data_2GVS # _entry.id 2GVS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2GVS pdb_00002gvs 10.2210/pdb2gvs/pdb RCSB RCSB037608 ? ? WWPDB D_1000037608 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2GVS _pdbx_database_status.recvd_initial_deposition_date 2006-05-03 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tomaselli, S.' 1 'Crescenzi, O.' 2 'Sanfelice, D.' 3 'Ab, E.' 4 'Tancredi, T.' 5 'Picone, D.' 6 # _citation.id primary _citation.title 'Solution Structure of a Chemosensory Protein from the Desert Locust Schistocerca gregaria(,).' _citation.journal_abbrev Biochemistry _citation.journal_volume 45 _citation.page_first 10606 _citation.page_last 10613 _citation.year 2006 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16939212 _citation.pdbx_database_id_DOI 10.1021/bi060998w # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tomaselli, S.' 1 ? primary 'Crescenzi, O.' 2 ? primary 'Sanfelice, D.' 3 ? primary 'Ab, E.' 4 ? primary 'Wechselberger, R.' 5 ? primary 'Angeli, S.' 6 ? primary 'Scaloni, A.' 7 ? primary 'Boelens, R.' 8 ? primary 'Tancredi, T.' 9 ? primary 'Pelosi, P.' 10 ? primary 'Picone, D.' 11 ? # _cell.entry_id 2GVS _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2GVS _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'chemosensory protein CSP-sg4' _entity.formula_weight 12697.210 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;EEKYTTKYDNVNLDEILANDRLLNKYVQCLLEDDESNCTADGKELKSVIPDALSNECAKCNEKQKEGTKKVLKHLINHKP DVWAQLKAKYDPDGTYSKKYEDREKELHQ ; _entity_poly.pdbx_seq_one_letter_code_can ;EEKYTTKYDNVNLDEILANDRLLNKYVQCLLEDDESNCTADGKELKSVIPDALSNECAKCNEKQKEGTKKVLKHLINHKP DVWAQLKAKYDPDGTYSKKYEDREKELHQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 GLU n 1 3 LYS n 1 4 TYR n 1 5 THR n 1 6 THR n 1 7 LYS n 1 8 TYR n 1 9 ASP n 1 10 ASN n 1 11 VAL n 1 12 ASN n 1 13 LEU n 1 14 ASP n 1 15 GLU n 1 16 ILE n 1 17 LEU n 1 18 ALA n 1 19 ASN n 1 20 ASP n 1 21 ARG n 1 22 LEU n 1 23 LEU n 1 24 ASN n 1 25 LYS n 1 26 TYR n 1 27 VAL n 1 28 GLN n 1 29 CYS n 1 30 LEU n 1 31 LEU n 1 32 GLU n 1 33 ASP n 1 34 ASP n 1 35 GLU n 1 36 SER n 1 37 ASN n 1 38 CYS n 1 39 THR n 1 40 ALA n 1 41 ASP n 1 42 GLY n 1 43 LYS n 1 44 GLU n 1 45 LEU n 1 46 LYS n 1 47 SER n 1 48 VAL n 1 49 ILE n 1 50 PRO n 1 51 ASP n 1 52 ALA n 1 53 LEU n 1 54 SER n 1 55 ASN n 1 56 GLU n 1 57 CYS n 1 58 ALA n 1 59 LYS n 1 60 CYS n 1 61 ASN n 1 62 GLU n 1 63 LYS n 1 64 GLN n 1 65 LYS n 1 66 GLU n 1 67 GLY n 1 68 THR n 1 69 LYS n 1 70 LYS n 1 71 VAL n 1 72 LEU n 1 73 LYS n 1 74 HIS n 1 75 LEU n 1 76 ILE n 1 77 ASN n 1 78 HIS n 1 79 LYS n 1 80 PRO n 1 81 ASP n 1 82 VAL n 1 83 TRP n 1 84 ALA n 1 85 GLN n 1 86 LEU n 1 87 LYS n 1 88 ALA n 1 89 LYS n 1 90 TYR n 1 91 ASP n 1 92 PRO n 1 93 ASP n 1 94 GLY n 1 95 THR n 1 96 TYR n 1 97 SER n 1 98 LYS n 1 99 LYS n 1 100 TYR n 1 101 GLU n 1 102 ASP n 1 103 ARG n 1 104 GLU n 1 105 LYS n 1 106 GLU n 1 107 LEU n 1 108 HIS n 1 109 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Schistocerca _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Schistocerca gregaria' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 7010 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET-Schi 10' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code O76476_SCHGR _struct_ref.pdbx_db_accession O76476 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2GVS _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 109 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O76476 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 109 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 109 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_13C-separated_NOESY 1 2 1 3D_15N-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 300 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.ionic_strength '50 mm Na Phosphate buffer' _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '50mM Sodium phosphate buffer, 95% H2O, 5% D2O' _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 DRX Bruker 500 ? 2 DRX Bruker 600 ? 3 DRX Bruker 750 ? # _pdbx_nmr_refine.entry_id 2GVS _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2GVS _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2GVS _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 ? 1 processing NMRPipe linux 'Delaglio et al.' 2 'data analysis' NMRView 5.0.4 'Johnson et al.' 3 'structure solution' CYANA 2.0 ? 4 refinement Amber 99 ? 5 # _exptl.entry_id 2GVS _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 2GVS _struct.title 'NMR solution structure of CSPsg4' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2GVS _struct_keywords.pdbx_keywords 'LIPID BINDING PROTEIN' _struct_keywords.text 'alpha-coil, LIPID BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 12 ? ASN A 19 ? ASN A 12 ASN A 19 1 ? 8 HELX_P HELX_P2 2 ASN A 19 ? GLU A 32 ? ASN A 19 GLU A 32 1 ? 14 HELX_P HELX_P3 3 ASP A 41 ? ILE A 49 ? ASP A 41 ILE A 49 1 ? 9 HELX_P HELX_P4 4 PRO A 50 ? ASN A 55 ? PRO A 50 ASN A 55 1 ? 6 HELX_P HELX_P5 5 ASN A 61 ? LYS A 79 ? ASN A 61 LYS A 79 1 ? 19 HELX_P HELX_P6 6 LYS A 79 ? ASP A 91 ? LYS A 79 ASP A 91 1 ? 13 HELX_P HELX_P7 7 SER A 97 ? ASP A 102 ? SER A 97 ASP A 102 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 29 SG ? ? ? 1_555 A CYS 38 SG ? ? A CYS 29 A CYS 38 1_555 ? ? ? ? ? ? ? 2.027 ? ? disulf2 disulf ? ? A CYS 57 SG ? ? ? 1_555 A CYS 60 SG ? ? A CYS 57 A CYS 60 1_555 ? ? ? ? ? ? ? 2.043 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _database_PDB_matrix.entry_id 2GVS _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2GVS _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 1 1 GLU GLU A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 TYR 4 4 4 TYR TYR A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 TYR 8 8 8 TYR TYR A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 PRO 50 50 50 PRO PRO A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 CYS 57 57 57 CYS CYS A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 CYS 60 60 60 CYS CYS A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 GLN 64 64 64 GLN GLN A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 HIS 74 74 74 HIS HIS A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 ASN 77 77 77 ASN ASN A . n A 1 78 HIS 78 78 78 HIS HIS A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 PRO 80 80 80 PRO PRO A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 TRP 83 83 83 TRP TRP A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 GLN 85 85 85 GLN GLN A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 TYR 90 90 90 TYR TYR A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 ASP 93 93 93 ASP ASP A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 TYR 96 96 96 TYR TYR A . n A 1 97 SER 97 97 97 SER SER A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 TYR 100 100 100 TYR TYR A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 ARG 103 103 103 ARG ARG A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 LYS 105 105 105 LYS LYS A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 HIS 108 108 108 HIS HIS A . n A 1 109 GLN 109 109 109 GLN GLN A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-09-12 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 9 _pdbx_validate_close_contact.auth_atom_id_1 OD1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ASP _pdbx_validate_close_contact.auth_seq_id_1 93 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 HG1 _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 THR _pdbx_validate_close_contact.auth_seq_id_2 95 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.60 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 4 _pdbx_validate_rmsd_angle.auth_atom_id_1 NE _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ARG _pdbx_validate_rmsd_angle.auth_seq_id_1 21 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CZ _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ARG _pdbx_validate_rmsd_angle.auth_seq_id_2 21 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 NH1 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ARG _pdbx_validate_rmsd_angle.auth_seq_id_3 21 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 123.42 _pdbx_validate_rmsd_angle.angle_target_value 120.30 _pdbx_validate_rmsd_angle.angle_deviation 3.12 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.50 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 55 ? ? -148.71 25.61 2 1 ASP A 91 ? ? -152.15 71.55 3 1 LEU A 107 ? ? -67.66 88.59 4 2 ASN A 55 ? ? -144.72 23.40 5 2 ASP A 91 ? ? -150.17 71.05 6 3 ASN A 55 ? ? -144.45 22.29 7 3 ASP A 91 ? ? -151.53 72.56 8 3 GLU A 106 ? ? -76.23 21.19 9 4 THR A 6 ? ? -115.99 77.12 10 4 ASN A 55 ? ? -144.04 23.12 11 4 GLU A 106 ? ? -92.32 30.29 12 4 HIS A 108 ? ? -69.97 53.79 13 5 ASN A 55 ? ? -144.98 23.17 14 5 ASP A 91 ? ? -150.17 76.54 15 5 LYS A 105 ? ? 36.86 47.49 16 6 ASN A 55 ? ? -145.00 24.51 17 6 ASP A 91 ? ? -152.37 74.47 18 6 GLU A 104 ? ? -124.35 -55.27 19 6 HIS A 108 ? ? -141.82 29.77 20 7 TYR A 4 ? ? -112.56 55.98 21 7 THR A 6 ? ? -79.97 28.18 22 7 ASN A 55 ? ? -144.23 22.57 23 7 ASP A 91 ? ? -150.71 73.23 24 7 LYS A 105 ? ? 49.07 26.56 25 7 GLU A 106 ? ? -75.81 38.18 26 8 LYS A 7 ? ? -59.44 107.40 27 8 GLU A 35 ? ? 45.58 2.96 28 8 ASN A 55 ? ? -146.75 22.37 29 8 ASP A 91 ? ? -157.12 65.33 30 8 LEU A 107 ? ? -62.43 94.01 31 9 ASN A 55 ? ? -144.86 22.85 32 9 ASP A 91 ? ? -153.88 74.91 33 9 LYS A 105 ? ? 32.64 52.15 34 9 HIS A 108 ? ? -59.32 109.44 35 10 ASN A 55 ? ? -142.34 24.94 36 10 ASP A 91 ? ? -151.33 69.53 37 10 GLU A 104 ? ? -132.65 -31.28 38 10 LYS A 105 ? ? 35.82 36.15 39 10 LEU A 107 ? ? -67.96 71.78 40 11 TYR A 4 ? ? -153.03 41.07 41 11 ASN A 55 ? ? -146.62 25.18 42 11 ASP A 91 ? ? -150.01 73.17 43 12 GLU A 2 ? ? -150.20 55.94 44 12 ASN A 55 ? ? -147.01 22.96 45 12 ASP A 91 ? ? -150.57 74.50 46 12 GLU A 104 ? ? -127.90 -55.84 47 12 GLU A 106 ? ? -76.12 47.15 48 13 THR A 6 ? ? -119.70 78.02 49 13 ASN A 55 ? ? -141.11 23.11 50 13 ASP A 91 ? ? -150.97 77.95 51 13 LYS A 105 ? ? 35.44 46.93 52 14 THR A 6 ? ? -78.31 30.93 53 14 ASN A 55 ? ? -145.74 24.94 54 14 ASP A 91 ? ? -153.02 74.38 55 14 HIS A 108 ? ? -144.48 14.12 56 15 THR A 6 ? ? -75.29 30.19 57 15 ASN A 55 ? ? -148.38 24.42 58 16 ASN A 55 ? ? -145.87 24.10 59 16 ASP A 91 ? ? -154.88 67.33 60 16 GLU A 106 ? ? -80.32 49.03 61 17 ASN A 55 ? ? -142.67 23.07 62 17 LYS A 105 ? ? 38.86 36.54 63 17 GLU A 106 ? ? -77.61 37.80 64 18 ASN A 55 ? ? -145.76 24.21 65 18 ASP A 91 ? ? -152.54 74.18 66 18 LYS A 105 ? ? 36.47 35.00 67 19 ASN A 55 ? ? -143.38 21.52 68 19 TYR A 100 ? ? -140.82 -22.52 69 20 ASN A 55 ? ? -146.87 26.37 70 20 ASP A 91 ? ? -156.05 66.06 #