data_2HFQ # _entry.id 2HFQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2HFQ pdb_00002hfq 10.2210/pdb2hfq/pdb RCSB RCSB038295 ? ? WWPDB D_1000038295 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-09-19 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 5 'Structure model' 1 4 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' struct_ref_seq_dif 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2HFQ _pdbx_database_status.recvd_initial_deposition_date 2006-06-25 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id NeT5 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Cort, J.R.' 1 'Yee, A.A.' 2 'Yim, V.' 3 'Lukin, J.' 4 'Kennedy, M.A.' 5 'Northeast Structural Genomics Consortium (NESG)' 6 # _citation.id primary _citation.title 'NMR structure of protein NE1680 from Nitrosomonas europaea: Northeast Structural Genomics Consortium target NeT5' _citation.journal_abbrev 'TO BE PUBLISHED' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Cort, J.R.' 1 ? primary 'Kennedy, M.A.' 2 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Hypothetical protein' _entity.formula_weight 12537.901 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGRENLYFQGHMQIHVYDTYVKAKDGHVMHFDVFTDVRDDKKAIEFAKQWLSSIGEEGATVTSEECRFC HSEKAPDEVIEAIKQNGYFIYKMEGCNGS ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGRENLYFQGHMQIHVYDTYVKAKDGHVMHFDVFTDVRDDKKAIEFAKQWLSSIGEEGATVTSEECRFC HSEKAPDEVIEAIKQNGYFIYKMEGCNGS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier NeT5 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 ARG n 1 15 GLU n 1 16 ASN n 1 17 LEU n 1 18 TYR n 1 19 PHE n 1 20 GLN n 1 21 GLY n 1 22 HIS n 1 23 MET n 1 24 GLN n 1 25 ILE n 1 26 HIS n 1 27 VAL n 1 28 TYR n 1 29 ASP n 1 30 THR n 1 31 TYR n 1 32 VAL n 1 33 LYS n 1 34 ALA n 1 35 LYS n 1 36 ASP n 1 37 GLY n 1 38 HIS n 1 39 VAL n 1 40 MET n 1 41 HIS n 1 42 PHE n 1 43 ASP n 1 44 VAL n 1 45 PHE n 1 46 THR n 1 47 ASP n 1 48 VAL n 1 49 ARG n 1 50 ASP n 1 51 ASP n 1 52 LYS n 1 53 LYS n 1 54 ALA n 1 55 ILE n 1 56 GLU n 1 57 PHE n 1 58 ALA n 1 59 LYS n 1 60 GLN n 1 61 TRP n 1 62 LEU n 1 63 SER n 1 64 SER n 1 65 ILE n 1 66 GLY n 1 67 GLU n 1 68 GLU n 1 69 GLY n 1 70 ALA n 1 71 THR n 1 72 VAL n 1 73 THR n 1 74 SER n 1 75 GLU n 1 76 GLU n 1 77 CYS n 1 78 ARG n 1 79 PHE n 1 80 CYS n 1 81 HIS n 1 82 SER n 1 83 GLU n 1 84 LYS n 1 85 ALA n 1 86 PRO n 1 87 ASP n 1 88 GLU n 1 89 VAL n 1 90 ILE n 1 91 GLU n 1 92 ALA n 1 93 ILE n 1 94 LYS n 1 95 GLN n 1 96 ASN n 1 97 GLY n 1 98 TYR n 1 99 PHE n 1 100 ILE n 1 101 TYR n 1 102 LYS n 1 103 MET n 1 104 GLU n 1 105 GLY n 1 106 CYS n 1 107 ASN n 1 108 GLY n 1 109 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Nitrosomonas _entity_src_gen.pdbx_gene_src_gene NE1680 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Nitrosomonas europaea' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 915 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'Novagen BL21(DE3) Gold' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET15b derivative' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -21 ? ? ? A . n A 1 2 GLY 2 -20 ? ? ? A . n A 1 3 SER 3 -19 ? ? ? A . n A 1 4 SER 4 -18 ? ? ? A . n A 1 5 HIS 5 -17 ? ? ? A . n A 1 6 HIS 6 -16 ? ? ? A . n A 1 7 HIS 7 -15 ? ? ? A . n A 1 8 HIS 8 -14 ? ? ? A . n A 1 9 HIS 9 -13 ? ? ? A . n A 1 10 HIS 10 -12 ? ? ? A . n A 1 11 SER 11 -11 ? ? ? A . n A 1 12 SER 12 -10 ? ? ? A . n A 1 13 GLY 13 -9 ? ? ? A . n A 1 14 ARG 14 -8 ? ? ? A . n A 1 15 GLU 15 -7 ? ? ? A . n A 1 16 ASN 16 -6 ? ? ? A . n A 1 17 LEU 17 -5 ? ? ? A . n A 1 18 TYR 18 -4 ? ? ? A . n A 1 19 PHE 19 -3 ? ? ? A . n A 1 20 GLN 20 -2 ? ? ? A . n A 1 21 GLY 21 -1 ? ? ? A . n A 1 22 HIS 22 0 ? ? ? A . n A 1 23 MET 23 1 1 MET MET A . n A 1 24 GLN 24 2 2 GLN GLN A . n A 1 25 ILE 25 3 3 ILE ILE A . n A 1 26 HIS 26 4 4 HIS HIS A . n A 1 27 VAL 27 5 5 VAL VAL A . n A 1 28 TYR 28 6 6 TYR TYR A . n A 1 29 ASP 29 7 7 ASP ASP A . n A 1 30 THR 30 8 8 THR THR A . n A 1 31 TYR 31 9 9 TYR TYR A . n A 1 32 VAL 32 10 10 VAL VAL A . n A 1 33 LYS 33 11 11 LYS LYS A . n A 1 34 ALA 34 12 12 ALA ALA A . n A 1 35 LYS 35 13 13 LYS LYS A . n A 1 36 ASP 36 14 14 ASP ASP A . n A 1 37 GLY 37 15 15 GLY GLY A . n A 1 38 HIS 38 16 16 HIS HIS A . n A 1 39 VAL 39 17 17 VAL VAL A . n A 1 40 MET 40 18 18 MET MET A . n A 1 41 HIS 41 19 19 HIS HIS A . n A 1 42 PHE 42 20 20 PHE PHE A . n A 1 43 ASP 43 21 21 ASP ASP A . n A 1 44 VAL 44 22 22 VAL VAL A . n A 1 45 PHE 45 23 23 PHE PHE A . n A 1 46 THR 46 24 24 THR THR A . n A 1 47 ASP 47 25 25 ASP ASP A . n A 1 48 VAL 48 26 26 VAL VAL A . n A 1 49 ARG 49 27 27 ARG ARG A . n A 1 50 ASP 50 28 28 ASP ASP A . n A 1 51 ASP 51 29 29 ASP ASP A . n A 1 52 LYS 52 30 30 LYS LYS A . n A 1 53 LYS 53 31 31 LYS LYS A . n A 1 54 ALA 54 32 32 ALA ALA A . n A 1 55 ILE 55 33 33 ILE ILE A . n A 1 56 GLU 56 34 34 GLU GLU A . n A 1 57 PHE 57 35 35 PHE PHE A . n A 1 58 ALA 58 36 36 ALA ALA A . n A 1 59 LYS 59 37 37 LYS LYS A . n A 1 60 GLN 60 38 38 GLN GLN A . n A 1 61 TRP 61 39 39 TRP TRP A . n A 1 62 LEU 62 40 40 LEU LEU A . n A 1 63 SER 63 41 41 SER SER A . n A 1 64 SER 64 42 42 SER SER A . n A 1 65 ILE 65 43 43 ILE ILE A . n A 1 66 GLY 66 44 44 GLY GLY A . n A 1 67 GLU 67 45 45 GLU GLU A . n A 1 68 GLU 68 46 46 GLU GLU A . n A 1 69 GLY 69 47 47 GLY GLY A . n A 1 70 ALA 70 48 48 ALA ALA A . n A 1 71 THR 71 49 49 THR THR A . n A 1 72 VAL 72 50 50 VAL VAL A . n A 1 73 THR 73 51 51 THR THR A . n A 1 74 SER 74 52 52 SER SER A . n A 1 75 GLU 75 53 53 GLU GLU A . n A 1 76 GLU 76 54 54 GLU GLU A . n A 1 77 CYS 77 55 55 CYS CYS A . n A 1 78 ARG 78 56 56 ARG ARG A . n A 1 79 PHE 79 57 57 PHE PHE A . n A 1 80 CYS 80 58 58 CYS CYS A . n A 1 81 HIS 81 59 59 HIS HIS A . n A 1 82 SER 82 60 60 SER SER A . n A 1 83 GLU 83 61 61 GLU GLU A . n A 1 84 LYS 84 62 62 LYS LYS A . n A 1 85 ALA 85 63 63 ALA ALA A . n A 1 86 PRO 86 64 64 PRO PRO A . n A 1 87 ASP 87 65 65 ASP ASP A . n A 1 88 GLU 88 66 66 GLU GLU A . n A 1 89 VAL 89 67 67 VAL VAL A . n A 1 90 ILE 90 68 68 ILE ILE A . n A 1 91 GLU 91 69 69 GLU GLU A . n A 1 92 ALA 92 70 70 ALA ALA A . n A 1 93 ILE 93 71 71 ILE ILE A . n A 1 94 LYS 94 72 72 LYS LYS A . n A 1 95 GLN 95 73 73 GLN GLN A . n A 1 96 ASN 96 74 74 ASN ASN A . n A 1 97 GLY 97 75 75 GLY GLY A . n A 1 98 TYR 98 76 76 TYR TYR A . n A 1 99 PHE 99 77 77 PHE PHE A . n A 1 100 ILE 100 78 78 ILE ILE A . n A 1 101 TYR 101 79 79 TYR TYR A . n A 1 102 LYS 102 80 80 LYS LYS A . n A 1 103 MET 103 81 81 MET MET A . n A 1 104 GLU 104 82 82 GLU GLU A . n A 1 105 GLY 105 83 83 GLY GLY A . n A 1 106 CYS 106 84 84 CYS CYS A . n A 1 107 ASN 107 85 85 ASN ASN A . n A 1 108 GLY 108 86 ? ? ? A . n A 1 109 SER 109 87 ? ? ? A . n # _cell.entry_id 2HFQ _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2HFQ _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 2HFQ _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 2HFQ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2HFQ _struct.title 'NMR structure of protein NE1680 from Nitrosomonas europaea: Northeast Structural Genomics Consortium target NeT5' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2HFQ _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;a/b protein, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q82U33_NITEU _struct_ref.pdbx_db_accession Q82U33 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2HFQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 23 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 107 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q82U33 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 85 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 85 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2HFQ MET A 1 ? UNP Q82U33 ? ? 'cloning artifact' -21 1 1 2HFQ GLY A 2 ? UNP Q82U33 ? ? 'cloning artifact' -20 2 1 2HFQ SER A 3 ? UNP Q82U33 ? ? 'cloning artifact' -19 3 1 2HFQ SER A 4 ? UNP Q82U33 ? ? 'cloning artifact' -18 4 1 2HFQ HIS A 5 ? UNP Q82U33 ? ? 'expression tag' -17 5 1 2HFQ HIS A 6 ? UNP Q82U33 ? ? 'expression tag' -16 6 1 2HFQ HIS A 7 ? UNP Q82U33 ? ? 'expression tag' -15 7 1 2HFQ HIS A 8 ? UNP Q82U33 ? ? 'expression tag' -14 8 1 2HFQ HIS A 9 ? UNP Q82U33 ? ? 'expression tag' -13 9 1 2HFQ HIS A 10 ? UNP Q82U33 ? ? 'expression tag' -12 10 1 2HFQ SER A 11 ? UNP Q82U33 ? ? 'cloning artifact' -11 11 1 2HFQ SER A 12 ? UNP Q82U33 ? ? 'cloning artifact' -10 12 1 2HFQ GLY A 13 ? UNP Q82U33 ? ? 'cloning artifact' -9 13 1 2HFQ ARG A 14 ? UNP Q82U33 ? ? 'cloning artifact' -8 14 1 2HFQ GLU A 15 ? UNP Q82U33 ? ? 'cloning artifact' -7 15 1 2HFQ ASN A 16 ? UNP Q82U33 ? ? 'cloning artifact' -6 16 1 2HFQ LEU A 17 ? UNP Q82U33 ? ? 'cloning artifact' -5 17 1 2HFQ TYR A 18 ? UNP Q82U33 ? ? 'cloning artifact' -4 18 1 2HFQ PHE A 19 ? UNP Q82U33 ? ? 'cloning artifact' -3 19 1 2HFQ GLN A 20 ? UNP Q82U33 ? ? 'cloning artifact' -2 20 1 2HFQ GLY A 21 ? UNP Q82U33 ? ? 'cloning artifact' -1 21 1 2HFQ HIS A 22 ? UNP Q82U33 ? ? 'cloning artifact' 0 22 1 2HFQ GLU A 83 ? UNP Q82U33 GLN 61 'SEE REMARK 999' 61 23 1 2HFQ GLY A 108 ? UNP Q82U33 ? ? 'cloning artifact' 86 24 1 2HFQ SER A 109 ? UNP Q82U33 ? ? 'cloning artifact' 87 25 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 50 ? GLY A 66 ? ASP A 28 GLY A 44 1 ? 17 HELX_P HELX_P2 2 PRO A 86 ? GLY A 97 ? PRO A 64 GLY A 75 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 CYS A 77 ? LYS A 84 ? CYS A 55 LYS A 62 A 2 GLN A 24 ? VAL A 32 ? GLN A 2 VAL A 10 A 3 MET A 40 ? THR A 46 ? MET A 18 THR A 24 A 4 TYR A 98 ? TYR A 101 ? TYR A 76 TYR A 79 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O CYS A 80 ? O CYS A 58 N VAL A 27 ? N VAL A 5 A 2 3 N VAL A 32 ? N VAL A 10 O MET A 40 ? O MET A 18 A 3 4 N PHE A 45 ? N PHE A 23 O PHE A 99 ? O PHE A 77 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HZ2 A LYS 31 ? ? OE1 A GLU 34 ? ? 1.57 2 3 HD1 A TYR 9 ? ? HD2 A HIS 19 ? ? 1.30 3 3 OE1 A GLU 69 ? ? HZ2 A LYS 72 ? ? 1.58 4 3 HE2 A HIS 16 ? ? O A ASN 85 ? ? 1.58 5 3 OD1 A ASP 7 ? ? HG A CYS 58 ? ? 1.59 6 4 HG1 A THR 51 ? ? OE1 A GLU 54 ? ? 1.58 7 4 HZ3 A LYS 31 ? ? OE2 A GLU 34 ? ? 1.59 8 7 HG1 A THR 51 ? ? OE1 A GLU 54 ? ? 1.57 9 8 OD1 A ASP 7 ? ? HE2 A HIS 19 ? ? 1.56 10 8 HG1 A THR 51 ? ? OE1 A GLU 54 ? ? 1.56 11 10 HG1 A THR 51 ? ? OE1 A GLU 54 ? ? 1.60 12 12 HD2 A PHE 23 ? ? HD2 A PHE 77 ? ? 1.30 13 13 OD1 A ASP 7 ? ? HG A CYS 58 ? ? 1.53 14 15 HG1 A THR 51 ? ? OE1 A GLU 54 ? ? 1.59 15 17 HE2 A HIS 59 ? ? OE1 A GLU 61 ? ? 1.58 16 18 OD1 A ASP 7 ? ? HG A CYS 58 ? ? 1.53 17 19 HZ2 A LYS 31 ? ? OE2 A GLU 34 ? ? 1.57 18 19 HG1 A THR 51 ? ? OE1 A GLU 54 ? ? 1.58 19 19 OE2 A GLU 69 ? ? HZ3 A LYS 72 ? ? 1.60 20 20 HZ2 A LYS 31 ? ? OE2 A GLU 34 ? ? 1.55 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 16 ? ? -178.03 145.44 2 1 GLU A 45 ? ? -99.68 46.04 3 1 HIS A 59 ? ? -177.18 -179.11 4 2 HIS A 16 ? ? 73.74 152.20 5 2 ARG A 27 ? ? -101.80 62.97 6 2 THR A 51 ? ? -122.52 -161.79 7 2 GLN A 73 ? ? -92.58 -64.24 8 2 MET A 81 ? ? -53.92 -71.63 9 2 CYS A 84 ? ? -143.27 33.85 10 3 ASP A 14 ? ? -106.89 54.87 11 3 MET A 18 ? ? -69.68 98.70 12 3 GLU A 46 ? ? 65.40 -160.83 13 3 THR A 49 ? ? -65.88 96.24 14 3 GLU A 82 ? ? -135.75 -57.07 15 4 ASP A 14 ? ? -143.23 -6.09 16 4 HIS A 16 ? ? 74.13 150.14 17 4 THR A 51 ? ? -105.93 -168.60 18 4 GLU A 61 ? ? -124.29 -167.76 19 4 MET A 81 ? ? -79.48 -81.29 20 5 ARG A 27 ? ? -88.29 36.44 21 5 CYS A 58 ? ? -100.01 -73.38 22 5 GLU A 82 ? ? -151.21 78.38 23 6 THR A 51 ? ? -111.42 -164.64 24 6 CYS A 58 ? ? -105.48 -62.79 25 6 MET A 81 ? ? -92.42 -61.97 26 6 CYS A 84 ? ? -179.86 127.66 27 7 GLU A 45 ? ? -84.01 47.05 28 7 THR A 51 ? ? -109.86 -167.00 29 7 MET A 81 ? ? -59.93 -75.91 30 7 GLU A 82 ? ? -145.52 -6.74 31 7 CYS A 84 ? ? -107.32 -98.45 32 8 HIS A 16 ? ? 71.63 156.00 33 8 GLU A 45 ? ? -78.19 -75.60 34 8 THR A 51 ? ? -105.21 -169.06 35 8 HIS A 59 ? ? -174.12 -178.76 36 8 GLN A 73 ? ? -97.58 -65.45 37 8 GLU A 82 ? ? -161.29 118.95 38 9 GLU A 46 ? ? 83.13 -23.23 39 9 ALA A 48 ? ? 52.85 -151.81 40 9 THR A 51 ? ? -114.64 -164.09 41 10 ARG A 27 ? ? -99.69 36.80 42 10 GLU A 45 ? ? -106.42 -78.60 43 10 HIS A 59 ? ? -174.01 -179.87 44 11 GLU A 45 ? ? -99.81 31.22 45 11 HIS A 59 ? ? 177.64 -164.48 46 11 LYS A 80 ? ? -67.04 98.14 47 11 GLU A 82 ? ? -150.41 25.22 48 12 CYS A 58 ? ? -100.96 -70.43 49 13 VAL A 17 ? ? -58.52 107.89 50 13 LYS A 80 ? ? -67.01 96.39 51 14 ASP A 28 ? ? -162.91 105.63 52 14 GLU A 45 ? ? -100.58 -79.45 53 14 SER A 52 ? ? -67.72 0.67 54 15 GLU A 45 ? ? -95.75 37.20 55 16 GLU A 46 ? ? -93.30 43.78 56 16 MET A 81 ? ? -74.99 -74.80 57 16 CYS A 84 ? ? -173.10 -49.97 58 17 GLU A 46 ? ? -79.52 23.06 59 17 HIS A 59 ? ? -175.78 -177.42 60 17 GLU A 82 ? ? -160.64 18.07 61 18 ARG A 27 ? ? -94.51 36.63 62 18 GLU A 46 ? ? 66.56 -76.04 63 18 GLU A 82 ? ? -175.09 -50.94 64 18 CYS A 84 ? ? -143.01 -53.46 65 19 ASP A 14 ? ? -149.08 24.17 66 19 HIS A 16 ? ? 73.33 147.21 67 19 GLU A 46 ? ? 61.77 -88.16 68 19 THR A 49 ? ? -65.93 96.00 69 19 THR A 51 ? ? -125.40 -168.09 70 19 HIS A 59 ? ? 178.01 -178.36 71 20 ASP A 14 ? ? -147.60 -17.54 72 20 HIS A 16 ? ? 74.44 137.87 73 20 GLU A 46 ? ? 70.00 -72.92 74 20 THR A 51 ? ? -121.41 -168.08 75 20 LYS A 80 ? ? -67.31 99.18 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.initial_of_center NESG # _pdbx_database_remark.id 999 _pdbx_database_remark.text ; Sequence The authors state that the sample contains an apparent mutation at position 61, where the reported glutamine was found to be glutamic acid. ; # _pdbx_nmr_ensemble.entry_id 2HFQ _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'all calculated structures submitted' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2HFQ _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'low energy, few violations, good geometry' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '1 mM NE1680 U-13C,15N; 10mM MOPS, 450 mM NaCl, 10 mM DTT, 0.01% NaN3, pH 6.5, 90% H20, 10% D2O' '90% H20, 10% D2O' 2 '1 mM NE1680 U-13C,15N; 10mM MOPS, 450 mM NaCl, 10 mM DTT, 0.01% NaN3, pH 6.5, 100% D2O' '100% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength '450 mM NaCl' _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_13C-separated_NOESY 1 2 1 3D_15N-separated_NOESY 1 3 1 3D_13C-separated_NOESY 2 4 1 4D_13C-separated_NOESY 2 # _pdbx_nmr_details.entry_id 2HFQ _pdbx_nmr_details.text ;The sample contains a 22 residue N-term tag, and a two residue C-term cloning artifact. No coordinates for these unstructured residues were included. The sample also contains an apparent mutation at position 61, where the reported glutamine was found to be glutamic acid. ; # _pdbx_nmr_refine.entry_id 2HFQ _pdbx_nmr_refine.method 'The structure was determined using AutoStructure and refined manually' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal processing Felix 97 ? 1 'data analysis' Sparky 3.106 ? 2 'structure solution' AutoStructure 2.1.1 ? 3 collection VNMR 6.1C ? 4 refinement CNS 1.1 BRUNGER,ADAMS,CLORE,DELANO,GROS,GROSSE-KUNSTLEVE,JIANG,KUSZEWSKI,NILGES,PANNU,READ,RICE,SIMONSON,WARREN 5 refinement XPLOR-NIH ? 'C.D.SCHWIETERS,J.J.KUSZEWSKI,N.TJANDRA,G.MARIUS CLORE' 6 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -21 ? A MET 1 2 1 Y 1 A GLY -20 ? A GLY 2 3 1 Y 1 A SER -19 ? A SER 3 4 1 Y 1 A SER -18 ? A SER 4 5 1 Y 1 A HIS -17 ? A HIS 5 6 1 Y 1 A HIS -16 ? A HIS 6 7 1 Y 1 A HIS -15 ? A HIS 7 8 1 Y 1 A HIS -14 ? A HIS 8 9 1 Y 1 A HIS -13 ? A HIS 9 10 1 Y 1 A HIS -12 ? A HIS 10 11 1 Y 1 A SER -11 ? A SER 11 12 1 Y 1 A SER -10 ? A SER 12 13 1 Y 1 A GLY -9 ? A GLY 13 14 1 Y 1 A ARG -8 ? A ARG 14 15 1 Y 1 A GLU -7 ? A GLU 15 16 1 Y 1 A ASN -6 ? A ASN 16 17 1 Y 1 A LEU -5 ? A LEU 17 18 1 Y 1 A TYR -4 ? A TYR 18 19 1 Y 1 A PHE -3 ? A PHE 19 20 1 Y 1 A GLN -2 ? A GLN 20 21 1 Y 1 A GLY -1 ? A GLY 21 22 1 Y 1 A HIS 0 ? A HIS 22 23 1 Y 1 A GLY 86 ? A GLY 108 24 1 Y 1 A SER 87 ? A SER 109 25 2 Y 1 A MET -21 ? A MET 1 26 2 Y 1 A GLY -20 ? A GLY 2 27 2 Y 1 A SER -19 ? A SER 3 28 2 Y 1 A SER -18 ? A SER 4 29 2 Y 1 A HIS -17 ? A HIS 5 30 2 Y 1 A HIS -16 ? A HIS 6 31 2 Y 1 A HIS -15 ? A HIS 7 32 2 Y 1 A HIS -14 ? A HIS 8 33 2 Y 1 A HIS -13 ? A HIS 9 34 2 Y 1 A HIS -12 ? A HIS 10 35 2 Y 1 A SER -11 ? A SER 11 36 2 Y 1 A SER -10 ? A SER 12 37 2 Y 1 A GLY -9 ? A GLY 13 38 2 Y 1 A ARG -8 ? A ARG 14 39 2 Y 1 A GLU -7 ? A GLU 15 40 2 Y 1 A ASN -6 ? A ASN 16 41 2 Y 1 A LEU -5 ? A LEU 17 42 2 Y 1 A TYR -4 ? A TYR 18 43 2 Y 1 A PHE -3 ? A PHE 19 44 2 Y 1 A GLN -2 ? A GLN 20 45 2 Y 1 A GLY -1 ? A GLY 21 46 2 Y 1 A HIS 0 ? A HIS 22 47 2 Y 1 A GLY 86 ? A GLY 108 48 2 Y 1 A SER 87 ? A SER 109 49 3 Y 1 A MET -21 ? A MET 1 50 3 Y 1 A GLY -20 ? A GLY 2 51 3 Y 1 A SER -19 ? A SER 3 52 3 Y 1 A SER -18 ? A SER 4 53 3 Y 1 A HIS -17 ? A HIS 5 54 3 Y 1 A HIS -16 ? A HIS 6 55 3 Y 1 A HIS -15 ? A HIS 7 56 3 Y 1 A HIS -14 ? A HIS 8 57 3 Y 1 A HIS -13 ? A HIS 9 58 3 Y 1 A HIS -12 ? A HIS 10 59 3 Y 1 A SER -11 ? A SER 11 60 3 Y 1 A SER -10 ? A SER 12 61 3 Y 1 A GLY -9 ? A GLY 13 62 3 Y 1 A ARG -8 ? A ARG 14 63 3 Y 1 A GLU -7 ? A GLU 15 64 3 Y 1 A ASN -6 ? A ASN 16 65 3 Y 1 A LEU -5 ? A LEU 17 66 3 Y 1 A TYR -4 ? A TYR 18 67 3 Y 1 A PHE -3 ? A PHE 19 68 3 Y 1 A GLN -2 ? A GLN 20 69 3 Y 1 A GLY -1 ? A GLY 21 70 3 Y 1 A HIS 0 ? A HIS 22 71 3 Y 1 A GLY 86 ? A GLY 108 72 3 Y 1 A SER 87 ? A SER 109 73 4 Y 1 A MET -21 ? A MET 1 74 4 Y 1 A GLY -20 ? A GLY 2 75 4 Y 1 A SER -19 ? A SER 3 76 4 Y 1 A SER -18 ? A SER 4 77 4 Y 1 A HIS -17 ? A HIS 5 78 4 Y 1 A HIS -16 ? A HIS 6 79 4 Y 1 A HIS -15 ? A HIS 7 80 4 Y 1 A HIS -14 ? A HIS 8 81 4 Y 1 A HIS -13 ? A HIS 9 82 4 Y 1 A HIS -12 ? A HIS 10 83 4 Y 1 A SER -11 ? A SER 11 84 4 Y 1 A SER -10 ? A SER 12 85 4 Y 1 A GLY -9 ? A GLY 13 86 4 Y 1 A ARG -8 ? A ARG 14 87 4 Y 1 A GLU -7 ? A GLU 15 88 4 Y 1 A ASN -6 ? A ASN 16 89 4 Y 1 A LEU -5 ? A LEU 17 90 4 Y 1 A TYR -4 ? A TYR 18 91 4 Y 1 A PHE -3 ? A PHE 19 92 4 Y 1 A GLN -2 ? A GLN 20 93 4 Y 1 A GLY -1 ? A GLY 21 94 4 Y 1 A HIS 0 ? A HIS 22 95 4 Y 1 A GLY 86 ? A GLY 108 96 4 Y 1 A SER 87 ? A SER 109 97 5 Y 1 A MET -21 ? A MET 1 98 5 Y 1 A GLY -20 ? A GLY 2 99 5 Y 1 A SER -19 ? A SER 3 100 5 Y 1 A SER -18 ? A SER 4 101 5 Y 1 A HIS -17 ? A HIS 5 102 5 Y 1 A HIS -16 ? A HIS 6 103 5 Y 1 A HIS -15 ? A HIS 7 104 5 Y 1 A HIS -14 ? A HIS 8 105 5 Y 1 A HIS -13 ? A HIS 9 106 5 Y 1 A HIS -12 ? A HIS 10 107 5 Y 1 A SER -11 ? A SER 11 108 5 Y 1 A SER -10 ? A SER 12 109 5 Y 1 A GLY -9 ? A GLY 13 110 5 Y 1 A ARG -8 ? A ARG 14 111 5 Y 1 A GLU -7 ? A GLU 15 112 5 Y 1 A ASN -6 ? A ASN 16 113 5 Y 1 A LEU -5 ? A LEU 17 114 5 Y 1 A TYR -4 ? A TYR 18 115 5 Y 1 A PHE -3 ? A PHE 19 116 5 Y 1 A GLN -2 ? A GLN 20 117 5 Y 1 A GLY -1 ? A GLY 21 118 5 Y 1 A HIS 0 ? A HIS 22 119 5 Y 1 A GLY 86 ? A GLY 108 120 5 Y 1 A SER 87 ? A SER 109 121 6 Y 1 A MET -21 ? A MET 1 122 6 Y 1 A GLY -20 ? A GLY 2 123 6 Y 1 A SER -19 ? A SER 3 124 6 Y 1 A SER -18 ? A SER 4 125 6 Y 1 A HIS -17 ? A HIS 5 126 6 Y 1 A HIS -16 ? A HIS 6 127 6 Y 1 A HIS -15 ? A HIS 7 128 6 Y 1 A HIS -14 ? A HIS 8 129 6 Y 1 A HIS -13 ? A HIS 9 130 6 Y 1 A HIS -12 ? A HIS 10 131 6 Y 1 A SER -11 ? A SER 11 132 6 Y 1 A SER -10 ? A SER 12 133 6 Y 1 A GLY -9 ? A GLY 13 134 6 Y 1 A ARG -8 ? A ARG 14 135 6 Y 1 A GLU -7 ? A GLU 15 136 6 Y 1 A ASN -6 ? A ASN 16 137 6 Y 1 A LEU -5 ? A LEU 17 138 6 Y 1 A TYR -4 ? A TYR 18 139 6 Y 1 A PHE -3 ? A PHE 19 140 6 Y 1 A GLN -2 ? A GLN 20 141 6 Y 1 A GLY -1 ? A GLY 21 142 6 Y 1 A HIS 0 ? A HIS 22 143 6 Y 1 A GLY 86 ? A GLY 108 144 6 Y 1 A SER 87 ? A SER 109 145 7 Y 1 A MET -21 ? A MET 1 146 7 Y 1 A GLY -20 ? A GLY 2 147 7 Y 1 A SER -19 ? A SER 3 148 7 Y 1 A SER -18 ? A SER 4 149 7 Y 1 A HIS -17 ? A HIS 5 150 7 Y 1 A HIS -16 ? A HIS 6 151 7 Y 1 A HIS -15 ? A HIS 7 152 7 Y 1 A HIS -14 ? A HIS 8 153 7 Y 1 A HIS -13 ? A HIS 9 154 7 Y 1 A HIS -12 ? A HIS 10 155 7 Y 1 A SER -11 ? A SER 11 156 7 Y 1 A SER -10 ? A SER 12 157 7 Y 1 A GLY -9 ? A GLY 13 158 7 Y 1 A ARG -8 ? A ARG 14 159 7 Y 1 A GLU -7 ? A GLU 15 160 7 Y 1 A ASN -6 ? A ASN 16 161 7 Y 1 A LEU -5 ? A LEU 17 162 7 Y 1 A TYR -4 ? A TYR 18 163 7 Y 1 A PHE -3 ? A PHE 19 164 7 Y 1 A GLN -2 ? A GLN 20 165 7 Y 1 A GLY -1 ? A GLY 21 166 7 Y 1 A HIS 0 ? A HIS 22 167 7 Y 1 A GLY 86 ? A GLY 108 168 7 Y 1 A SER 87 ? A SER 109 169 8 Y 1 A MET -21 ? A MET 1 170 8 Y 1 A GLY -20 ? A GLY 2 171 8 Y 1 A SER -19 ? A SER 3 172 8 Y 1 A SER -18 ? A SER 4 173 8 Y 1 A HIS -17 ? A HIS 5 174 8 Y 1 A HIS -16 ? A HIS 6 175 8 Y 1 A HIS -15 ? A HIS 7 176 8 Y 1 A HIS -14 ? A HIS 8 177 8 Y 1 A HIS -13 ? A HIS 9 178 8 Y 1 A HIS -12 ? A HIS 10 179 8 Y 1 A SER -11 ? A SER 11 180 8 Y 1 A SER -10 ? A SER 12 181 8 Y 1 A GLY -9 ? A GLY 13 182 8 Y 1 A ARG -8 ? A ARG 14 183 8 Y 1 A GLU -7 ? A GLU 15 184 8 Y 1 A ASN -6 ? A ASN 16 185 8 Y 1 A LEU -5 ? A LEU 17 186 8 Y 1 A TYR -4 ? A TYR 18 187 8 Y 1 A PHE -3 ? A PHE 19 188 8 Y 1 A GLN -2 ? A GLN 20 189 8 Y 1 A GLY -1 ? A GLY 21 190 8 Y 1 A HIS 0 ? A HIS 22 191 8 Y 1 A GLY 86 ? A GLY 108 192 8 Y 1 A SER 87 ? A SER 109 193 9 Y 1 A MET -21 ? A MET 1 194 9 Y 1 A GLY -20 ? A GLY 2 195 9 Y 1 A SER -19 ? A SER 3 196 9 Y 1 A SER -18 ? A SER 4 197 9 Y 1 A HIS -17 ? A HIS 5 198 9 Y 1 A HIS -16 ? A HIS 6 199 9 Y 1 A HIS -15 ? A HIS 7 200 9 Y 1 A HIS -14 ? A HIS 8 201 9 Y 1 A HIS -13 ? A HIS 9 202 9 Y 1 A HIS -12 ? A HIS 10 203 9 Y 1 A SER -11 ? A SER 11 204 9 Y 1 A SER -10 ? A SER 12 205 9 Y 1 A GLY -9 ? A GLY 13 206 9 Y 1 A ARG -8 ? A ARG 14 207 9 Y 1 A GLU -7 ? A GLU 15 208 9 Y 1 A ASN -6 ? A ASN 16 209 9 Y 1 A LEU -5 ? A LEU 17 210 9 Y 1 A TYR -4 ? A TYR 18 211 9 Y 1 A PHE -3 ? A PHE 19 212 9 Y 1 A GLN -2 ? A GLN 20 213 9 Y 1 A GLY -1 ? A GLY 21 214 9 Y 1 A HIS 0 ? A HIS 22 215 9 Y 1 A GLY 86 ? A GLY 108 216 9 Y 1 A SER 87 ? A SER 109 217 10 Y 1 A MET -21 ? A MET 1 218 10 Y 1 A GLY -20 ? A GLY 2 219 10 Y 1 A SER -19 ? A SER 3 220 10 Y 1 A SER -18 ? A SER 4 221 10 Y 1 A HIS -17 ? A HIS 5 222 10 Y 1 A HIS -16 ? A HIS 6 223 10 Y 1 A HIS -15 ? A HIS 7 224 10 Y 1 A HIS -14 ? A HIS 8 225 10 Y 1 A HIS -13 ? A HIS 9 226 10 Y 1 A HIS -12 ? A HIS 10 227 10 Y 1 A SER -11 ? A SER 11 228 10 Y 1 A SER -10 ? A SER 12 229 10 Y 1 A GLY -9 ? A GLY 13 230 10 Y 1 A ARG -8 ? A ARG 14 231 10 Y 1 A GLU -7 ? A GLU 15 232 10 Y 1 A ASN -6 ? A ASN 16 233 10 Y 1 A LEU -5 ? A LEU 17 234 10 Y 1 A TYR -4 ? A TYR 18 235 10 Y 1 A PHE -3 ? A PHE 19 236 10 Y 1 A GLN -2 ? A GLN 20 237 10 Y 1 A GLY -1 ? A GLY 21 238 10 Y 1 A HIS 0 ? A HIS 22 239 10 Y 1 A GLY 86 ? A GLY 108 240 10 Y 1 A SER 87 ? A SER 109 241 11 Y 1 A MET -21 ? A MET 1 242 11 Y 1 A GLY -20 ? A GLY 2 243 11 Y 1 A SER -19 ? A SER 3 244 11 Y 1 A SER -18 ? A SER 4 245 11 Y 1 A HIS -17 ? A HIS 5 246 11 Y 1 A HIS -16 ? A HIS 6 247 11 Y 1 A HIS -15 ? A HIS 7 248 11 Y 1 A HIS -14 ? A HIS 8 249 11 Y 1 A HIS -13 ? A HIS 9 250 11 Y 1 A HIS -12 ? A HIS 10 251 11 Y 1 A SER -11 ? A SER 11 252 11 Y 1 A SER -10 ? A SER 12 253 11 Y 1 A GLY -9 ? A GLY 13 254 11 Y 1 A ARG -8 ? A ARG 14 255 11 Y 1 A GLU -7 ? A GLU 15 256 11 Y 1 A ASN -6 ? A ASN 16 257 11 Y 1 A LEU -5 ? A LEU 17 258 11 Y 1 A TYR -4 ? A TYR 18 259 11 Y 1 A PHE -3 ? A PHE 19 260 11 Y 1 A GLN -2 ? A GLN 20 261 11 Y 1 A GLY -1 ? A GLY 21 262 11 Y 1 A HIS 0 ? A HIS 22 263 11 Y 1 A GLY 86 ? A GLY 108 264 11 Y 1 A SER 87 ? A SER 109 265 12 Y 1 A MET -21 ? A MET 1 266 12 Y 1 A GLY -20 ? A GLY 2 267 12 Y 1 A SER -19 ? A SER 3 268 12 Y 1 A SER -18 ? A SER 4 269 12 Y 1 A HIS -17 ? A HIS 5 270 12 Y 1 A HIS -16 ? A HIS 6 271 12 Y 1 A HIS -15 ? A HIS 7 272 12 Y 1 A HIS -14 ? A HIS 8 273 12 Y 1 A HIS -13 ? A HIS 9 274 12 Y 1 A HIS -12 ? A HIS 10 275 12 Y 1 A SER -11 ? A SER 11 276 12 Y 1 A SER -10 ? A SER 12 277 12 Y 1 A GLY -9 ? A GLY 13 278 12 Y 1 A ARG -8 ? A ARG 14 279 12 Y 1 A GLU -7 ? A GLU 15 280 12 Y 1 A ASN -6 ? A ASN 16 281 12 Y 1 A LEU -5 ? A LEU 17 282 12 Y 1 A TYR -4 ? A TYR 18 283 12 Y 1 A PHE -3 ? A PHE 19 284 12 Y 1 A GLN -2 ? A GLN 20 285 12 Y 1 A GLY -1 ? A GLY 21 286 12 Y 1 A HIS 0 ? A HIS 22 287 12 Y 1 A GLY 86 ? A GLY 108 288 12 Y 1 A SER 87 ? A SER 109 289 13 Y 1 A MET -21 ? A MET 1 290 13 Y 1 A GLY -20 ? A GLY 2 291 13 Y 1 A SER -19 ? A SER 3 292 13 Y 1 A SER -18 ? A SER 4 293 13 Y 1 A HIS -17 ? A HIS 5 294 13 Y 1 A HIS -16 ? A HIS 6 295 13 Y 1 A HIS -15 ? A HIS 7 296 13 Y 1 A HIS -14 ? A HIS 8 297 13 Y 1 A HIS -13 ? A HIS 9 298 13 Y 1 A HIS -12 ? A HIS 10 299 13 Y 1 A SER -11 ? A SER 11 300 13 Y 1 A SER -10 ? A SER 12 301 13 Y 1 A GLY -9 ? A GLY 13 302 13 Y 1 A ARG -8 ? A ARG 14 303 13 Y 1 A GLU -7 ? A GLU 15 304 13 Y 1 A ASN -6 ? A ASN 16 305 13 Y 1 A LEU -5 ? A LEU 17 306 13 Y 1 A TYR -4 ? A TYR 18 307 13 Y 1 A PHE -3 ? A PHE 19 308 13 Y 1 A GLN -2 ? A GLN 20 309 13 Y 1 A GLY -1 ? A GLY 21 310 13 Y 1 A HIS 0 ? A HIS 22 311 13 Y 1 A GLY 86 ? A GLY 108 312 13 Y 1 A SER 87 ? A SER 109 313 14 Y 1 A MET -21 ? A MET 1 314 14 Y 1 A GLY -20 ? A GLY 2 315 14 Y 1 A SER -19 ? A SER 3 316 14 Y 1 A SER -18 ? A SER 4 317 14 Y 1 A HIS -17 ? A HIS 5 318 14 Y 1 A HIS -16 ? A HIS 6 319 14 Y 1 A HIS -15 ? A HIS 7 320 14 Y 1 A HIS -14 ? A HIS 8 321 14 Y 1 A HIS -13 ? A HIS 9 322 14 Y 1 A HIS -12 ? A HIS 10 323 14 Y 1 A SER -11 ? A SER 11 324 14 Y 1 A SER -10 ? A SER 12 325 14 Y 1 A GLY -9 ? A GLY 13 326 14 Y 1 A ARG -8 ? A ARG 14 327 14 Y 1 A GLU -7 ? A GLU 15 328 14 Y 1 A ASN -6 ? A ASN 16 329 14 Y 1 A LEU -5 ? A LEU 17 330 14 Y 1 A TYR -4 ? A TYR 18 331 14 Y 1 A PHE -3 ? A PHE 19 332 14 Y 1 A GLN -2 ? A GLN 20 333 14 Y 1 A GLY -1 ? A GLY 21 334 14 Y 1 A HIS 0 ? A HIS 22 335 14 Y 1 A GLY 86 ? A GLY 108 336 14 Y 1 A SER 87 ? A SER 109 337 15 Y 1 A MET -21 ? A MET 1 338 15 Y 1 A GLY -20 ? A GLY 2 339 15 Y 1 A SER -19 ? A SER 3 340 15 Y 1 A SER -18 ? A SER 4 341 15 Y 1 A HIS -17 ? A HIS 5 342 15 Y 1 A HIS -16 ? A HIS 6 343 15 Y 1 A HIS -15 ? A HIS 7 344 15 Y 1 A HIS -14 ? A HIS 8 345 15 Y 1 A HIS -13 ? A HIS 9 346 15 Y 1 A HIS -12 ? A HIS 10 347 15 Y 1 A SER -11 ? A SER 11 348 15 Y 1 A SER -10 ? A SER 12 349 15 Y 1 A GLY -9 ? A GLY 13 350 15 Y 1 A ARG -8 ? A ARG 14 351 15 Y 1 A GLU -7 ? A GLU 15 352 15 Y 1 A ASN -6 ? A ASN 16 353 15 Y 1 A LEU -5 ? A LEU 17 354 15 Y 1 A TYR -4 ? A TYR 18 355 15 Y 1 A PHE -3 ? A PHE 19 356 15 Y 1 A GLN -2 ? A GLN 20 357 15 Y 1 A GLY -1 ? A GLY 21 358 15 Y 1 A HIS 0 ? A HIS 22 359 15 Y 1 A GLY 86 ? A GLY 108 360 15 Y 1 A SER 87 ? A SER 109 361 16 Y 1 A MET -21 ? A MET 1 362 16 Y 1 A GLY -20 ? A GLY 2 363 16 Y 1 A SER -19 ? A SER 3 364 16 Y 1 A SER -18 ? A SER 4 365 16 Y 1 A HIS -17 ? A HIS 5 366 16 Y 1 A HIS -16 ? A HIS 6 367 16 Y 1 A HIS -15 ? A HIS 7 368 16 Y 1 A HIS -14 ? A HIS 8 369 16 Y 1 A HIS -13 ? A HIS 9 370 16 Y 1 A HIS -12 ? A HIS 10 371 16 Y 1 A SER -11 ? A SER 11 372 16 Y 1 A SER -10 ? A SER 12 373 16 Y 1 A GLY -9 ? A GLY 13 374 16 Y 1 A ARG -8 ? A ARG 14 375 16 Y 1 A GLU -7 ? A GLU 15 376 16 Y 1 A ASN -6 ? A ASN 16 377 16 Y 1 A LEU -5 ? A LEU 17 378 16 Y 1 A TYR -4 ? A TYR 18 379 16 Y 1 A PHE -3 ? A PHE 19 380 16 Y 1 A GLN -2 ? A GLN 20 381 16 Y 1 A GLY -1 ? A GLY 21 382 16 Y 1 A HIS 0 ? A HIS 22 383 16 Y 1 A GLY 86 ? A GLY 108 384 16 Y 1 A SER 87 ? A SER 109 385 17 Y 1 A MET -21 ? A MET 1 386 17 Y 1 A GLY -20 ? A GLY 2 387 17 Y 1 A SER -19 ? A SER 3 388 17 Y 1 A SER -18 ? A SER 4 389 17 Y 1 A HIS -17 ? A HIS 5 390 17 Y 1 A HIS -16 ? A HIS 6 391 17 Y 1 A HIS -15 ? A HIS 7 392 17 Y 1 A HIS -14 ? A HIS 8 393 17 Y 1 A HIS -13 ? A HIS 9 394 17 Y 1 A HIS -12 ? A HIS 10 395 17 Y 1 A SER -11 ? A SER 11 396 17 Y 1 A SER -10 ? A SER 12 397 17 Y 1 A GLY -9 ? A GLY 13 398 17 Y 1 A ARG -8 ? A ARG 14 399 17 Y 1 A GLU -7 ? A GLU 15 400 17 Y 1 A ASN -6 ? A ASN 16 401 17 Y 1 A LEU -5 ? A LEU 17 402 17 Y 1 A TYR -4 ? A TYR 18 403 17 Y 1 A PHE -3 ? A PHE 19 404 17 Y 1 A GLN -2 ? A GLN 20 405 17 Y 1 A GLY -1 ? A GLY 21 406 17 Y 1 A HIS 0 ? A HIS 22 407 17 Y 1 A GLY 86 ? A GLY 108 408 17 Y 1 A SER 87 ? A SER 109 409 18 Y 1 A MET -21 ? A MET 1 410 18 Y 1 A GLY -20 ? A GLY 2 411 18 Y 1 A SER -19 ? A SER 3 412 18 Y 1 A SER -18 ? A SER 4 413 18 Y 1 A HIS -17 ? A HIS 5 414 18 Y 1 A HIS -16 ? A HIS 6 415 18 Y 1 A HIS -15 ? A HIS 7 416 18 Y 1 A HIS -14 ? A HIS 8 417 18 Y 1 A HIS -13 ? A HIS 9 418 18 Y 1 A HIS -12 ? A HIS 10 419 18 Y 1 A SER -11 ? A SER 11 420 18 Y 1 A SER -10 ? A SER 12 421 18 Y 1 A GLY -9 ? A GLY 13 422 18 Y 1 A ARG -8 ? A ARG 14 423 18 Y 1 A GLU -7 ? A GLU 15 424 18 Y 1 A ASN -6 ? A ASN 16 425 18 Y 1 A LEU -5 ? A LEU 17 426 18 Y 1 A TYR -4 ? A TYR 18 427 18 Y 1 A PHE -3 ? A PHE 19 428 18 Y 1 A GLN -2 ? A GLN 20 429 18 Y 1 A GLY -1 ? A GLY 21 430 18 Y 1 A HIS 0 ? A HIS 22 431 18 Y 1 A GLY 86 ? A GLY 108 432 18 Y 1 A SER 87 ? A SER 109 433 19 Y 1 A MET -21 ? A MET 1 434 19 Y 1 A GLY -20 ? A GLY 2 435 19 Y 1 A SER -19 ? A SER 3 436 19 Y 1 A SER -18 ? A SER 4 437 19 Y 1 A HIS -17 ? A HIS 5 438 19 Y 1 A HIS -16 ? A HIS 6 439 19 Y 1 A HIS -15 ? A HIS 7 440 19 Y 1 A HIS -14 ? A HIS 8 441 19 Y 1 A HIS -13 ? A HIS 9 442 19 Y 1 A HIS -12 ? A HIS 10 443 19 Y 1 A SER -11 ? A SER 11 444 19 Y 1 A SER -10 ? A SER 12 445 19 Y 1 A GLY -9 ? A GLY 13 446 19 Y 1 A ARG -8 ? A ARG 14 447 19 Y 1 A GLU -7 ? A GLU 15 448 19 Y 1 A ASN -6 ? A ASN 16 449 19 Y 1 A LEU -5 ? A LEU 17 450 19 Y 1 A TYR -4 ? A TYR 18 451 19 Y 1 A PHE -3 ? A PHE 19 452 19 Y 1 A GLN -2 ? A GLN 20 453 19 Y 1 A GLY -1 ? A GLY 21 454 19 Y 1 A HIS 0 ? A HIS 22 455 19 Y 1 A GLY 86 ? A GLY 108 456 19 Y 1 A SER 87 ? A SER 109 457 20 Y 1 A MET -21 ? A MET 1 458 20 Y 1 A GLY -20 ? A GLY 2 459 20 Y 1 A SER -19 ? A SER 3 460 20 Y 1 A SER -18 ? A SER 4 461 20 Y 1 A HIS -17 ? A HIS 5 462 20 Y 1 A HIS -16 ? A HIS 6 463 20 Y 1 A HIS -15 ? A HIS 7 464 20 Y 1 A HIS -14 ? A HIS 8 465 20 Y 1 A HIS -13 ? A HIS 9 466 20 Y 1 A HIS -12 ? A HIS 10 467 20 Y 1 A SER -11 ? A SER 11 468 20 Y 1 A SER -10 ? A SER 12 469 20 Y 1 A GLY -9 ? A GLY 13 470 20 Y 1 A ARG -8 ? A ARG 14 471 20 Y 1 A GLU -7 ? A GLU 15 472 20 Y 1 A ASN -6 ? A ASN 16 473 20 Y 1 A LEU -5 ? A LEU 17 474 20 Y 1 A TYR -4 ? A TYR 18 475 20 Y 1 A PHE -3 ? A PHE 19 476 20 Y 1 A GLN -2 ? A GLN 20 477 20 Y 1 A GLY -1 ? A GLY 21 478 20 Y 1 A HIS 0 ? A HIS 22 479 20 Y 1 A GLY 86 ? A GLY 108 480 20 Y 1 A SER 87 ? A SER 109 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 INOVA Varian 600 ? 2 INOVA Varian 750 ? 3 INOVA Varian 900 ? # _atom_sites.entry_id 2HFQ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_