 GLU 74 75 75 GLU GLU A . n A 1 75 VAL 75 76 76 VAL VAL A . n A 1 76 VAL 76 77 77 VAL VAL A . n A 1 77 CYS 77 78 78 CYS CYS A . n A 1 78 HIS 78 79 79 HIS HIS A . n A 1 79 GLY 79 80 80 GLY GLY A . n A 1 80 ILE 80 81 81 ILE ILE A . n A 1 81 PRO 81 82 82 PRO PRO A . n A 1 82 ASP 82 83 83 ASP ASP A . n A 1 83 ASP 83 84 84 ASP ASP A . n A 1 84 ALA 84 85 85 ALA ALA A . n A 1 85 LYS 85 86 86 LYS LYS A . n A 1 86 LEU 86 87 87 LEU LEU A . n A 1 87 LEU 87 88 88 LEU LEU A . n A 1 88 LYS 88 89 89 LYS LYS A . n A 1 89 ASP 89 90 90 ASP ASP A . n A 1 90 GLY 90 91 91 GLY GLY A . n A 1 91 ASP 91 92 92 ASP ASP A . n A 1 92 ILE 92 93 93 ILE ILE A . n A 1 93 VAL 93 94 94 VAL VAL A . n A 1 94 ASN 94 95 95 ASN ASN A . n A 1 95 ILE 95 96 96 ILE ILE A . n A 1 96 ASP 96 97 97 ASP ASP A . n A 1 97 VAL 97 98 98 VAL VAL A . n A 1 98 THR 98 99 99 THR THR A . n A 1 99 VAL 99 100 100 VAL VAL A . n A 1 100 ILE 100 101 101 ILE ILE A . n A 1 101 LYS 101 102 102 LYS LYS A . n A 1 102 ASP 102 103 103 ASP ASP A . n A 1 103 GLY 103 104 104 GLY GLY A . n A 1 104 PHE 104 105 105 PHE PHE A . n A 1 105 HIS 105 106 106 HIS HIS A . n A 1 106 GLY 106 107 107 GLY GLY A . n A 1 107 ASP 107 108 108 ASP ASP A . n A 1 108 THR 108 109 109 THR THR A . n A 1 109 SER 109 110 110 SER SER A . n A 1 110 LYS 110 111 111 LYS LYS A . n A 1 111 MET 111 112 112 MET MET A . n A 1 112 PHE 112 113 113 PHE PHE A . n A 1 113 ILE 113 114 114 ILE ILE A . n A 1 114 VAL 114 115 115 VAL VAL A . n A 1 115 GLY 115 116 116 GLY GLY A . n A 1 116 LYS 116 117 117 LYS LYS A . n A 1 117 PRO 117 118 118 PRO PRO A . n A 1 118 THR 118 119 119 THR THR A . n A 1 119 ILE 119 120 120 ILE ILE A . n A 1 120 MET 120 121 121 MET MET A . n A 1 121 GLY 121 122 122 GLY GLY A . n A 1 122 GLU 122 123 123 GLU GLU A . n A 1 123 ARG 123 124 124 ARG ARG A . n A 1 124 LEU 124 125 125 LEU LEU A . n A 1 125 CYS 125 126 126 CYS CYS A . n A 1 126 ARG 126 127 127 ARG ARG A . n A 1 127 ILE 127 128 128 ILE ILE A . n A 1 128 THR 128 129 129 THR THR A . n A 1 129 GLN 129 130 130 GLN GLN A . n A 1 130 GLU 130 131 131 GLU GLU A . n A 1 131 SER 131 132 132 SER SER A . n A 1 132 LEU 132 133 133 LEU LEU A . n A 1 133 TYR 133 134 134 TYR TYR A . n A 1 134 LEU 134 135 135 LEU LEU A . n A 1 135 ALA 135 136 136 ALA ALA A . n A 1 136 LEU 136 137 137 LEU LEU A . n A 1 137 ARG 137 138 138 ARG ARG A . n A 1 138 MET 138 139 139 MET MET A . n A 1 139 VAL 139 140 140 VAL VAL A . n A 1 140 LYS 140 141 141 LYS LYS A . n A 1 141 PRO 141 142 142 PRO PRO A . n A 1 142 GLY 142 143 143 GLY GLY A . n A 1 143 ILE 143 144 144 ILE ILE A . n A 1 144 ASN 144 145 145 ASN ASN A . n A 1 145 LEU 145 146 146 LEU LEU A . n A 1 146 ARG 146 147 147 ARG ARG A . n A 1 147 GLU 147 148 148 GLU GLU A . n A 1 148 ILE 148 149 149 ILE ILE A . n A 1 149 GLY 149 150 150 GLY GLY A . n A 1 150 ALA 150 151 151 ALA ALA A . n A 1 151 ALA 151 152 152 ALA ALA A . n A 1 152 ILE 152 153 153 ILE ILE A . n A 1 153 GLN 153 154 154 GLN GLN A . n A 1 154 LYS 154 155 155 LYS LYS A . n A 1 155 PHE 155 156 156 PHE PHE A . n A 1 156 VAL 156 157 157 VAL VAL A . n A 1 157 GLU 157 158 158 GLU GLU A . n A 1 158 ALA 158 159 159 ALA ALA A . n A 1 159 GLU 159 160 160 GLU GLU A . n A 1 160 GLY 160 161 161 GLY GLY A . n A 1 161 PHE 161 162 162 PHE PHE A . n A 1 162 SER 162 163 163 SER SER A . n A 1 163 VAL 163 164 164 VAL VAL A . n A 1 164 VAL 164 165 165 VAL VAL A . n A 1 165 ARG 165 166 166 ARG ARG A . n A 1 166 GLU 166 167 167 GLU GLU A . n A 1 167 TYR 167 168 168 TYR TYR A . n A 1 168 CYS 168 169 169 CYS CYS A . n A 1 169 GLY 169 170 170 GLY GLY A . n A 1 170 HIS 170 171 171 HIS HIS A . n A 1 171 GLY 171 172 172 GLY GLY A . n A 1 172 ILE 172 173 173 ILE ILE A . n A 1 173 GLY 173 174 174 GLY GLY A . n A 1 174 ARG 174 175 175 ARG ARG A . n A 1 175 GLY 175 176 176 GLY GLY A . n A 1 176 PHE 176 177 177 PHE PHE A . n A 1 177 HIS 177 178 178 HIS HIS A . n A 1 178 GLU 178 179 179 GLU GLU A . n A 1 179 GLU 179 180 180 GLU GLU A . n A 1 180 PRO 180 181 181 PRO PRO A . n A 1 181 GLN 181 182 182 GLN GLN A . n A 1 182 VAL 182 183 183 VAL VAL A . n A 1 183 LEU 183 184 184 LEU LEU A . n A 1 184 HIS 184 185 185 HIS HIS A . n A 1 185 TYR 185 186 186 TYR TYR A . n A 1 186 ASP 186 187 187 ASP ASP A . n A 1 187 SER 187 188 188 SER SER A . n A 1 188 ARG 188 189 189 ARG ARG A . n A 1 189 GLU 189 190 190 GLU GLU A . n A 1 190 THR 190 191 191 THR THR A . n A 1 191 ASN 191 192 192 ASN ASN A . n A 1 192 VAL 192 193 193 VAL VAL A . n A 1 193 VAL 193 194 194 VAL VAL A . n A 1 194 LEU 194 195 195 LEU LEU A . n A 1 195 LYS 195 196 196 LYS LYS A . n A 1 196 PRO 196 197 197 PRO PRO A . n A 1 197 GLY 197 198 198 GLY GLY A . n A 1 198 MET 198 199 199 MET MET A . n A 1 199 THR 199 200 200 THR THR A . n A 1 200 PHE 200 201 201 PHE PHE A . n A 1 201 THR 201 202 202 THR THR A . n A 1 202 ILE 202 203 203 ILE ILE A . n A 1 203 GLU 203 204 204 GLU GLU A . n A 1 204 PRO 204 205 205 PRO PRO A . n A 1 205 MET 205 206 206 MET MET A . n A 1 206 VAL 206 207 207 VAL VAL A . n A 1 207 ASN 207 208 208 ASN ASN A . n A 1 208 ALA 208 209 209 ALA ALA A . n A 1 209 GLY 209 210 210 GLY GLY A . n A 1 210 LYS 210 211 211 LYS LYS A . n A 1 211 LYS 211 212 212 LYS LYS A . n A 1 212 GLU 212 213 213 GLU GLU A . n A 1 213 ILE 213 214 214 ILE ILE A . n A 1 214 ARG 214 215 215 ARG ARG A . n A 1 215 THR 215 216 216 THR THR A . n A 1 216 MET 216 217 217 MET MET A . n A 1 217 LYS 217 218 218 LYS LYS A . n A 1 218 ASP 218 219 219 ASP ASP A . n A 1 219 GLY 219 220 220 GLY GLY A . n A 1 220 TRP 220 221 221 TRP TRP A . n A 1 221 THR 221 222 222 THR THR A . n A 1 222 VAL 222 223 223 VAL VAL A . n A 1 223 LYS 223 224 224 LYS LYS A . n A 1 224 THR 224 225 225 THR THR A . n A 1 225 LYS 225 226 226 LYS LYS A . n A 1 226 ASP 226 227 227 ASP ASP A . n A 1 227 ARG 227 228 228 ARG ARG A . n A 1 228 SER 228 229 229 SER SER A . n A 1 229 LEU 229 230 230 LEU LEU A . n A 1 230 SER 230 231 231 SER SER A . n A 1 231 ALA 231 232 232 ALA ALA A . n A 1 232 GLN 232 233 233 GLN GLN A . n A 1 233 TYR 233 234 234 TYR TYR A . n A 1 234 GLU 234 235 235 GLU GLU A . n A 1 235 HIS 235 236 236 HIS HIS A . n A 1 236 THR 236 237 237 THR THR A . n A 1 237 ILE 237 238 238 ILE ILE A . n A 1 238 VAL 238 239 239 VAL VAL A . n A 1 239 VAL 239 240 240 VAL VAL A . n A 1 240 THR 240 241 241 THR THR A . n A 1 241 ASP 241 242 242 ASP ASP A . n A 1 242 ASN 242 243 243 ASN ASN A . n A 1 243 GLY 243 244 244 GLY GLY A . n A 1 244 CYS 244 245 245 CYS CYS A . n A 1 245 GLU 245 246 246 GLU GLU A . n A 1 246 ILE 246 247 247 ILE ILE A . n A 1 247 LEU 247 248 248 LEU LEU A . n A 1 248 THR 248 249 249 THR THR A . n A 1 249 LEU 249 250 250 LEU LEU A . n A 1 250 ARG 250 251 251 ARG ARG A . n A 1 251 LYS 251 252 252 LYS LYS A . n A 1 252 ASP 252 253 253 ASP ASP A . n A 1 253 ASP 253 254 254 ASP ASP A . n A 1 254 THR 254 255 255 THR THR A . n A 1 255 ILE 255 256 256 ILE ILE A . n A 1 256 PRO 256 257 257 PRO PRO A . n A 1 257 ALA 257 258 258 ALA ALA A . n A 1 258 ILE 258 259 259 ILE ILE A . n A 1 259 ILE 259 260 260 ILE ILE A . n A 1 260 SER 260 261 261 SER SER A . n A 1 261 HIS 261 262 262 HIS HIS A . n A 1 262 ASP 262 263 263 ASP ASP A . n A 1 263 GLU 263 264 264 GLU GLU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CO 1 301 301 CO CO A . C 2 CO 1 302 302 CO CO A . D 3 NA 1 603 603 NA NA A . E 4 U11 1 601 601 U11 U11 A . F 5 HOH 1 604 1 HOH HOH A . F 5 HOH 2 605 2 HOH HOH A . F 5 HOH 3 606 3 HOH HOH A . F 5 HOH 4 607 4 HOH HOH A . F 5 HOH 5 608 5 HOH HOH A . F 5 HOH 6 609 7 HOH HOH A . F 5 HOH 7 610 9 HOH HOH A . F 5 HOH 8 611 10 HOH HOH A . F 5 HOH 9 612 11 HOH HOH A . F 5 HOH 10 613 12 HOH HOH A . F 5 HOH 11 614 13 HOH HOH A . F 5 HOH 12 615 14 HOH HOH A . F 5 HOH 13 616 15 HOH HOH A . F 5 HOH 14 617 16 HOH HOH A . F 5 HOH 15 618 17 HOH HOH A . F 5 HOH 16 619 18 HOH HOH A . F 5 HOH 17 620 20 HOH HOH A . F 5 HOH 18 621 21 HOH HOH A . F 5 HOH 19 622 22 HOH HOH A . F 5 HOH 20 623 23 HOH HOH A . F 5 HOH 21 624 24 HOH HOH A . F 5 HOH 22 625 25 HOH HOH A . F 5 HOH 23 626 26 HOH HOH A . F 5 HOH 24 627 27 HOH HOH A . F 5 HOH 25 628 28 HOH HOH A . F 5 HOH 26 629 29 HOH HOH A . F 5 HOH 27 630 30 HOH HOH A . F 5 HOH 28 631 31 HOH HOH A . F 5 HOH 29 632 32 HOH HOH A . F 5 HOH 30 633 34 HOH HOH A . F 5 HOH 31 634 35 HOH HOH A . F 5 HOH 32 635 36 HOH HOH A . F 5 HOH 33 636 37 HOH HOH A . F 5 HOH 34 637 40 HOH HOH A . F 5 HOH 35 638 41 HOH HOH A . F 5 HOH 36 639 42 HOH HOH A . F 5 HOH 37 640 43 HOH HOH A . F 5 HOH 38 641 44 HOH HOH A . F 5 HOH 39 642 46 HOH HOH A . F 5 HOH 40 643 47 HOH HOH A . F 5 HOH 41 644 48 HOH HOH A . F 5 HOH 42 645 49 HOH HOH A . F 5 HOH 43 646 50 HOH HOH A . F 5 HOH 44 647 52 HOH HOH A . F 5 HOH 45 648 53 HOH HOH A . F 5 HOH 46 649 54 HOH HOH A . F 5 HOH 47 650 55 HOH HOH A . F 5 HOH 48 651 56 HOH HOH A . F 5 HOH 49 652 57 HOH HOH A . F 5 HOH 50 653 58 HOH HOH A . F 5 HOH 51 654 60 HOH HOH A . F 5 HOH 52 655 61 HOH HOH A . F 5 HOH 53 656 63 HOH HOH A . F 5 HOH 54 657 64 HOH HOH A . F 5 HOH 55 658 66 HOH HOH A . F 5 HOH 56 659 68 HOH HOH A . F 5 HOH 57 660 70 HOH HOH A . F 5 HOH 58 661 71 HOH HOH A . F 5 HOH 59 662 72 HOH HOH A . F 5 HOH 60 663 73 HOH HOH A . F 5 HOH 61 664 74 HOH HOH A . F 5 HOH 62 665 75 HOH HOH A . F 5 HOH 63 666 76 HOH HOH A . F 5 HOH 64 667 77 HOH HOH A . F 5 HOH 65 668 79 HOH HOH A . F 5 HOH 66 669 80 HOH HOH A . F 5 HOH 67 670 81 HOH HOH A . F 5 HOH 68 671 82 HOH HOH A . F 5 HOH 69 672 83 HOH HOH A . F 5 HOH 70 673 84 HOH HOH A . F 5 HOH 71 674 85 HOH HOH A . F 5 HOH 72 675 86 HOH HOH A . F 5 HOH 73 676 87 HOH HOH A . F 5 HOH 74 677 88 HOH HOH A . F 5 HOH 75 678 89 HOH HOH A . F 5 HOH 76 679 90 HOH HOH A . F 5 HOH 77 680 91 HOH HOH A . F 5 HOH 78 681 92 HOH HOH A . F 5 HOH 79 682 93 HOH HOH A . F 5 HOH 80 683 96 HOH HOH A . F 5 HOH 81 684 97 HOH HOH A . F 5 HOH 82 685 98 HOH HOH A . F 5 HOH 83 686 99 HOH HOH A . F 5 HOH 84 687 100 HOH HOH A . F 5 HOH 85 688 101 HOH HOH A . F 5 HOH 86 689 102 HOH HOH A . F 5 HOH 87 690 104 HOH HOH A . F 5 HOH 88 691 106 HOH HOH A . F 5 HOH 89 692 107 HOH HOH A . F 5 HOH 90 693 108 HOH HOH A . F 5 HOH 91 694 110 HOH HOH A . F 5 HOH 92 695 111 HOH HOH A . F 5 HOH 93 696 112 HOH HOH A . F 5 HOH 94 697 113 HOH HOH A . F 5 HOH 95 698 115 HOH HOH A . F 5 HOH 96 699 116 HOH HOH A . F 5 HOH 97 700 117 HOH HOH A . F 5 HOH 98 701 119 HOH HOH A . F 5 HOH 99 702 120 HOH HOH A . F 5 HOH 100 703 122 HOH HOH A . F 5 HOH 101 704 123 HOH HOH A . F 5 HOH 102 705 124 HOH HOH A . F 5 HOH 103 706 125 HOH HOH A . F 5 HOH 104 707 128 HOH HOH A . F 5 HOH 105 708 131 HOH HOH A . F 5 HOH 106 709 132 HOH HOH A . F 5 HOH 107 710 134 HOH HOH A . F 5 HOH 108 711 136 HOH HOH A . F 5 HOH 109 712 137 HOH HOH A . F 5 HOH 110 713 138 HOH HOH A . F 5 HOH 111 714 139 HOH HOH A . F 5 HOH 112 715 140 HOH HOH A . F 5 HOH 113 716 141 HOH HOH A . F 5 HOH 114 717 142 HOH HOH A . F 5 HOH 115 718 143 HOH HOH A . F 5 HOH 116 719 145 HOH HOH A . F 5 HOH 117 720 148 HOH HOH A . F 5 HOH 118 721 149 HOH HOH A . F 5 HOH 119 722 151 HOH HOH A . F 5 HOH 120 723 152 HOH HOH A . F 5 HOH 121 724 153 HOH HOH A . F 5 HOH 122 725 154 HOH HOH A . F 5 HOH 123 726 155 HOH HOH A . F 5 HOH 124 727 156 HOH HOH A . F 5 HOH 125 728 158 HOH HOH A . F 5 HOH 126 729 160 HOH HOH A . F 5 HOH 127 730 163 HOH HOH A . F 5 HOH 128 731 166 HOH HOH A . F 5 HOH 129 732 167 HOH HOH A . F 5 HOH 130 733 168 HOH HOH A . F 5 HOH 131 734 171 HOH HOH A . F 5 HOH 132 735 172 HOH HOH A . F 5 HOH 133 736 174 HOH HOH A . F 5 HOH 134 737 178 HOH HOH A . F 5 HOH 135 738 179 HOH HOH A . F 5 HOH 136 739 180 HOH HOH A . F 5 HOH 137 740 181 HOH HOH A . F 5 HOH 138 741 182 HOH HOH A . F 5 HOH 139 742 185 HOH HOH A . F 5 HOH 140 743 186 HOH HOH A . F 5 HOH 141 744 188 HOH HOH A . F 5 HOH 142 745 190 HOH HOH A . F 5 HOH 143 746 191 HOH HOH A . F 5 HOH 144 747 192 HOH HOH A . F 5 HOH 145 748 193 HOH HOH A . F 5 HOH 146 749 194 HOH HOH A . F 5 HOH 147 750 196 HOH HOH A . F 5 HOH 148 751 197 HOH HOH A . F 5 HOH 149 752 199 HOH HOH A . F 5 HOH 150 753 200 HOH HOH A . F 5 HOH 151 754 202 HOH HOH A . F 5 HOH 152 755 209 HOH HOH A . F 5 HOH 153 756 211 HOH HOH A . F 5 HOH 154 757 213 HOH HOH A . F 5 HOH 155 758 215 HOH HOH A . F 5 HOH 156 759 219 HOH HOH A . F 5 HOH 157 760 221 HOH HOH A . F 5 HOH 158 761 223 HOH HOH A . F 5 HOH 159 762 224 HOH HOH A . F 5 HOH 160 763 225 HOH HOH A . F 5 HOH 161 764 226 HOH HOH A . F 5 HOH 162 765 227 HOH HOH A . F 5 HOH 163 766 228 HOH HOH A . F 5 HOH 164 767 230 HOH HOH A . F 5 HOH 165 768 231 HOH HOH A . F 5 HOH 166 769 232 HOH HOH A . F 5 HOH 167 770 233 HOH HOH A . F 5 HOH 168 771 234 HOH HOH A . F 5 HOH 169 772 235 HOH HOH A . F 5 HOH 170 773 236 HOH HOH A . F 5 HOH 171 774 237 HOH HOH A . F 5 HOH 172 775 239 HOH HOH A . F 5 HOH 173 776 240 HOH HOH A . F 5 HOH 174 777 241 HOH HOH A . F 5 HOH 175 778 242 HOH HOH A . F 5 HOH 176 779 243 HOH HOH A . F 5 HOH 177 780 244 HOH HOH A . F 5 HOH 178 781 245 HOH HOH A . F 5 HOH 179 782 246 HOH HOH A . F 5 HOH 180 783 248 HOH HOH A . F 5 HOH 181 784 250 HOH HOH A . F 5 HOH 182 785 251 HOH HOH A . F 5 HOH 183 786 253 HOH HOH A . F 5 HOH 184 787 254 HOH HOH A . F 5 HOH 185 788 255 HOH HOH A . F 5 HOH 186 789 256 HOH HOH A . F 5 HOH 187 790 257 HOH HOH A . F 5 HOH 188 791 258 HOH HOH A . F 5 HOH 189 792 259 HOH HOH A . F 5 HOH 190 793 260 HOH HOH A . F 5 HOH 191 794 261 HOH HOH A . F 5 HOH 192 795 262 HOH HOH A . F 5 HOH 193 796 263 HOH HOH A . F 5 HOH 194 797 264 HOH HOH A . F 5 HOH 195 798 265 HOH HOH A . F 5 HOH 196 799 266 HOH HOH A . F 5 HOH 197 800 267 HOH HOH A . F 5 HOH 198 801 268 HOH HOH A . F 5 HOH 199 802 269 HOH HOH A . F 5 HOH 200 803 271 HOH HOH A . F 5 HOH 201 804 273 HOH HOH A . F 5 HOH 202 805 274 HOH HOH A . F 5 HOH 203 806 275 HOH HOH A . F 5 HOH 204 807 276 HOH HOH A . F 5 HOH 205 808 277 HOH HOH A . F 5 HOH 206 809 278 HOH HOH A . F 5 HOH 207 810 279 HOH HOH A . F 5 HOH 208 811 281 HOH HOH A . F 5 HOH 209 812 282 HOH HOH A . F 5 HOH 210 813 284 HOH HOH A . F 5 HOH 211 814 285 HOH HOH A . F 5 HOH 212 815 286 HOH HOH A . F 5 HOH 213 816 287 HOH HOH A . F 5 HOH 214 817 288 HOH HOH A . F 5 HOH 215 818 289 HOH HOH A . F 5 HOH 216 819 290 HOH HOH A . F 5 HOH 217 820 291 HOH HOH A . F 5 HOH 218 821 292 HOH HOH A . F 5 HOH 219 822 293 HOH HOH A . F 5 HOH 220 823 294 HOH HOH A . F 5 HOH 221 824 295 HOH HOH A . F 5 HOH 222 825 296 HOH HOH A . F 5 HOH 223 826 298 HOH HOH A . F 5 HOH 224 827 299 HOH HOH A . F 5 HOH 225 828 300 HOH HOH A . F 5 HOH 226 829 301 HOH HOH A . F 5 HOH 227 830 302 HOH HOH A . F 5 HOH 228 831 304 HOH HOH A . F 5 HOH 229 832 305 HOH HOH A . F 5 HOH 230 833 307 HOH HOH A . F 5 HOH 231 834 308 HOH HOH A . F 5 HOH 232 835 309 HOH HOH A . F 5 HOH 233 836 310 HOH HOH A . F 5 HOH 234 837 311 HOH HOH A . F 5 HOH 235 838 312 HOH HOH A . F 5 HOH 236 839 313 HOH HOH A . F 5 HOH 237 840 315 HOH HOH A . F 5 HOH 238 841 316 HOH HOH A . F 5 HOH 239 842 318 HOH HOH A . F 5 HOH 240 843 319 HOH HOH A . F 5 HOH 241 844 320 HOH HOH A . F 5 HOH 242 845 322 HOH HOH A . F 5 HOH 243 846 323 HOH HOH A . F 5 HOH 244 847 324 HOH HOH A . F 5 HOH 245 848 325 HOH HOH A . F 5 HOH 246 849 326 HOH HOH A . F 5 HOH 247 850 330 HOH HOH A . F 5 HOH 248 851 331 HOH HOH A . F 5 HOH 249 852 332 HOH HOH A . F 5 HOH 250 853 334 HOH HOH A . F 5 HOH 251 854 338 HOH HOH A . F 5 HOH 252 855 341 HOH HOH A . F 5 HOH 253 856 343 HOH HOH A . F 5 HOH 254 857 344 HOH HOH A . F 5 HOH 255 858 346 HOH HOH A . F 5 HOH 256 859 347 HOH HOH A . F 5 HOH 257 860 350 HOH HOH A . F 5 HOH 258 861 351 HOH HOH A . F 5 HOH 259 862 352 HOH HOH A . F 5 HOH 260 863 354 HOH HOH A . F 5 HOH 261 864 355 HOH HOH A . F 5 HOH 262 865 356 HOH HOH A . F 5 HOH 263 866 360 HOH HOH A . F 5 HOH 264 867 361 HOH HOH A . F 5 HOH 265 868 362 HOH HOH A . F 5 HOH 266 869 364 HOH HOH A . F 5 HOH 267 870 365 HOH HOH A . F 5 HOH 268 871 366 HOH HOH A . F 5 HOH 269 872 367 HOH HOH A . F 5 HOH 270 873 368 HOH HOH A . F 5 HOH 271 874 372 HOH HOH A . F 5 HOH 272 875 373 HOH HOH A . F 5 HOH 273 876 374 HOH HOH A . F 5 HOH 274 877 375 HOH HOH A . F 5 HOH 275 878 378 HOH HOH A . F 5 HOH 276 879 381 HOH HOH A . F 5 HOH 277 880 383 HOH HOH A . F 5 HOH 278 881 385 HOH HOH A . F 5 HOH 279 882 387 HOH HOH A . F 5 HOH 280 883 392 HOH HOH A . F 5 HOH 281 884 393 HOH HOH A . F 5 HOH 282 885 398 HOH HOH A . F 5 HOH 283 886 401 HOH HOH A . F 5 HOH 284 887 402 HOH HOH A . F 5 HOH 285 888 404 HOH HOH A . F 5 HOH 286 889 408 HOH HOH A . F 5 HOH 287 890 410 HOH HOH A . F 5 HOH 288 891 411 HOH HOH A . F 5 HOH 289 892 412 HOH HOH A . F 5 HOH 290 893 414 HOH HOH A . F 5 HOH 291 894 419 HOH HOH A . F 5 HOH 292 895 420 HOH HOH A . F 5 HOH 293 896 421 HOH HOH A . F 5 HOH 294 897 422 HOH HOH A . F 5 HOH 295 898 423 HOH HOH A . F 5 HOH 296 899 424 HOH HOH A . F 5 HOH 297 900 425 HOH HOH A . F 5 HOH 298 901 426 HOH HOH A . F 5 HOH 299 902 431 HOH HOH A . F 5 HOH 300 903 433 HOH HOH A . F 5 HOH 301 904 434 HOH HOH A . F 5 HOH 302 905 435 HOH HOH A . F 5 HOH 303 906 436 HOH HOH A . F 5 HOH 304 907 437 HOH HOH A . F 5 HOH 305 908 438 HOH HOH A . F 5 HOH 306 909 439 HOH HOH A . F 5 HOH 307 910 440 HOH HOH A . F 5 HOH 308 911 441 HOH HOH A . F 5 HOH 309 912 442 HOH HOH A . F 5 HOH 310 913 443 HOH HOH A . F 5 HOH 311 914 444 HOH HOH A . F 5 HOH 312 915 445 HOH HOH A . F 5 HOH 313 916 446 HOH HOH A . F 5 HOH 314 917 447 HOH HOH A . F 5 HOH 315 918 448 HOH HOH A . F 5 HOH 316 919 449 HOH HOH A . F 5 HOH 317 920 450 HOH HOH A . F 5 HOH 318 921 451 HOH HOH A . F 5 HOH 319 922 452 HOH HOH A . F 5 HOH 320 923 453 HOH HOH A . F 5 HOH 321 924 454 HOH HOH A . F 5 HOH 322 925 455 HOH HOH A . F 5 HOH 323 926 456 HOH HOH A . F 5 HOH 324 927 457 HOH HOH A . F 5 HOH 325 928 458 HOH HOH A . F 5 HOH 326 929 459 HOH HOH A . F 5 HOH 327 930 461 HOH HOH A . F 5 HOH 328 931 462 HOH HOH A . F 5 HOH 329 932 463 HOH HOH A . F 5 HOH 330 933 464 HOH HOH A . F 5 HOH 331 934 465 HOH HOH A . F 5 HOH 332 935 466 HOH HOH A . F 5 HOH 333 936 467 HOH HOH A . F 5 HOH 334 937 468 HOH HOH A . F 5 HOH 335 938 469 HOH HOH A . F 5 HOH 336 939 470 HOH HOH A . F 5 HOH 337 940 471 HOH HOH A . F 5 HOH 338 941 472 HOH HOH A . F 5 HOH 339 942 473 HOH HOH A . F 5 HOH 340 943 474 HOH HOH A . F 5 HOH 341 944 475 HOH HOH A . F 5 HOH 342 945 476 HOH HOH A . F 5 HOH 343 946 477 HOH HOH A . F 5 HOH 344 947 478 HOH HOH A . F 5 HOH 345 948 479 HOH HOH A . F 5 HOH 346 949 480 HOH HOH A . F 5 HOH 347 950 481 HOH HOH A . F 5 HOH 348 951 482 HOH HOH A . F 5 HOH 349 952 483 HOH HOH A . F 5 HOH 350 953 484 HOH HOH A . F 5 HOH 351 954 485 HOH HOH A . F 5 HOH 352 955 486 HOH HOH A . F 5 HOH 353 956 487 HOH HOH A . F 5 HOH 354 957 488 HOH HOH A . F 5 HOH 355 958 489 HOH HOH A . F 5 HOH 356 959 490 HOH HOH A . F 5 HOH 357 960 491 HOH HOH A . F 5 HOH 358 961 492 HOH HOH A . F 5 HOH 359 962 493 HOH HOH A . F 5 HOH 360 963 495 HOH HOH A . F 5 HOH 361 964 497 HOH HOH A . F 5 HOH 362 965 498 HOH HOH A . F 5 HOH 363 966 499 HOH HOH A . F 5 HOH 364 967 500 HOH HOH A . F 5 HOH 365 968 501 HOH HOH A . F 5 HOH 366 969 502 HOH HOH A . F 5 HOH 367 970 503 HOH HOH A . F 5 HOH 368 971 504 HOH HOH A . F 5 HOH 369 972 505 HOH HOH A . F 5 HOH 370 973 506 HOH HOH A . F 5 HOH 371 974 507 HOH HOH A . F 5 HOH 372 975 508 HOH HOH A . F 5 HOH 373 976 509 HOH HOH A . F 5 HOH 374 977 510 HOH HOH A . F 5 HOH 375 978 511 HOH HOH A . F 5 HOH 376 979 512 HOH HOH A . F 5 HOH 377 980 513 HOH HOH A . F 5 HOH 378 981 514 HOH HOH A . F 5 HOH 379 982 515 HOH HOH A . F 5 HOH 380 983 516 HOH HOH A . F 5 HOH 381 984 517 HOH HOH A . F 5 HOH 382 985 518 HOH HOH A . F 5 HOH 383 986 519 HOH HOH A . F 5 HOH 384 987 520 HOH HOH A . F 5 HOH 385 988 521 HOH HOH A . F 5 HOH 386 989 522 HOH HOH A . F 5 HOH 387 990 523 HOH HOH A . F 5 HOH 388 991 524 HOH HOH A . F 5 HOH 389 992 525 HOH HOH A . F 5 HOH 390 993 526 HOH HOH A . F 5 HOH 391 994 527 HOH HOH A . F 5 HOH 392 995 528 HOH HOH A . F 5 HOH 393 996 529 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A ASN 73 ? A ASN 74 ? 1_555 NA ? D NA . ? A NA 603 ? 1_555 O ? A VAL 75 ? A VAL 76 ? 1_555 98.6 ? 2 O ? A ASN 73 ? A ASN 74 ? 1_555 NA ? D NA . ? A NA 603 ? 1_555 O ? A SER 230 ? A SER 231 ? 1_555 94.2 ? 3 O ? A VAL 75 ? A VAL 76 ? 1_555 NA ? D NA . ? A NA 603 ? 1_555 O ? A SER 230 ? A SER 231 ? 1_555 130.4 ? 4 O ? A ASN 73 ? A ASN 74 ? 1_555 NA ? D NA . ? A NA 603 ? 1_555 O ? F HOH . ? A HOH 680 ? 1_555 136.4 ? 5 O ? A VAL 75 ? A VAL 76 ? 1_555 NA ? D NA . ? A NA 603 ? 1_555 O ? F HOH . ? A HOH 680 ? 1_555 110.2 ? 6 O ? A SER 230 ? A SER 231 ? 1_555 NA ? D NA . ? A NA 603 ? 1_555 O ? F HOH . ? A HOH 680 ? 1_555 91.2 ? 7 OD1 ? A ASP 96 ? A ASP 97 ? 1_555 CO ? C CO . ? A CO 302 ? 1_555 OD2 ? A ASP 96 ? A ASP 97 ? 1_555 57.5 ? 8 OD1 ? A ASP 96 ? A ASP 97 ? 1_555 CO ? C CO . ? A CO 302 ? 1_555 OD2 ? A ASP 107 ? A ASP 108 ? 1_555 103.0 ? 9 OD2 ? A ASP 96 ? A ASP 97 ? 1_555 CO ? C CO . ? A CO 302 ? 1_555 OD2 ? A ASP 107 ? A ASP 108 ? 1_555 160.1 ? 10 OD1 ? A ASP 96 ? A ASP 97 ? 1_555 CO ? C CO . ? A CO 302 ? 1_555 OE2 ? A GLU 234 ? A GLU 235 ? 1_555 96.0 ? 11 OD2 ? A ASP 96 ? A ASP 97 ? 1_555 CO ? C CO . ? A CO 302 ? 1_555 OE2 ? A GLU 234 ? A GLU 235 ? 1_555 97.1 ? 12 OD2 ? A ASP 107 ? A ASP 108 ? 1_555 CO ? C CO . ? A CO 302 ? 1_555 OE2 ? A GLU 234 ? A GLU 235 ? 1_555 87.9 ? 13 OD1 ? A ASP 96 ? A ASP 97 ? 1_555 CO ? C CO . ? A CO 302 ? 1_555 N24 ? E U11 . ? A U11 601 ? 1_555 91.0 ? 14 OD2 ? A ASP 96 ? A ASP 97 ? 1_555 CO ? C CO . ? A CO 302 ? 1_555 N24 ? E U11 . ? A U11 601 ? 1_555 83.0 ? 15 OD2 ? A ASP 107 ? A ASP 108 ? 1_555 CO ? C CO . ? A CO 302 ? 1_555 N24 ? E U11 . ? A U11 601 ? 1_555 94.8 ? 16 OE2 ? A GLU 234 ? A GLU 235 ? 1_555 CO ? C CO . ? A CO 302 ? 1_555 N24 ? E U11 . ? A U11 601 ? 1_555 171.8 ? 17 OD1 ? A ASP 96 ? A ASP 97 ? 1_555 CO ? C CO . ? A CO 302 ? 1_555 O27 ? E U11 . ? A U11 601 ? 1_555 147.3 ? 18 OD2 ? A ASP 96 ? A ASP 97 ? 1_555 CO ? C CO . ? A CO 302 ? 1_555 O27 ? E U11 . ? A U11 601 ? 1_555 89.9 ? 19 OD2 ? A ASP 107 ? A ASP 108 ? 1_555 CO ? C CO . ? A CO 302 ? 1_555 O27 ? E U11 . ? A U11 601 ? 1_555 109.6 ? 20 OE2 ? A GLU 234 ? A GLU 235 ? 1_555 CO ? C CO . ? A CO 302 ? 1_555 O27 ? E U11 . ? A U11 601 ? 1_555 87.3 ? 21 N24 ? E U11 . ? A U11 601 ? 1_555 CO ? C CO . ? A CO 302 ? 1_555 O27 ? E U11 . ? A U11 601 ? 1_555 84.5 ? 22 OD1 ? A ASP 107 ? A ASP 108 ? 1_555 CO ? B CO . ? A CO 301 ? 1_555 NE2 ? A HIS 170 ? A HIS 171 ? 1_555 91.2 ? 23 OD1 ? A ASP 107 ? A ASP 108 ? 1_555 CO ? B CO . ? A CO 301 ? 1_555 OE2 ? A GLU 203 ? A GLU 204 ? 1_555 160.6 ? 24 NE2 ? A HIS 170 ? A HIS 171 ? 1_555 CO ? B CO . ? A CO 301 ? 1_555 OE2 ? A GLU 203 ? A GLU 204 ? 1_555 87.3 ? 25 OD1 ? A ASP 107 ? A ASP 108 ? 1_555 CO ? B CO . ? A CO 301 ? 1_555 OE1 ? A GLU 234 ? A GLU 235 ? 1_555 86.0 ? 26 NE2 ? A HIS 170 ? A HIS 171 ? 1_555 CO ? B CO . ? A CO 301 ? 1_555 OE1 ? A GLU 234 ? A GLU 235 ? 1_555 117.7 ? 27 OE2 ? A GLU 203 ? A GLU 204 ? 1_555 CO ? B CO . ? A CO 301 ? 1_555 OE1 ? A GLU 234 ? A GLU 235 ? 1_555 77.6 ? 28 OD1 ? A ASP 107 ? A ASP 108 ? 1_555 CO ? B CO . ? A CO 301 ? 1_555 O27 ? E U11 . ? A U11 601 ? 1_555 100.2 ? 29 NE2 ? A HIS 170 ? A HIS 171 ? 1_555 CO ? B CO . ? A CO 301 ? 1_555 O27 ? E U11 . ? A U11 601 ? 1_555 151.7 ? 30 OE2 ? A GLU 203 ? A GLU 204 ? 1_555 CO ? B CO . ? A CO 301 ? 1_555 O27 ? E U11 . ? A U11 601 ? 1_555 90.1 ? 31 OE1 ? A GLU 234 ? A GLU 235 ? 1_555 CO ? B CO . ? A CO 301 ? 1_555 O27 ? E U11 . ? A U11 601 ? 1_555 89.2 ? 32 OD1 ? A ASP 107 ? A ASP 108 ? 1_555 CO ? B CO . ? A CO 301 ? 1_555 O31 ? E U11 . ? A U11 601 ? 1_555 107.2 ? 33 NE2 ? A HIS 170 ? A HIS 171 ? 1_555 CO ? B CO . ? A CO 301 ? 1_555 O31 ? E U11 . ? A U11 601 ? 1_555 75.8 ? 34 OE2 ? A GLU 203 ? A GLU 204 ? 1_555 CO ? B CO . ? A CO 301 ? 1_555 O31 ? E U11 . ? A U11 601 ? 1_555 91.2 ? 35 OE1 ? A GLU 234 ? A GLU 235 ? 1_555 CO ? B CO . ? A CO 301 ? 1_555 O31 ? E U11 . ? A U11 601 ? 1_555 161.6 ? 36 O27 ? E U11 . ? A U11 601 ? 1_555 CO ? B CO . ? A CO 301 ? 1_555 O31 ? E U11 . ? A U11 601 ? 1_555 76.1 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-06-13 2 'Structure model' 1 1 2008-04-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2023-08-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' chem_comp_atom 2 4 'Structure model' chem_comp_bond 3 4 'Structure model' database_2 4 4 'Structure model' pdbx_initial_refinement_model 5 4 'Structure model' pdbx_struct_conn_angle 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_comp_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_atom_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_comp_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 16 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 17 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 18 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 19 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 20 4 'Structure model' '_pdbx_struct_conn_angle.value' 21 4 'Structure model' '_struct_conn.pdbx_dist_value' 22 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 23 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 24 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 25 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 26 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 27 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 28 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 29 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 30 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 31 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 32 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 33 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 34 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 35 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 36 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id _software.pdbx_ordinal REFMAC . ? program 'Murshudov, G.N.' ccp4@dl.ac.uk refinement http://www.ccp4.ac.uk/main.html Fortran_77 ? 1 PDB_EXTRACT 1.701 'Nov. 1, 2005' package PDB sw-help@rcsb.rutgers.edu 'data extraction' http://pdb.rutgers.edu/software/ C++ ? 2 ADSC . ? ? ? ? 'data collection' ? ? ? 3 SCALEPACK . ? ? ? ? 'data scaling' ? ? ? 4 AMoRE . ? ? ? ? phasing ? ? ? 5 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 754 ? ? O A HOH 851 ? ? 2.05 2 1 OE2 A GLU 160 ? ? O A HOH 993 ? ? 2.12 3 1 O A HOH 960 ? ? O A HOH 962 ? ? 2.12 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 NH2 A ARG 138 ? B 1_555 O A HOH 688 ? ? 1_455 1.43 2 1 NH1 A ARG 138 ? B 1_555 O A HOH 644 ? ? 1_455 1.66 3 1 NZ A LYS 218 ? B 1_555 O A HOH 836 ? ? 1_655 1.73 4 1 O A HOH 958 ? ? 1_555 O A HOH 968 ? ? 2_545 1.78 5 1 ND1 A HIS 63 ? ? 1_555 O A HOH 894 ? ? 1_655 1.78 6 1 CZ A ARG 138 ? B 1_555 O A HOH 644 ? ? 1_455 2.19 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 63 ? ? 49.75 27.77 2 1 ASN A 74 ? ? 58.94 -116.48 3 1 TYR A 168 ? A 50.40 96.99 4 1 GLU A 204 ? ? -151.29 57.91 5 1 TRP A 221 ? ? -132.89 -50.88 # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id ALA _pdbx_unobs_or_zero_occ_residues.auth_seq_id 2 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id ALA _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CO CO CO N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 NA NA NA N N 251 PHE N N N N 252 PHE CA C N S 253 PHE C C N N 254 PHE O O N N 255 PHE CB C N N 256 PHE CG C Y N 257 PHE CD1 C Y N 258 PHE CD2 C Y N 259 PHE CE1 C Y N 260 PHE CE2 C Y N 261 PHE CZ C Y N 262 PHE OXT O N N 263 PHE H H N N 264 PHE H2 H N N 265 PHE HA H N N 266 PHE HB2 H N N 267 PHE HB3 H N N 268 PHE HD1 H N N 269 PHE HD2 H N N 270 PHE HE1 H N N 271 PHE HE2 H N N 272 PHE HZ H N N 273 PHE HXT H N N 274 PRO N N N N 275 PRO CA C N S 276 PRO C C N N 277 PRO O O N N 278 PRO CB C N N 279 PRO CG C N N 280 PRO CD C N N 281 PRO OXT O N N 282 PRO H H N N 283 PRO HA H N N 284 PRO HB2 H N N 285 PRO HB3 H N N 286 PRO HG2 H N N 287 PRO HG3 H N N 288 PRO HD2 H N N 289 PRO HD3 H N N 290 PRO HXT H N N 291 SER N N N N 292 SER CA C N S 293 SER C C N N 294 SER O O N N 295 SER CB C N N 296 SER OG O N N 297 SER OXT O N N 298 SER H H N N 299 SER H2 H N N 300 SER HA H N N 301 SER HB2 H N N 302 SER HB3 H N N 303 SER HG H N N 304 SER HXT H N N 305 THR N N N N 306 THR CA C N S 307 THR C C N N 308 THR O O N N 309 THR CB C N R 310 THR OG1 O N N 311 THR CG2 C N N 312 THR OXT O N N 313 THR H H N N 314 THR H2 H N N 315 THR HA H N N 316 THR HB H N N 317 THR HG1 H N N 318 THR HG21 H N N 319 THR HG22 H N N 320 THR HG23 H N N 321 THR HXT H N N 322 TRP N N N N 323 TRP CA C N S 324 TRP C C N N 325 TRP O O N N 326 TRP CB C N N 327 TRP CG C Y N 328 TRP CD1 C Y N 329 TRP CD2 C Y N 330 TRP NE1 N Y N 331 TRP CE2 C Y N 332 TRP CE3 C Y N 333 TRP CZ2 C Y N 334 TRP CZ3 C Y N 335 TRP CH2 C Y N 336 TRP OXT O N N 337 TRP H H N N 338 TRP H2 H N N 339 TRP HA H N N 340 TRP HB2 H N N 341 TRP HB3 H N N 342 TRP HD1 H N N 343 TRP HE1 H N N 344 TRP HE3 H N N 345 TRP HZ2 H N N 346 TRP HZ3 H N N 347 TRP HH2 H N N 348 TRP HXT H N N 349 TYR N N N N 350 TYR CA C N S 351 TYR C C N N 352 TYR O O N N 353 TYR CB C N N 354 TYR CG C Y N 355 TYR CD1 C Y N 356 TYR CD2 C Y N 357 TYR CE1 C Y N 358 TYR CE2 C Y N 359 TYR CZ C Y N 360 TYR OH O N N 361 TYR OXT O N N 362 TYR H H N N 363 TYR H2 H N N 364 TYR HA H N N 365 TYR HB2 H N N 366 TYR HB3 H N N 367 TYR HD1 H N N 368 TYR HD2 H N N 369 TYR HE1 H N N 370 TYR HE2 H N N 371 TYR HH H N N 372 TYR HXT H N N 373 U11 F29 F N N 374 U11 C9 C N N 375 U11 F30 F N N 376 U11 F31 F N N 377 U11 C5 C Y N 378 U11 C2 C Y N 379 U11 C4 C Y N 380 U11 C6 C Y N 381 U11 C3 C Y N 382 U11 C7 C Y N 383 U11 C11 C N R 384 U11 N24 N N N 385 U11 C23 C N S 386 U11 O27 O N N 387 U11 C25 C N N 388 U11 O31 O N N 389 U11 N32 N N N 390 U11 C33 C N S 391 U11 C37 C N N 392 U11 C36 C N N 393 U11 O41 O N N 394 U11 N42 N N N 395 U11 C43 C N N 396 U11 C47 C N N 397 U11 O60 O N N 398 U11 O61 O N N 399 U11 C62 C N N 400 U11 H2 H N N 401 U11 H4 H N N 402 U11 H6 H N N 403 U11 H3 H N N 404 U11 H11 H N N 405 U11 H241 H N N 406 U11 H242 H N N 407 U11 H23 H N N 408 U11 HO27 H N N 409 U11 HN32 H N N 410 U11 H33 H N N 411 U11 H371 H N N 412 U11 H372 H N N 413 U11 H373 H N N 414 U11 HN42 H N N 415 U11 H431 H N N 416 U11 H432 H N N 417 U11 H621 H N N 418 U11 H622 H N N 419 U11 H623 H N N 420 VAL N N N N 421 VAL CA C N S 422 VAL C C N N 423 VAL O O N N 424 VAL CB C N N 425 VAL CG1 C N N 426 VAL CG2 C N N 427 VAL OXT O N N 428 VAL H H N N 429 VAL H2 H N N 430 VAL HA H N N 431 VAL HB H N N 432 VAL HG11 H N N 433 VAL HG12 H N N 434 VAL HG13 H N N 435 VAL HG21 H N N 436 VAL HG22 H N N 437 VAL HG23 H N N 438 VAL HXT H N N 439 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 U11 F29 C9 sing N N 358 U11 C9 F30 sing N N 359 U11 C9 F31 sing N N 360 U11 C9 C5 sing N N 361 U11 C5 C2 sing Y N 362 U11 C5 C6 doub Y N 363 U11 C2 C4 doub Y N 364 U11 C2 H2 sing N N 365 U11 C4 C7 sing Y N 366 U11 C4 H4 sing N N 367 U11 C6 C3 sing Y N 368 U11 C6 H6 sing N N 369 U11 C3 C7 doub Y N 370 U11 C3 H3 sing N N 371 U11 C7 C11 sing N N 372 U11 C11 N24 sing N N 373 U11 C11 C23 sing N N 374 U11 C11 H11 sing N N 375 U11 N24 H241 sing N N 376 U11 N24 H242 sing N N 377 U11 C23 O27 sing N N 378 U11 C23 C25 sing N N 379 U11 C23 H23 sing N N 380 U11 O27 HO27 sing N N 381 U11 C25 O31 doub N N 382 U11 C25 N32 sing N N 383 U11 N32 C33 sing N N 384 U11 N32 HN32 sing N N 385 U11 C33 C37 sing N N 386 U11 C33 C36 sing N N 387 U11 C33 H33 sing N N 388 U11 C37 H371 sing N N 389 U11 C37 H372 sing N N 390 U11 C37 H373 sing N N 391 U11 C36 O41 doub N N 392 U11 C36 N42 sing N N 393 U11 N42 C43 sing N N 394 U11 N42 HN42 sing N N 395 U11 C43 C47 sing N N 396 U11 C43 H431 sing N N 397 U11 C43 H432 sing N N 398 U11 C47 O60 doub N N 399 U11 C47 O61 sing N N 400 U11 O61 C62 sing N N 401 U11 C62 H621 sing N N 402 U11 C62 H622 sing N N 403 U11 C62 H623 sing N N 404 VAL N CA sing N N 405 VAL N H sing N N 406 VAL N H2 sing N N 407 VAL CA C sing N N 408 VAL CA CB sing N N 409 VAL CA HA sing N N 410 VAL C O doub N N 411 VAL C OXT sing N N 412 VAL CB CG1 sing N N 413 VAL CB CG2 sing N N 414 VAL CB HB sing N N 415 VAL CG1 HG11 sing N N 416 VAL CG1 HG12 sing N N 417 VAL CG1 HG13 sing N N 418 VAL CG2 HG21 sing N N 419 VAL CG2 HG22 sing N N 420 VAL CG2 HG23 sing N N 421 VAL OXT HXT sing N N 422 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'COBALT (II) ION' CO 3 'SODIUM ION' NA 4 'METHYL N-{(2S,3R)-3-AMINO-2-HYDROXY-3-[4-(TRIFLUOROMETHYL)PHENYL]PROPANOYL}ALANYLGLYCINATE' U11 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1C27 _pdbx_initial_refinement_model.details 'PDB ENTRY 1C27' #