data_2HDL # _entry.id 2HDL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2HDL pdb_00002hdl 10.2210/pdb2hdl/pdb RCSB RCSB038228 ? ? WWPDB D_1000038228 ? ? BMRB 7229 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.db_id 7229 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2HDL _pdbx_database_status.recvd_initial_deposition_date 2006-06-20 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Peterson, F.C.' 1 'Thorpe, J.A.' 2 'Harder, A.G.' 3 'Volkman, B.F.' 4 'Schwarze, S.R.' 5 # _citation.id primary _citation.title 'Structural Determinants Involved in the Regulation of CXCL14/BRAK Expression by the 26 S Proteasome.' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 363 _citation.page_first 813 _citation.page_last 822 _citation.year 2006 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 16987528 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2006.08.057 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Peterson, F.C.' 1 ? primary 'Thorpe, J.A.' 2 ? primary 'Harder, A.G.' 3 ? primary 'Volkman, B.F.' 4 ? primary 'Schwarze, S.R.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Small inducible cytokine B14' _entity.formula_weight 9500.201 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'CXCL14, Chemokine BRAK' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE _entity_poly.pdbx_seq_one_letter_code_can GSKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 LYS n 1 4 CYS n 1 5 LYS n 1 6 CYS n 1 7 SER n 1 8 ARG n 1 9 LYS n 1 10 GLY n 1 11 PRO n 1 12 LYS n 1 13 ILE n 1 14 ARG n 1 15 TYR n 1 16 SER n 1 17 ASP n 1 18 VAL n 1 19 LYS n 1 20 LYS n 1 21 LEU n 1 22 GLU n 1 23 MET n 1 24 LYS n 1 25 PRO n 1 26 LYS n 1 27 TYR n 1 28 PRO n 1 29 HIS n 1 30 CYS n 1 31 GLU n 1 32 GLU n 1 33 LYS n 1 34 MET n 1 35 VAL n 1 36 ILE n 1 37 ILE n 1 38 THR n 1 39 THR n 1 40 LYS n 1 41 SER n 1 42 VAL n 1 43 SER n 1 44 ARG n 1 45 TYR n 1 46 ARG n 1 47 GLY n 1 48 GLN n 1 49 GLU n 1 50 HIS n 1 51 CYS n 1 52 LEU n 1 53 HIS n 1 54 PRO n 1 55 LYS n 1 56 LEU n 1 57 GLN n 1 58 SER n 1 59 THR n 1 60 LYS n 1 61 ARG n 1 62 PHE n 1 63 ILE n 1 64 LYS n 1 65 TRP n 1 66 TYR n 1 67 ASN n 1 68 ALA n 1 69 TRP n 1 70 ASN n 1 71 GLU n 1 72 LYS n 1 73 ARG n 1 74 ARG n 1 75 VAL n 1 76 TYR n 1 77 GLU n 1 78 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'CXCL14, NJAC, SCYB14' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'SG13009[pREP4]' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pQE308HT _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SCYBE_HUMAN _struct_ref.pdbx_db_accession O95715 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE _struct_ref.pdbx_align_begin 23 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2HDL _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 78 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O95715 _struct_ref_seq.db_align_beg 23 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 99 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 77 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2HDL _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code O95715 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'cloning artifact' _struct_ref_seq_dif.pdbx_auth_seq_num 0 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 3 1 '3D_13C-separated_NOESY (AROMATIC)' 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength '300 mM' _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1 mM CXCL14 U-15N, 13C; 100mM phosphate buffer, 150mM NaCl,95% H2O, 5% D2O' _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2HDL _pdbx_nmr_refine.method ;AUTOMATED METHODS WERE USED FOR BACKBONE CHEMICAL SHIFT ASSIGNMENT AND ITERATIVE NOE REFINEMENT. FINAL STRUCTURES WERE OBTAINED BY MOLECULAR DYNAMICS IN EXPLICIT SOLVEN ; _pdbx_nmr_refine.details ;STRUCTURES ARE BASED ON A TOTAL OF 894 NOE CONSTRAINTS ( 366 INTRA, 186 SEQUENTIAL, 133 MEDIUM and 209 LONG RANGE CONSTRAINTS) AND 97 PHI AND PSI DIHEDRAL ANGLE CONSTRAINTS. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2HDL _pdbx_nmr_details.text 'ALL TRIPLE-RESONANCE AND NOESY SPECTRA WERE ACQUIRED USING A CRYOGENIC PROBE' # _pdbx_nmr_ensemble.entry_id 2HDL _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2HDL _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 ? 1 processing NMRPipe 2004 'Delaglio, F., Grzesiek, S., Vuister, G.W., Zhu, G., Pfeifer, J., Bax, A.' 2 'data analysis' SPSCAN 1.1.0 'Glaser, R.W.' 3 'data analysis' XEASY 1.3 'Bartels, C, Xia, T.-H., Billeter, M., Guntert, P., Wuthrich, K.' 4 'data analysis' GARANT 2.1 'Bartels, C., Billeter, M., Guntert, P., Wuthrich, K.' 5 'structure solution' CYANA 2.1 'Herrmann, T., Guntert, P., Wuthrich, K.' 6 refinement XPLOR-NIH 2.9.3 'Schwieters, C.D., Kuszewski, J.J, Tjandra, N., Clore, G.M.' 7 # _exptl.entry_id 2HDL _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 2HDL _struct.title 'Solution structure of Brak/CXCL14' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2HDL _struct_keywords.pdbx_keywords CYTOKINE _struct_keywords.text 'CXCL14, Brak, chemokine, CYTOKINE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ARG A 14 ? SER A 16 ? ARG A 13 SER A 15 5 ? 3 HELX_P HELX_P2 2 LEU A 56 ? ARG A 74 ? LEU A 55 ARG A 73 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 4 SG ? ? ? 1_555 A CYS 30 SG ? ? A CYS 3 A CYS 29 1_555 ? ? ? ? ? ? ? 2.035 ? ? disulf2 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 51 SG ? ? A CYS 5 A CYS 50 1_555 ? ? ? ? ? ? ? 2.037 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 18 ? MET A 23 ? VAL A 17 MET A 22 A 2 VAL A 35 ? THR A 39 ? VAL A 34 THR A 38 A 3 GLU A 49 ? LEU A 52 ? GLU A 48 LEU A 51 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLU A 22 ? N GLU A 21 O ILE A 36 ? O ILE A 35 A 2 3 N ILE A 37 ? N ILE A 36 O HIS A 50 ? O HIS A 49 # _database_PDB_matrix.entry_id 2HDL _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2HDL _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 0 ? ? ? A . n A 1 2 SER 2 1 1 SER SER A . n A 1 3 LYS 3 2 2 LYS LYS A . n A 1 4 CYS 4 3 3 CYS CYS A . n A 1 5 LYS 5 4 4 LYS LYS A . n A 1 6 CYS 6 5 5 CYS CYS A . n A 1 7 SER 7 6 6 SER SER A . n A 1 8 ARG 8 7 7 ARG ARG A . n A 1 9 LYS 9 8 8 LYS LYS A . n A 1 10 GLY 10 9 9 GLY GLY A . n A 1 11 PRO 11 10 10 PRO PRO A . n A 1 12 LYS 12 11 11 LYS LYS A . n A 1 13 ILE 13 12 12 ILE ILE A . n A 1 14 ARG 14 13 13 ARG ARG A . n A 1 15 TYR 15 14 14 TYR TYR A . n A 1 16 SER 16 15 15 SER SER A . n A 1 17 ASP 17 16 16 ASP ASP A . n A 1 18 VAL 18 17 17 VAL VAL A . n A 1 19 LYS 19 18 18 LYS LYS A . n A 1 20 LYS 20 19 19 LYS LYS A . n A 1 21 LEU 21 20 20 LEU LEU A . n A 1 22 GLU 22 21 21 GLU GLU A . n A 1 23 MET 23 22 22 MET MET A . n A 1 24 LYS 24 23 23 LYS LYS A . n A 1 25 PRO 25 24 24 PRO PRO A . n A 1 26 LYS 26 25 25 LYS LYS A . n A 1 27 TYR 27 26 26 TYR TYR A . n A 1 28 PRO 28 27 27 PRO PRO A . n A 1 29 HIS 29 28 28 HIS HIS A . n A 1 30 CYS 30 29 29 CYS CYS A . n A 1 31 GLU 31 30 30 GLU GLU A . n A 1 32 GLU 32 31 31 GLU GLU A . n A 1 33 LYS 33 32 32 LYS LYS A . n A 1 34 MET 34 33 33 MET MET A . n A 1 35 VAL 35 34 34 VAL VAL A . n A 1 36 ILE 36 35 35 ILE ILE A . n A 1 37 ILE 37 36 36 ILE ILE A . n A 1 38 THR 38 37 37 THR THR A . n A 1 39 THR 39 38 38 THR THR A . n A 1 40 LYS 40 39 39 LYS LYS A . n A 1 41 SER 41 40 40 SER SER A . n A 1 42 VAL 42 41 41 VAL VAL A . n A 1 43 SER 43 42 42 SER SER A . n A 1 44 ARG 44 43 43 ARG ARG A . n A 1 45 TYR 45 44 44 TYR TYR A . n A 1 46 ARG 46 45 45 ARG ARG A . n A 1 47 GLY 47 46 46 GLY GLY A . n A 1 48 GLN 48 47 47 GLN GLN A . n A 1 49 GLU 49 48 48 GLU GLU A . n A 1 50 HIS 50 49 49 HIS HIS A . n A 1 51 CYS 51 50 50 CYS CYS A . n A 1 52 LEU 52 51 51 LEU LEU A . n A 1 53 HIS 53 52 52 HIS HIS A . n A 1 54 PRO 54 53 53 PRO PRO A . n A 1 55 LYS 55 54 54 LYS LYS A . n A 1 56 LEU 56 55 55 LEU LEU A . n A 1 57 GLN 57 56 56 GLN GLN A . n A 1 58 SER 58 57 57 SER SER A . n A 1 59 THR 59 58 58 THR THR A . n A 1 60 LYS 60 59 59 LYS LYS A . n A 1 61 ARG 61 60 60 ARG ARG A . n A 1 62 PHE 62 61 61 PHE PHE A . n A 1 63 ILE 63 62 62 ILE ILE A . n A 1 64 LYS 64 63 63 LYS LYS A . n A 1 65 TRP 65 64 64 TRP TRP A . n A 1 66 TYR 66 65 65 TYR TYR A . n A 1 67 ASN 67 66 66 ASN ASN A . n A 1 68 ALA 68 67 67 ALA ALA A . n A 1 69 TRP 69 68 68 TRP TRP A . n A 1 70 ASN 70 69 69 ASN ASN A . n A 1 71 GLU 71 70 70 GLU GLU A . n A 1 72 LYS 72 71 71 LYS LYS A . n A 1 73 ARG 73 72 72 ARG ARG A . n A 1 74 ARG 74 73 73 ARG ARG A . n A 1 75 VAL 75 74 74 VAL VAL A . n A 1 76 TYR 76 75 75 TYR TYR A . n A 1 77 GLU 77 76 76 GLU GLU A . n A 1 78 GLU 78 77 77 GLU GLU A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-10-24 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2020-02-26 5 'Structure model' 1 4 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' Other 7 5 'Structure model' 'Database references' 8 5 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_software 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif 7 5 'Structure model' database_2 8 5 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_database_status.status_code_cs' 2 4 'Structure model' '_pdbx_nmr_software.name' 3 4 'Structure model' '_struct_ref_seq_dif.details' 4 5 'Structure model' '_database_2.pdbx_DOI' 5 5 'Structure model' '_database_2.pdbx_database_accession' 6 5 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE1 A GLU 31 ? ? HZ2 A LYS 54 ? ? 1.59 2 4 OE1 A GLU 30 ? ? HZ1 A LYS 54 ? ? 1.56 3 5 HZ1 A LYS 71 ? ? OE1 A GLU 76 ? ? 1.57 4 11 O A LYS 39 ? ? HG A SER 40 ? ? 1.56 5 12 O A LYS 39 ? ? HG A SER 40 ? ? 1.59 6 17 O A LYS 39 ? ? HG A SER 40 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 6 ? ? 66.60 -83.72 2 1 ARG A 7 ? ? -144.17 -61.40 3 1 GLU A 31 ? ? 64.29 178.04 4 1 SER A 40 ? ? 177.20 -72.13 5 1 ARG A 45 ? ? -35.57 121.22 6 1 PRO A 53 ? ? -66.22 8.35 7 1 VAL A 74 ? ? 77.68 84.18 8 2 LYS A 2 ? ? -147.27 26.43 9 2 CYS A 5 ? ? -127.89 -65.44 10 2 GLU A 31 ? ? 53.07 -163.83 11 2 SER A 40 ? ? 169.65 -170.32 12 2 VAL A 41 ? ? 72.58 -35.43 13 3 LYS A 4 ? ? 58.56 -168.84 14 3 ARG A 7 ? ? -121.59 -61.80 15 3 GLU A 31 ? ? 68.82 175.51 16 3 SER A 40 ? ? 163.60 -30.75 17 3 PRO A 53 ? ? -67.51 0.39 18 3 VAL A 74 ? ? 85.70 103.32 19 4 SER A 6 ? ? 70.97 -64.88 20 4 ARG A 7 ? ? -175.78 -54.74 21 4 GLU A 31 ? ? 72.84 177.61 22 4 SER A 40 ? ? -179.26 -52.53 23 5 SER A 6 ? ? 175.82 157.93 24 5 LYS A 8 ? ? -136.01 -55.44 25 5 GLU A 31 ? ? 58.14 -171.36 26 5 SER A 40 ? ? 168.46 -42.19 27 6 CYS A 3 ? ? 71.25 106.47 28 6 LYS A 4 ? ? -95.26 -79.23 29 6 CYS A 5 ? ? 59.81 -87.22 30 6 LYS A 25 ? ? 72.33 -44.22 31 6 GLU A 31 ? ? 70.17 176.00 32 6 SER A 40 ? ? 173.05 -70.02 33 6 VAL A 41 ? ? 30.84 -70.81 34 6 PRO A 53 ? ? -67.44 9.82 35 7 LYS A 4 ? ? -141.40 -3.01 36 7 CYS A 5 ? ? 69.34 149.69 37 7 SER A 6 ? ? -60.54 -80.16 38 7 ARG A 7 ? ? -135.71 -78.88 39 7 LYS A 8 ? ? -144.59 -10.35 40 7 LYS A 25 ? ? 71.01 -55.91 41 7 GLU A 31 ? ? 54.27 -162.51 42 7 SER A 40 ? ? 164.31 -36.04 43 8 LYS A 4 ? ? -169.59 92.51 44 8 CYS A 5 ? ? -165.56 32.05 45 8 HIS A 28 ? ? -87.27 30.35 46 8 GLU A 31 ? ? 55.96 -176.03 47 8 SER A 40 ? ? 167.19 -38.25 48 8 ARG A 45 ? ? 60.15 88.35 49 8 PRO A 53 ? ? -68.01 16.39 50 8 ARG A 73 ? ? -168.16 70.71 51 8 TYR A 75 ? ? 53.51 80.40 52 8 GLU A 76 ? ? 179.87 148.25 53 9 LYS A 4 ? ? 72.79 131.24 54 9 ARG A 7 ? ? 65.98 -66.10 55 9 LYS A 8 ? ? -132.08 -47.36 56 9 LYS A 25 ? ? 72.42 -46.80 57 9 GLU A 31 ? ? 62.14 179.81 58 9 SER A 40 ? ? 168.46 -163.29 59 9 VAL A 41 ? ? 70.39 -58.31 60 9 ARG A 45 ? ? 49.96 81.99 61 9 VAL A 74 ? ? 78.60 144.37 62 10 LYS A 2 ? ? 68.39 -1.35 63 10 CYS A 3 ? ? 65.29 85.58 64 10 LYS A 4 ? ? -143.97 12.68 65 10 CYS A 5 ? ? 70.71 -65.99 66 10 SER A 6 ? ? -161.00 -60.31 67 10 ARG A 7 ? ? -155.89 83.96 68 10 LYS A 8 ? ? 60.57 -171.38 69 10 HIS A 28 ? ? -92.61 30.26 70 10 GLU A 31 ? ? 50.13 -160.58 71 10 SER A 40 ? ? -175.33 -45.70 72 10 ARG A 45 ? ? 59.23 89.85 73 10 PRO A 53 ? ? -60.94 2.57 74 10 GLU A 76 ? ? -137.84 -79.58 75 11 LYS A 4 ? ? 74.84 162.45 76 11 CYS A 5 ? ? 70.77 -64.29 77 11 SER A 6 ? ? 63.89 -78.59 78 11 ARG A 7 ? ? -158.86 10.28 79 11 LYS A 25 ? ? 71.65 -48.51 80 11 GLU A 31 ? ? 65.31 -177.63 81 11 SER A 40 ? ? 170.14 -74.09 82 11 ARG A 45 ? ? 66.40 82.72 83 11 PRO A 53 ? ? -65.23 11.99 84 11 VAL A 74 ? ? 67.64 68.85 85 11 GLU A 76 ? ? 67.70 123.60 86 12 CYS A 3 ? ? 74.15 154.96 87 12 ARG A 7 ? ? -163.62 80.63 88 12 LYS A 25 ? ? 68.62 -61.77 89 12 GLU A 31 ? ? 58.09 175.07 90 12 SER A 40 ? ? -170.45 -79.36 91 12 ARG A 45 ? ? 50.66 92.95 92 12 VAL A 74 ? ? 63.65 -81.54 93 13 CYS A 5 ? ? 82.26 128.37 94 13 GLU A 31 ? ? 63.73 175.17 95 13 SER A 40 ? ? 166.09 -21.46 96 13 ARG A 45 ? ? 53.21 82.37 97 13 PRO A 53 ? ? -69.73 4.11 98 13 VAL A 74 ? ? -28.88 106.88 99 13 GLU A 76 ? ? 70.16 115.08 100 14 CYS A 5 ? ? 75.81 -54.18 101 14 GLU A 31 ? ? 63.66 -172.37 102 14 SER A 40 ? ? 174.61 -30.73 103 14 ARG A 45 ? ? 55.56 83.40 104 14 PRO A 53 ? ? -65.54 7.17 105 15 CYS A 3 ? ? 66.33 -52.47 106 15 LYS A 8 ? ? -136.52 -39.97 107 15 GLU A 31 ? ? 54.97 -175.95 108 15 SER A 40 ? ? 153.50 -63.24 109 16 CYS A 3 ? ? 65.66 95.70 110 16 GLU A 31 ? ? 54.50 -169.40 111 16 SER A 40 ? ? 80.52 -32.87 112 16 PRO A 53 ? ? -68.80 1.25 113 16 VAL A 74 ? ? 66.41 69.83 114 17 LYS A 2 ? ? -121.82 -155.97 115 17 ARG A 7 ? ? -140.67 -80.24 116 17 LYS A 8 ? ? -179.41 -58.65 117 17 GLU A 31 ? ? 74.55 151.06 118 17 SER A 40 ? ? -177.06 -75.56 119 17 ARG A 45 ? ? 34.95 92.37 120 18 CYS A 3 ? ? -172.14 137.73 121 18 LYS A 8 ? ? 67.38 155.25 122 18 GLU A 31 ? ? 63.13 179.70 123 18 SER A 40 ? ? -169.88 -89.40 124 18 VAL A 41 ? ? 42.54 -77.73 125 19 SER A 6 ? ? -95.60 -72.91 126 19 GLU A 31 ? ? 57.57 -161.83 127 19 SER A 40 ? ? 87.45 -175.68 128 19 VAL A 41 ? ? 59.69 14.23 129 19 GLU A 76 ? ? 70.77 157.35 130 20 CYS A 5 ? ? 174.20 -66.19 131 20 SER A 6 ? ? 61.32 -69.63 132 20 ARG A 7 ? ? -156.79 85.09 133 20 HIS A 28 ? ? -93.20 36.67 134 20 GLU A 31 ? ? 52.10 -159.94 135 20 SER A 40 ? ? -169.58 -66.01 136 20 ARG A 73 ? ? -123.73 -54.96 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 0 ? A GLY 1 2 2 Y 1 A GLY 0 ? A GLY 1 3 3 Y 1 A GLY 0 ? A GLY 1 4 4 Y 1 A GLY 0 ? A GLY 1 5 5 Y 1 A GLY 0 ? A GLY 1 6 6 Y 1 A GLY 0 ? A GLY 1 7 7 Y 1 A GLY 0 ? A GLY 1 8 8 Y 1 A GLY 0 ? A GLY 1 9 9 Y 1 A GLY 0 ? A GLY 1 10 10 Y 1 A GLY 0 ? A GLY 1 11 11 Y 1 A GLY 0 ? A GLY 1 12 12 Y 1 A GLY 0 ? A GLY 1 13 13 Y 1 A GLY 0 ? A GLY 1 14 14 Y 1 A GLY 0 ? A GLY 1 15 15 Y 1 A GLY 0 ? A GLY 1 16 16 Y 1 A GLY 0 ? A GLY 1 17 17 Y 1 A GLY 0 ? A GLY 1 18 18 Y 1 A GLY 0 ? A GLY 1 19 19 Y 1 A GLY 0 ? A GLY 1 20 20 Y 1 A GLY 0 ? A GLY 1 #