data_2GWP # _entry.id 2GWP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.350 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2GWP pdb_00002gwp 10.2210/pdb2gwp/pdb RCSB RCSB037641 ? ? WWPDB D_1000037641 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 2GW9 _pdbx_database_related.details 'Structure of the native Cryptdin4 peptide' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2GWP _pdbx_database_status.recvd_initial_deposition_date 2006-05-05 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Rosengren, K.J.' 1 'Craik, D.J.' 2 'Vogel, H.J.' 3 'Daly, N.L.' 4 'Ouellette, A.J.' 5 # _citation.id primary _citation.title ;Structural and functional characterization of the conserved salt bridge in mammalian paneth cell alpha-defensins: solution structures of mouse CRYPTDIN-4 and (E15D)-CRYPTDIN-4. ; _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 281 _citation.page_first 28068 _citation.page_last 28078 _citation.year 2006 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16857681 _citation.pdbx_database_id_DOI 10.1074/jbc.M604992200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Rosengren, K.J.' 1 ? primary 'Daly, N.L.' 2 ? primary 'Fornander, L.M.' 3 ? primary 'Shirafuji, Y.' 4 ? primary 'Qu, X.' 5 ? primary 'Vogel, H.J.' 6 ? primary 'Ouellette, A.J.' 7 ? primary 'Craik, D.J.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Defensin-related cryptdin 4' _entity.formula_weight 3757.583 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation E15D _entity.pdbx_fragment Cryptdin4 _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GLLCYCRKGHCKRGDRVRGTCGIRFLYCCPRR _entity_poly.pdbx_seq_one_letter_code_can GLLCYCRKGHCKRGDRVRGTCGIRFLYCCPRR _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 LEU n 1 3 LEU n 1 4 CYS n 1 5 TYR n 1 6 CYS n 1 7 ARG n 1 8 LYS n 1 9 GLY n 1 10 HIS n 1 11 CYS n 1 12 LYS n 1 13 ARG n 1 14 GLY n 1 15 ASP n 1 16 ARG n 1 17 VAL n 1 18 ARG n 1 19 GLY n 1 20 THR n 1 21 CYS n 1 22 GLY n 1 23 ILE n 1 24 ARG n 1 25 PHE n 1 26 LEU n 1 27 TYR n 1 28 CYS n 1 29 CYS n 1 30 PRO n 1 31 ARG n 1 32 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus Mus _entity_src_gen.pdbx_gene_src_gene Defcr4 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)-CODON-PLUS-RIL' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET-28A _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DEF4_MOUSE _struct_ref.pdbx_db_accession P28311 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GLLCYCRKGHCKRGERVRGTCGIRFLYCCPRR _struct_ref.pdbx_align_begin 61 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2GWP _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 32 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P28311 _struct_ref_seq.db_align_beg 61 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 92 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 32 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2GWP _struct_ref_seq_dif.mon_id ASP _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 15 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P28311 _struct_ref_seq_dif.db_mon_id GLU _struct_ref_seq_dif.pdbx_seq_db_seq_num 75 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 15 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 3 '2D NOESY' 1 2 3 '2D TOCSY' 1 3 3 DQF-COSY 1 4 3 '2D NOESY' 2 5 3 '2D TOCSY' 2 # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature_units 1 288 ambient 5.1 0 . K 2 293 ambient 5.1 0 . K 3 298 ambient 5.1 0 . K 4 303 ambient 5.1 0 . K 5 308 ambient 5.1 0 . K # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '0.6 mg (E15D)-Cryptdin4 / 0.5ml; 90% H2O / 10% D2O' '90% H2O/10% D2O' 2 ;0.6 mg (E15D)-Cryptdin4 / 0.5ml; 100% D2O ; '100% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2GWP _pdbx_nmr_refine.method ;Structure was calculated using torsion angle dynamics followed by refinement in explicit solvent using Cartesian dynamics within CNS. ; _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2GWP _pdbx_nmr_details.text 'This structure was determined using standard 2D homonuclear techniques.' # _pdbx_nmr_ensemble.entry_id 2GWP _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations,structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2GWP _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 1.3.5 Bruker 1 'data analysis' CARA 1.0 'Wuthrich, K. et al.' 2 'structure solution' CYANA 2.0 'Hermann, T. et al.' 3 refinement CNS 1.0 'Brunger, A.T. et al.' 4 # _exptl.entry_id 2GWP _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 2GWP _struct.title 'High-resolution solution structure of the salt-bridge defficient mouse defensin (E15D)-Cryptdin4' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2GWP _struct_keywords.pdbx_keywords ANTIBIOTIC _struct_keywords.text 'triple stranded beta sheet, beta hairpin, ANTIBIOTIC' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 4 SG ? ? ? 1_555 A CYS 29 SG ? ? A CYS 4 A CYS 29 1_555 ? ? ? ? ? ? ? 2.029 ? ? disulf2 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 21 SG ? ? A CYS 6 A CYS 21 1_555 ? ? ? ? ? ? ? 2.028 ? ? disulf3 disulf ? ? A CYS 11 SG ? ? ? 1_555 A CYS 28 SG ? ? A CYS 11 A CYS 28 1_555 ? ? ? ? ? ? ? 2.026 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 5 ? LYS A 8 ? TYR A 5 LYS A 8 A 2 PHE A 25 ? CYS A 29 ? PHE A 25 CYS A 29 A 3 ARG A 16 ? GLY A 22 ? ARG A 16 GLY A 22 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ARG A 7 ? N ARG A 7 O LEU A 26 ? O LEU A 26 A 2 3 O TYR A 27 ? O TYR A 27 N ARG A 18 ? N ARG A 18 # _database_PDB_matrix.entry_id 2GWP _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2GWP _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 LEU 2 2 2 LEU LEU A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 CYS 4 4 4 CYS CYS A . n A 1 5 TYR 5 5 5 TYR TYR A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 ARG 7 7 7 ARG ARG A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 HIS 10 10 10 HIS HIS A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 ARG 32 32 32 ARG ARG A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-07-25 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2021-10-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 H3 A GLY 1 ? ? O A ARG 32 ? ? 1.56 2 1 HH A TYR 5 ? ? OD2 A ASP 15 ? ? 1.58 3 3 HZ3 A LYS 12 ? ? OD1 A ASP 15 ? ? 1.59 4 4 H2 A GLY 1 ? ? O A ARG 32 ? ? 1.53 5 4 HH A TYR 5 ? ? OD2 A ASP 15 ? ? 1.58 6 5 HZ2 A LYS 12 ? ? O A ARG 32 ? ? 1.58 7 6 HZ2 A LYS 12 ? ? OXT A ARG 32 ? ? 1.57 8 7 HA A ASP 15 ? ? HA A PRO 30 ? ? 1.29 9 8 HZ3 A LYS 12 ? ? O A ARG 32 ? ? 1.53 10 9 HH A TYR 5 ? ? OD2 A ASP 15 ? ? 1.58 11 9 HZ2 A LYS 12 ? ? OD1 A ASP 15 ? ? 1.59 12 10 HZ1 A LYS 12 ? ? OD2 A ASP 15 ? ? 1.57 13 11 OD1 A ASP 15 ? ? HH21 A ARG 32 ? ? 1.58 14 12 HZ2 A LYS 12 ? ? OD1 A ASP 15 ? ? 1.55 15 13 HZ1 A LYS 12 ? ? OD2 A ASP 15 ? ? 1.59 16 14 HZ1 A LYS 12 ? ? O A ARG 32 ? ? 1.54 17 15 HZ2 A LYS 12 ? ? OXT A ARG 32 ? ? 1.53 18 15 HH A TYR 5 ? ? OD2 A ASP 15 ? ? 1.59 19 20 HZ2 A LYS 12 ? ? O A ARG 32 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 10 ? ? 178.83 177.58 2 1 ARG A 13 ? ? -69.83 76.32 3 2 LEU A 2 ? ? -177.73 -49.53 4 2 HIS A 10 ? ? -177.17 -179.68 5 2 ILE A 23 ? ? -59.72 85.39 6 2 ARG A 24 ? ? 72.88 31.03 7 3 LEU A 2 ? ? -167.02 -52.60 8 3 HIS A 10 ? ? 179.30 174.41 9 3 ILE A 23 ? ? -57.89 95.96 10 4 ASP A 15 ? ? -78.61 -168.92 11 4 ILE A 23 ? ? -60.55 85.35 12 4 ARG A 31 ? ? -87.51 35.86 13 5 ILE A 23 ? ? -61.54 96.26 14 6 LEU A 3 ? ? -158.19 45.47 15 6 ARG A 13 ? ? -52.82 107.26 16 6 ILE A 23 ? ? -62.12 93.93 17 7 ILE A 23 ? ? -61.62 91.91 18 8 LEU A 2 ? ? -79.68 -122.43 19 8 HIS A 10 ? ? 179.93 161.32 20 9 LEU A 3 ? ? -151.88 45.36 21 9 ARG A 13 ? ? -59.03 101.56 22 9 ILE A 23 ? ? -53.30 91.32 23 10 HIS A 10 ? ? 179.84 170.74 24 10 ILE A 23 ? ? -61.20 95.82 25 10 ARG A 31 ? ? -103.77 -61.82 26 11 ARG A 13 ? ? -55.94 105.82 27 11 ILE A 23 ? ? -61.32 88.91 28 12 ILE A 23 ? ? -62.26 91.41 29 13 LEU A 3 ? ? -147.76 38.48 30 13 CYS A 21 ? ? -147.17 -49.58 31 13 ILE A 23 ? ? -62.32 93.81 32 13 ARG A 24 ? ? 71.58 34.13 33 13 ARG A 31 ? ? -170.16 -31.70 34 14 HIS A 10 ? ? 179.11 174.44 35 14 ARG A 13 ? ? -67.93 83.46 36 14 ILE A 23 ? ? -60.57 93.44 37 14 ARG A 31 ? ? -134.50 -33.91 38 15 HIS A 10 ? ? -179.87 -179.61 39 15 ARG A 13 ? ? -59.97 98.69 40 15 ASP A 15 ? ? -73.40 -165.01 41 15 ILE A 23 ? ? -60.43 93.42 42 16 ARG A 13 ? ? -61.08 96.09 43 16 ILE A 23 ? ? -63.24 97.96 44 16 ARG A 31 ? ? -59.45 -72.96 45 17 ARG A 13 ? ? -64.43 90.56 46 17 ILE A 23 ? ? -60.90 97.31 47 17 ARG A 24 ? ? 71.48 33.21 48 18 ARG A 13 ? ? -67.33 79.86 49 18 ILE A 23 ? ? -55.51 97.78 50 19 HIS A 10 ? ? 179.30 164.47 51 19 ARG A 13 ? ? -63.06 92.19 52 19 ILE A 23 ? ? -53.61 87.86 53 20 ARG A 13 ? ? -59.78 109.74 54 20 ARG A 24 ? ? 70.10 31.15 55 20 ARG A 31 ? ? -148.67 19.65 #