data_2HG6 # _entry.id 2HG6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2HG6 pdb_00002hg6 10.2210/pdb2hg6/pdb RCSB RCSB038310 ? ? WWPDB D_1000038310 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-07-25 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-09 5 'Structure model' 1 4 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_nmr_software 3 4 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2HG6 _pdbx_database_status.recvd_initial_deposition_date 2006-06-26 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id PaT4 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Lemak, A.' 1 'Srisailam, S.' 2 'Yee, A.' 3 'Lukin, J.A.' 4 'Orekhov, V.Y.' 5 'Arrowsmith, C.H.' 6 'Northeast Structural Genomics Consortium (NESG)' 7 # _citation.id primary _citation.title ;Solution Structure of a hypothetical protein from Pseudomonas aeruginosa (Northeast Structural Genomics Consortium Target: PaT4; Ontario Centre for Structural Proteomics Target: PA1123) ; _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lemak, A.' 1 ? primary 'Srisailam, S.' 2 ? primary 'Yee, A.' 3 ? primary 'Lukin, J.A.' 4 ? primary 'Orekhov, V.Y.' 5 ? primary 'Arrowsmith, C.H.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Hypothetical protein' _entity.formula_weight 14749.495 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGRENLYFQGHMSITSTDICQAADALKGFVGFNRKTGRYIVRFSEDSFGMDVADDSITPTSEFVWSSVR DDVMRLGREQLQILLEQNINERLNIGEPLLVYLRRQDLPEITAQRQLR ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGRENLYFQGHMSITSTDICQAADALKGFVGFNRKTGRYIVRFSEDSFGMDVADDSITPTSEFVWSSVR DDVMRLGREQLQILLEQNINERLNIGEPLLVYLRRQDLPEITAQRQLR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier PaT4 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 ARG n 1 15 GLU n 1 16 ASN n 1 17 LEU n 1 18 TYR n 1 19 PHE n 1 20 GLN n 1 21 GLY n 1 22 HIS n 1 23 MET n 1 24 SER n 1 25 ILE n 1 26 THR n 1 27 SER n 1 28 THR n 1 29 ASP n 1 30 ILE n 1 31 CYS n 1 32 GLN n 1 33 ALA n 1 34 ALA n 1 35 ASP n 1 36 ALA n 1 37 LEU n 1 38 LYS n 1 39 GLY n 1 40 PHE n 1 41 VAL n 1 42 GLY n 1 43 PHE n 1 44 ASN n 1 45 ARG n 1 46 LYS n 1 47 THR n 1 48 GLY n 1 49 ARG n 1 50 TYR n 1 51 ILE n 1 52 VAL n 1 53 ARG n 1 54 PHE n 1 55 SER n 1 56 GLU n 1 57 ASP n 1 58 SER n 1 59 PHE n 1 60 GLY n 1 61 MET n 1 62 ASP n 1 63 VAL n 1 64 ALA n 1 65 ASP n 1 66 ASP n 1 67 SER n 1 68 ILE n 1 69 THR n 1 70 PRO n 1 71 THR n 1 72 SER n 1 73 GLU n 1 74 PHE n 1 75 VAL n 1 76 TRP n 1 77 SER n 1 78 SER n 1 79 VAL n 1 80 ARG n 1 81 ASP n 1 82 ASP n 1 83 VAL n 1 84 MET n 1 85 ARG n 1 86 LEU n 1 87 GLY n 1 88 ARG n 1 89 GLU n 1 90 GLN n 1 91 LEU n 1 92 GLN n 1 93 ILE n 1 94 LEU n 1 95 LEU n 1 96 GLU n 1 97 GLN n 1 98 ASN n 1 99 ILE n 1 100 ASN n 1 101 GLU n 1 102 ARG n 1 103 LEU n 1 104 ASN n 1 105 ILE n 1 106 GLY n 1 107 GLU n 1 108 PRO n 1 109 LEU n 1 110 LEU n 1 111 VAL n 1 112 TYR n 1 113 LEU n 1 114 ARG n 1 115 ARG n 1 116 GLN n 1 117 ASP n 1 118 LEU n 1 119 PRO n 1 120 GLU n 1 121 ILE n 1 122 THR n 1 123 ALA n 1 124 GLN n 1 125 ARG n 1 126 GLN n 1 127 LEU n 1 128 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Pseudomonas _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pseudomonas aeruginosa' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 287 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -21 ? ? ? A . n A 1 2 GLY 2 -20 ? ? ? A . n A 1 3 SER 3 -19 ? ? ? A . n A 1 4 SER 4 -18 ? ? ? A . n A 1 5 HIS 5 -17 ? ? ? A . n A 1 6 HIS 6 -16 ? ? ? A . n A 1 7 HIS 7 -15 ? ? ? A . n A 1 8 HIS 8 -14 ? ? ? A . n A 1 9 HIS 9 -13 ? ? ? A . n A 1 10 HIS 10 -12 ? ? ? A . n A 1 11 SER 11 -11 ? ? ? A . n A 1 12 SER 12 -10 ? ? ? A . n A 1 13 GLY 13 -9 ? ? ? A . n A 1 14 ARG 14 -8 ? ? ? A . n A 1 15 GLU 15 -7 ? ? ? A . n A 1 16 ASN 16 -6 ? ? ? A . n A 1 17 LEU 17 -5 ? ? ? A . n A 1 18 TYR 18 -4 ? ? ? A . n A 1 19 PHE 19 -3 ? ? ? A . n A 1 20 GLN 20 -2 ? ? ? A . n A 1 21 GLY 21 -1 ? ? ? A . n A 1 22 HIS 22 0 ? ? ? A . n A 1 23 MET 23 1 1 MET MET A . n A 1 24 SER 24 2 2 SER SER A . n A 1 25 ILE 25 3 3 ILE ILE A . n A 1 26 THR 26 4 4 THR THR A . n A 1 27 SER 27 5 5 SER SER A . n A 1 28 THR 28 6 6 THR THR A . n A 1 29 ASP 29 7 7 ASP ASP A . n A 1 30 ILE 30 8 8 ILE ILE A . n A 1 31 CYS 31 9 9 CYS CYS A . n A 1 32 GLN 32 10 10 GLN GLN A . n A 1 33 ALA 33 11 11 ALA ALA A . n A 1 34 ALA 34 12 12 ALA ALA A . n A 1 35 ASP 35 13 13 ASP ASP A . n A 1 36 ALA 36 14 14 ALA ALA A . n A 1 37 LEU 37 15 15 LEU LEU A . n A 1 38 LYS 38 16 16 LYS LYS A . n A 1 39 GLY 39 17 17 GLY GLY A . n A 1 40 PHE 40 18 18 PHE PHE A . n A 1 41 VAL 41 19 19 VAL VAL A . n A 1 42 GLY 42 20 20 GLY GLY A . n A 1 43 PHE 43 21 21 PHE PHE A . n A 1 44 ASN 44 22 22 ASN ASN A . n A 1 45 ARG 45 23 23 ARG ARG A . n A 1 46 LYS 46 24 24 LYS LYS A . n A 1 47 THR 47 25 25 THR THR A . n A 1 48 GLY 48 26 26 GLY GLY A . n A 1 49 ARG 49 27 27 ARG ARG A . n A 1 50 TYR 50 28 28 TYR TYR A . n A 1 51 ILE 51 29 29 ILE ILE A . n A 1 52 VAL 52 30 30 VAL VAL A . n A 1 53 ARG 53 31 31 ARG ARG A . n A 1 54 PHE 54 32 32 PHE PHE A . n A 1 55 SER 55 33 33 SER SER A . n A 1 56 GLU 56 34 34 GLU GLU A . n A 1 57 ASP 57 35 35 ASP ASP A . n A 1 58 SER 58 36 36 SER SER A . n A 1 59 PHE 59 37 37 PHE PHE A . n A 1 60 GLY 60 38 38 GLY GLY A . n A 1 61 MET 61 39 39 MET MET A . n A 1 62 ASP 62 40 40 ASP ASP A . n A 1 63 VAL 63 41 41 VAL VAL A . n A 1 64 ALA 64 42 42 ALA ALA A . n A 1 65 ASP 65 43 43 ASP ASP A . n A 1 66 ASP 66 44 44 ASP ASP A . n A 1 67 SER 67 45 45 SER SER A . n A 1 68 ILE 68 46 46 ILE ILE A . n A 1 69 THR 69 47 47 THR THR A . n A 1 70 PRO 70 48 48 PRO PRO A . n A 1 71 THR 71 49 49 THR THR A . n A 1 72 SER 72 50 50 SER SER A . n A 1 73 GLU 73 51 51 GLU GLU A . n A 1 74 PHE 74 52 52 PHE PHE A . n A 1 75 VAL 75 53 53 VAL VAL A . n A 1 76 TRP 76 54 54 TRP TRP A . n A 1 77 SER 77 55 55 SER SER A . n A 1 78 SER 78 56 56 SER SER A . n A 1 79 VAL 79 57 57 VAL VAL A . n A 1 80 ARG 80 58 58 ARG ARG A . n A 1 81 ASP 81 59 59 ASP ASP A . n A 1 82 ASP 82 60 60 ASP ASP A . n A 1 83 VAL 83 61 61 VAL VAL A . n A 1 84 MET 84 62 62 MET MET A . n A 1 85 ARG 85 63 63 ARG ARG A . n A 1 86 LEU 86 64 64 LEU LEU A . n A 1 87 GLY 87 65 65 GLY GLY A . n A 1 88 ARG 88 66 66 ARG ARG A . n A 1 89 GLU 89 67 67 GLU GLU A . n A 1 90 GLN 90 68 68 GLN GLN A . n A 1 91 LEU 91 69 69 LEU LEU A . n A 1 92 GLN 92 70 70 GLN GLN A . n A 1 93 ILE 93 71 71 ILE ILE A . n A 1 94 LEU 94 72 72 LEU LEU A . n A 1 95 LEU 95 73 73 LEU LEU A . n A 1 96 GLU 96 74 74 GLU GLU A . n A 1 97 GLN 97 75 75 GLN GLN A . n A 1 98 ASN 98 76 76 ASN ASN A . n A 1 99 ILE 99 77 77 ILE ILE A . n A 1 100 ASN 100 78 78 ASN ASN A . n A 1 101 GLU 101 79 79 GLU GLU A . n A 1 102 ARG 102 80 80 ARG ARG A . n A 1 103 LEU 103 81 81 LEU LEU A . n A 1 104 ASN 104 82 82 ASN ASN A . n A 1 105 ILE 105 83 83 ILE ILE A . n A 1 106 GLY 106 84 84 GLY GLY A . n A 1 107 GLU 107 85 85 GLU GLU A . n A 1 108 PRO 108 86 86 PRO PRO A . n A 1 109 LEU 109 87 87 LEU LEU A . n A 1 110 LEU 110 88 88 LEU LEU A . n A 1 111 VAL 111 89 89 VAL VAL A . n A 1 112 TYR 112 90 90 TYR TYR A . n A 1 113 LEU 113 91 91 LEU LEU A . n A 1 114 ARG 114 92 92 ARG ARG A . n A 1 115 ARG 115 93 93 ARG ARG A . n A 1 116 GLN 116 94 94 GLN GLN A . n A 1 117 ASP 117 95 95 ASP ASP A . n A 1 118 LEU 118 96 96 LEU LEU A . n A 1 119 PRO 119 97 97 PRO PRO A . n A 1 120 GLU 120 98 98 GLU GLU A . n A 1 121 ILE 121 99 99 ILE ILE A . n A 1 122 THR 122 100 100 THR THR A . n A 1 123 ALA 123 101 101 ALA ALA A . n A 1 124 GLN 124 102 102 GLN GLN A . n A 1 125 ARG 125 103 103 ARG ARG A . n A 1 126 GLN 126 104 104 GLN GLN A . n A 1 127 LEU 127 105 105 LEU LEU A . n A 1 128 ARG 128 106 106 ARG ARG A . n # _cell.entry_id 2HG6 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2HG6 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 2HG6 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _database_PDB_matrix.entry_id 2HG6 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2HG6 _struct.title ;Solution NMR Structure of Protein PA1123 from Pseudomonas aeruginosa. Northeast Structural Genomics Consortium Target PaT4; Ontario Centre for Structural Proteomics Target PA1123. ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2HG6 _struct_keywords.pdbx_keywords 'Structural Genomics, Unknown Function' _struct_keywords.text ;hypothetical protein Pseudomonas aeruginosa, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, Unknown Function ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9I4L2_PSEAE _struct_ref.pdbx_db_accession Q9I4L2 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2HG6 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 23 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 128 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9I4L2 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 106 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 106 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2HG6 MET A 1 ? UNP Q9I4L2 ? ? 'cloning artifact' -21 1 1 2HG6 GLY A 2 ? UNP Q9I4L2 ? ? 'cloning artifact' -20 2 1 2HG6 SER A 3 ? UNP Q9I4L2 ? ? 'cloning artifact' -19 3 1 2HG6 SER A 4 ? UNP Q9I4L2 ? ? 'cloning artifact' -18 4 1 2HG6 HIS A 5 ? UNP Q9I4L2 ? ? 'expression tag' -17 5 1 2HG6 HIS A 6 ? UNP Q9I4L2 ? ? 'expression tag' -16 6 1 2HG6 HIS A 7 ? UNP Q9I4L2 ? ? 'expression tag' -15 7 1 2HG6 HIS A 8 ? UNP Q9I4L2 ? ? 'expression tag' -14 8 1 2HG6 HIS A 9 ? UNP Q9I4L2 ? ? 'expression tag' -13 9 1 2HG6 HIS A 10 ? UNP Q9I4L2 ? ? 'expression tag' -12 10 1 2HG6 SER A 11 ? UNP Q9I4L2 ? ? 'cloning artifact' -11 11 1 2HG6 SER A 12 ? UNP Q9I4L2 ? ? 'cloning artifact' -10 12 1 2HG6 GLY A 13 ? UNP Q9I4L2 ? ? 'cloning artifact' -9 13 1 2HG6 ARG A 14 ? UNP Q9I4L2 ? ? 'cloning artifact' -8 14 1 2HG6 GLU A 15 ? UNP Q9I4L2 ? ? 'cloning artifact' -7 15 1 2HG6 ASN A 16 ? UNP Q9I4L2 ? ? 'cloning artifact' -6 16 1 2HG6 LEU A 17 ? UNP Q9I4L2 ? ? 'cloning artifact' -5 17 1 2HG6 TYR A 18 ? UNP Q9I4L2 ? ? 'cloning artifact' -4 18 1 2HG6 PHE A 19 ? UNP Q9I4L2 ? ? 'cloning artifact' -3 19 1 2HG6 GLN A 20 ? UNP Q9I4L2 ? ? 'cloning artifact' -2 20 1 2HG6 GLY A 21 ? UNP Q9I4L2 ? ? 'cloning artifact' -1 21 1 2HG6 HIS A 22 ? UNP Q9I4L2 ? ? 'cloning artifact' 0 22 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 27 ? ALA A 36 ? SER A 5 ALA A 14 5 ? 10 HELX_P HELX_P2 2 SER A 55 ? PHE A 59 ? SER A 33 PHE A 37 5 ? 5 HELX_P HELX_P3 3 ALA A 64 ? ILE A 68 ? ALA A 42 ILE A 46 5 ? 5 HELX_P HELX_P4 4 THR A 71 ? VAL A 75 ? THR A 49 VAL A 53 1 ? 5 HELX_P HELX_P5 5 GLU A 89 ? ASN A 98 ? GLU A 67 ASN A 76 1 ? 10 HELX_P HELX_P6 6 ILE A 99 ? ASN A 104 ? ILE A 77 ASN A 82 1 ? 6 HELX_P HELX_P7 7 GLY A 106 ? LEU A 113 ? GLY A 84 LEU A 91 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ARG A 49 ? ARG A 53 ? ARG A 27 ARG A 31 A 2 PHE A 40 ? ASN A 44 ? PHE A 18 ASN A 22 A 3 THR A 69 ? PRO A 70 ? THR A 47 PRO A 48 B 1 TRP A 76 ? SER A 78 ? TRP A 54 SER A 56 B 2 VAL A 83 ? LEU A 86 ? VAL A 61 LEU A 64 B 3 THR A 122 ? GLN A 124 ? THR A 100 GLN A 102 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ILE A 51 ? O ILE A 29 N GLY A 42 ? N GLY A 20 A 2 3 N VAL A 41 ? N VAL A 19 O THR A 69 ? O THR A 47 B 1 2 N SER A 77 ? N SER A 55 O ARG A 85 ? O ARG A 63 B 2 3 N MET A 84 ? N MET A 62 O ALA A 123 ? O ALA A 101 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 6 HG A LEU 81 ? ? HD13 A ILE 83 ? ? 1.23 2 6 OD1 A ASP 59 ? ? H A ASP 60 ? ? 1.57 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 58 ? ? -122.63 -168.22 2 1 ASN A 82 ? ? 64.82 62.47 3 1 ARG A 92 ? ? -100.58 -70.38 4 2 ASN A 76 ? ? 71.96 -34.15 5 2 ILE A 77 ? ? -80.50 46.48 6 3 ASP A 40 ? ? -172.30 -41.55 7 3 ASN A 76 ? ? 74.39 -11.08 8 3 ARG A 93 ? ? -175.64 128.22 9 5 ASP A 95 ? ? -61.57 -71.90 10 6 ARG A 58 ? ? -168.62 -78.10 11 6 ASP A 59 ? ? -161.03 -66.14 12 6 ASP A 95 ? ? -144.71 -58.46 13 6 ARG A 103 ? ? -90.64 57.15 14 7 SER A 5 ? ? -75.44 -169.18 15 7 ASP A 59 ? ? -56.51 -70.77 16 7 ILE A 77 ? ? -112.99 54.01 17 7 ASN A 82 ? ? 67.12 63.81 18 7 GLU A 98 ? ? -173.91 125.31 19 8 ASN A 76 ? ? 75.95 -30.19 20 8 ASN A 82 ? ? 64.73 86.57 21 8 GLN A 104 ? ? 66.59 146.67 22 9 SER A 5 ? ? -77.17 -169.73 23 10 SER A 5 ? ? -75.59 -169.90 24 10 ARG A 58 ? ? -161.25 108.49 25 10 ASP A 59 ? ? 55.93 -92.80 26 10 ILE A 77 ? ? -117.07 55.21 27 10 ASN A 82 ? ? 62.84 83.87 28 11 ASN A 82 ? ? 65.26 72.08 29 12 SER A 5 ? ? -69.75 -168.42 30 12 ARG A 58 ? ? -166.39 -77.28 31 12 ASP A 59 ? ? -135.97 -87.11 32 12 ASN A 76 ? ? -79.75 35.13 33 12 ILE A 77 ? ? -93.81 53.15 34 12 ASN A 82 ? ? 64.13 85.49 35 12 ARG A 93 ? ? -166.86 115.06 36 13 ARG A 58 ? ? -146.11 -75.37 37 13 ASP A 59 ? ? 163.16 -53.81 38 14 SER A 5 ? ? -78.97 -168.36 39 14 ASN A 82 ? ? 77.41 34.82 40 15 ARG A 58 ? ? -164.86 -151.58 41 15 ILE A 77 ? ? -105.15 40.17 42 15 ASN A 82 ? ? 61.16 73.66 43 15 GLN A 104 ? ? -69.57 97.35 44 16 ASP A 59 ? ? 51.82 -102.61 45 16 ASN A 82 ? ? 63.83 85.24 46 17 ARG A 58 ? ? -113.38 -73.34 47 17 ASP A 59 ? ? -170.13 -64.39 48 17 ASN A 82 ? ? 70.98 76.97 49 18 SER A 5 ? ? -65.41 -172.11 50 18 ARG A 58 ? ? -149.03 -154.14 51 19 SER A 5 ? ? -79.47 -169.87 52 19 PHE A 32 ? ? -94.52 39.89 53 19 PHE A 37 ? ? -108.58 -64.53 54 19 ARG A 58 ? ? -163.88 -162.34 55 19 ASN A 76 ? ? 78.29 -12.67 56 19 ASN A 82 ? ? 66.95 80.13 57 20 ASP A 40 ? ? 69.17 -56.55 58 20 GLU A 98 ? ? -91.95 47.79 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.initial_of_center NESG # _pdbx_nmr_ensemble.entry_id 2HG6 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2HG6 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'fewest violations,lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 ;1mM Protein, U-15N,13C; 10 mM Phosphate Buffer;400mM NaCl;10mM DTT; 0.01% NaN3; 1mM Benzamidine; 1X protease; inhibitor cocktail; 95% H2O+5% D2O ; '95% H2O/5% D2O' 2 'Phosphate Buffer;400mM NaCl;10mM DTT; 0.01% NaN3; 1mM Benzamidine; 1X protease inhibitor cocktail; 100% D2O' '100% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 300 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength '400 mM NaCl, 10 mM Phosphate' _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 '3D N15/13C time shared NOESY' 1 2 1 3D_13C-separated_NOESY 2 3 1 4D_13C-separated_NOESY 2 # _pdbx_nmr_refine.entry_id 2HG6 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;1887 NOE distance constraints 22 Hydrogen bond constraints 122 Angle restraints ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal processing NMRPipe 2.3 'Delaglio, F. etal' 1 'data analysis' Sparky 3.106 'Goddar, T.D. and Kneller, D.G. UCSF' 2 'structure solution' CYANA 2.1 'Gunter, P.' 3 refinement CNS 1.1 'Brunger, A.T. etal' 4 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -21 ? A MET 1 2 1 Y 1 A GLY -20 ? A GLY 2 3 1 Y 1 A SER -19 ? A SER 3 4 1 Y 1 A SER -18 ? A SER 4 5 1 Y 1 A HIS -17 ? A HIS 5 6 1 Y 1 A HIS -16 ? A HIS 6 7 1 Y 1 A HIS -15 ? A HIS 7 8 1 Y 1 A HIS -14 ? A HIS 8 9 1 Y 1 A HIS -13 ? A HIS 9 10 1 Y 1 A HIS -12 ? A HIS 10 11 1 Y 1 A SER -11 ? A SER 11 12 1 Y 1 A SER -10 ? A SER 12 13 1 Y 1 A GLY -9 ? A GLY 13 14 1 Y 1 A ARG -8 ? A ARG 14 15 1 Y 1 A GLU -7 ? A GLU 15 16 1 Y 1 A ASN -6 ? A ASN 16 17 1 Y 1 A LEU -5 ? A LEU 17 18 1 Y 1 A TYR -4 ? A TYR 18 19 1 Y 1 A PHE -3 ? A PHE 19 20 1 Y 1 A GLN -2 ? A GLN 20 21 1 Y 1 A GLY -1 ? A GLY 21 22 1 Y 1 A HIS 0 ? A HIS 22 23 2 Y 1 A MET -21 ? A MET 1 24 2 Y 1 A GLY -20 ? A GLY 2 25 2 Y 1 A SER -19 ? A SER 3 26 2 Y 1 A SER -18 ? A SER 4 27 2 Y 1 A HIS -17 ? A HIS 5 28 2 Y 1 A HIS -16 ? A HIS 6 29 2 Y 1 A HIS -15 ? A HIS 7 30 2 Y 1 A HIS -14 ? A HIS 8 31 2 Y 1 A HIS -13 ? A HIS 9 32 2 Y 1 A HIS -12 ? A HIS 10 33 2 Y 1 A SER -11 ? A SER 11 34 2 Y 1 A SER -10 ? A SER 12 35 2 Y 1 A GLY -9 ? A GLY 13 36 2 Y 1 A ARG -8 ? A ARG 14 37 2 Y 1 A GLU -7 ? A GLU 15 38 2 Y 1 A ASN -6 ? A ASN 16 39 2 Y 1 A LEU -5 ? A LEU 17 40 2 Y 1 A TYR -4 ? A TYR 18 41 2 Y 1 A PHE -3 ? A PHE 19 42 2 Y 1 A GLN -2 ? A GLN 20 43 2 Y 1 A GLY -1 ? A GLY 21 44 2 Y 1 A HIS 0 ? A HIS 22 45 3 Y 1 A MET -21 ? A MET 1 46 3 Y 1 A GLY -20 ? A GLY 2 47 3 Y 1 A SER -19 ? A SER 3 48 3 Y 1 A SER -18 ? A SER 4 49 3 Y 1 A HIS -17 ? A HIS 5 50 3 Y 1 A HIS -16 ? A HIS 6 51 3 Y 1 A HIS -15 ? A HIS 7 52 3 Y 1 A HIS -14 ? A HIS 8 53 3 Y 1 A HIS -13 ? A HIS 9 54 3 Y 1 A HIS -12 ? A HIS 10 55 3 Y 1 A SER -11 ? A SER 11 56 3 Y 1 A SER -10 ? A SER 12 57 3 Y 1 A GLY -9 ? A GLY 13 58 3 Y 1 A ARG -8 ? A ARG 14 59 3 Y 1 A GLU -7 ? A GLU 15 60 3 Y 1 A ASN -6 ? A ASN 16 61 3 Y 1 A LEU -5 ? A LEU 17 62 3 Y 1 A TYR -4 ? A TYR 18 63 3 Y 1 A PHE -3 ? A PHE 19 64 3 Y 1 A GLN -2 ? A GLN 20 65 3 Y 1 A GLY -1 ? A GLY 21 66 3 Y 1 A HIS 0 ? A HIS 22 67 4 Y 1 A MET -21 ? A MET 1 68 4 Y 1 A GLY -20 ? A GLY 2 69 4 Y 1 A SER -19 ? A SER 3 70 4 Y 1 A SER -18 ? A SER 4 71 4 Y 1 A HIS -17 ? A HIS 5 72 4 Y 1 A HIS -16 ? A HIS 6 73 4 Y 1 A HIS -15 ? A HIS 7 74 4 Y 1 A HIS -14 ? A HIS 8 75 4 Y 1 A HIS -13 ? A HIS 9 76 4 Y 1 A HIS -12 ? A HIS 10 77 4 Y 1 A SER -11 ? A SER 11 78 4 Y 1 A SER -10 ? A SER 12 79 4 Y 1 A GLY -9 ? A GLY 13 80 4 Y 1 A ARG -8 ? A ARG 14 81 4 Y 1 A GLU -7 ? A GLU 15 82 4 Y 1 A ASN -6 ? A ASN 16 83 4 Y 1 A LEU -5 ? A LEU 17 84 4 Y 1 A TYR -4 ? A TYR 18 85 4 Y 1 A PHE -3 ? A PHE 19 86 4 Y 1 A GLN -2 ? A GLN 20 87 4 Y 1 A GLY -1 ? A GLY 21 88 4 Y 1 A HIS 0 ? A HIS 22 89 5 Y 1 A MET -21 ? A MET 1 90 5 Y 1 A GLY -20 ? A GLY 2 91 5 Y 1 A SER -19 ? A SER 3 92 5 Y 1 A SER -18 ? A SER 4 93 5 Y 1 A HIS -17 ? A HIS 5 94 5 Y 1 A HIS -16 ? A HIS 6 95 5 Y 1 A HIS -15 ? A HIS 7 96 5 Y 1 A HIS -14 ? A HIS 8 97 5 Y 1 A HIS -13 ? A HIS 9 98 5 Y 1 A HIS -12 ? A HIS 10 99 5 Y 1 A SER -11 ? A SER 11 100 5 Y 1 A SER -10 ? A SER 12 101 5 Y 1 A GLY -9 ? A GLY 13 102 5 Y 1 A ARG -8 ? A ARG 14 103 5 Y 1 A GLU -7 ? A GLU 15 104 5 Y 1 A ASN -6 ? A ASN 16 105 5 Y 1 A LEU -5 ? A LEU 17 106 5 Y 1 A TYR -4 ? A TYR 18 107 5 Y 1 A PHE -3 ? A PHE 19 108 5 Y 1 A GLN -2 ? A GLN 20 109 5 Y 1 A GLY -1 ? A GLY 21 110 5 Y 1 A HIS 0 ? A HIS 22 111 6 Y 1 A MET -21 ? A MET 1 112 6 Y 1 A GLY -20 ? A GLY 2 113 6 Y 1 A SER -19 ? A SER 3 114 6 Y 1 A SER -18 ? A SER 4 115 6 Y 1 A HIS -17 ? A HIS 5 116 6 Y 1 A HIS -16 ? A HIS 6 117 6 Y 1 A HIS -15 ? A HIS 7 118 6 Y 1 A HIS -14 ? A HIS 8 119 6 Y 1 A HIS -13 ? A HIS 9 120 6 Y 1 A HIS -12 ? A HIS 10 121 6 Y 1 A SER -11 ? A SER 11 122 6 Y 1 A SER -10 ? A SER 12 123 6 Y 1 A GLY -9 ? A GLY 13 124 6 Y 1 A ARG -8 ? A ARG 14 125 6 Y 1 A GLU -7 ? A GLU 15 126 6 Y 1 A ASN -6 ? A ASN 16 127 6 Y 1 A LEU -5 ? A LEU 17 128 6 Y 1 A TYR -4 ? A TYR 18 129 6 Y 1 A PHE -3 ? A PHE 19 130 6 Y 1 A GLN -2 ? A GLN 20 131 6 Y 1 A GLY -1 ? A GLY 21 132 6 Y 1 A HIS 0 ? A HIS 22 133 7 Y 1 A MET -21 ? A MET 1 134 7 Y 1 A GLY -20 ? A GLY 2 135 7 Y 1 A SER -19 ? A SER 3 136 7 Y 1 A SER -18 ? A SER 4 137 7 Y 1 A HIS -17 ? A HIS 5 138 7 Y 1 A HIS -16 ? A HIS 6 139 7 Y 1 A HIS -15 ? A HIS 7 140 7 Y 1 A HIS -14 ? A HIS 8 141 7 Y 1 A HIS -13 ? A HIS 9 142 7 Y 1 A HIS -12 ? A HIS 10 143 7 Y 1 A SER -11 ? A SER 11 144 7 Y 1 A SER -10 ? A SER 12 145 7 Y 1 A GLY -9 ? A GLY 13 146 7 Y 1 A ARG -8 ? A ARG 14 147 7 Y 1 A GLU -7 ? A GLU 15 148 7 Y 1 A ASN -6 ? A ASN 16 149 7 Y 1 A LEU -5 ? A LEU 17 150 7 Y 1 A TYR -4 ? A TYR 18 151 7 Y 1 A PHE -3 ? A PHE 19 152 7 Y 1 A GLN -2 ? A GLN 20 153 7 Y 1 A GLY -1 ? A GLY 21 154 7 Y 1 A HIS 0 ? A HIS 22 155 8 Y 1 A MET -21 ? A MET 1 156 8 Y 1 A GLY -20 ? A GLY 2 157 8 Y 1 A SER -19 ? A SER 3 158 8 Y 1 A SER -18 ? A SER 4 159 8 Y 1 A HIS -17 ? A HIS 5 160 8 Y 1 A HIS -16 ? A HIS 6 161 8 Y 1 A HIS -15 ? A HIS 7 162 8 Y 1 A HIS -14 ? A HIS 8 163 8 Y 1 A HIS -13 ? A HIS 9 164 8 Y 1 A HIS -12 ? A HIS 10 165 8 Y 1 A SER -11 ? A SER 11 166 8 Y 1 A SER -10 ? A SER 12 167 8 Y 1 A GLY -9 ? A GLY 13 168 8 Y 1 A ARG -8 ? A ARG 14 169 8 Y 1 A GLU -7 ? A GLU 15 170 8 Y 1 A ASN -6 ? A ASN 16 171 8 Y 1 A LEU -5 ? A LEU 17 172 8 Y 1 A TYR -4 ? A TYR 18 173 8 Y 1 A PHE -3 ? A PHE 19 174 8 Y 1 A GLN -2 ? A GLN 20 175 8 Y 1 A GLY -1 ? A GLY 21 176 8 Y 1 A HIS 0 ? A HIS 22 177 9 Y 1 A MET -21 ? A MET 1 178 9 Y 1 A GLY -20 ? A GLY 2 179 9 Y 1 A SER -19 ? A SER 3 180 9 Y 1 A SER -18 ? A SER 4 181 9 Y 1 A HIS -17 ? A HIS 5 182 9 Y 1 A HIS -16 ? A HIS 6 183 9 Y 1 A HIS -15 ? A HIS 7 184 9 Y 1 A HIS -14 ? A HIS 8 185 9 Y 1 A HIS -13 ? A HIS 9 186 9 Y 1 A HIS -12 ? A HIS 10 187 9 Y 1 A SER -11 ? A SER 11 188 9 Y 1 A SER -10 ? A SER 12 189 9 Y 1 A GLY -9 ? A GLY 13 190 9 Y 1 A ARG -8 ? A ARG 14 191 9 Y 1 A GLU -7 ? A GLU 15 192 9 Y 1 A ASN -6 ? A ASN 16 193 9 Y 1 A LEU -5 ? A LEU 17 194 9 Y 1 A TYR -4 ? A TYR 18 195 9 Y 1 A PHE -3 ? A PHE 19 196 9 Y 1 A GLN -2 ? A GLN 20 197 9 Y 1 A GLY -1 ? A GLY 21 198 9 Y 1 A HIS 0 ? A HIS 22 199 10 Y 1 A MET -21 ? A MET 1 200 10 Y 1 A GLY -20 ? A GLY 2 201 10 Y 1 A SER -19 ? A SER 3 202 10 Y 1 A SER -18 ? A SER 4 203 10 Y 1 A HIS -17 ? A HIS 5 204 10 Y 1 A HIS -16 ? A HIS 6 205 10 Y 1 A HIS -15 ? A HIS 7 206 10 Y 1 A HIS -14 ? A HIS 8 207 10 Y 1 A HIS -13 ? A HIS 9 208 10 Y 1 A HIS -12 ? A HIS 10 209 10 Y 1 A SER -11 ? A SER 11 210 10 Y 1 A SER -10 ? A SER 12 211 10 Y 1 A GLY -9 ? A GLY 13 212 10 Y 1 A ARG -8 ? A ARG 14 213 10 Y 1 A GLU -7 ? A GLU 15 214 10 Y 1 A ASN -6 ? A ASN 16 215 10 Y 1 A LEU -5 ? A LEU 17 216 10 Y 1 A TYR -4 ? A TYR 18 217 10 Y 1 A PHE -3 ? A PHE 19 218 10 Y 1 A GLN -2 ? A GLN 20 219 10 Y 1 A GLY -1 ? A GLY 21 220 10 Y 1 A HIS 0 ? A HIS 22 221 11 Y 1 A MET -21 ? A MET 1 222 11 Y 1 A GLY -20 ? A GLY 2 223 11 Y 1 A SER -19 ? A SER 3 224 11 Y 1 A SER -18 ? A SER 4 225 11 Y 1 A HIS -17 ? A HIS 5 226 11 Y 1 A HIS -16 ? A HIS 6 227 11 Y 1 A HIS -15 ? A HIS 7 228 11 Y 1 A HIS -14 ? A HIS 8 229 11 Y 1 A HIS -13 ? A HIS 9 230 11 Y 1 A HIS -12 ? A HIS 10 231 11 Y 1 A SER -11 ? A SER 11 232 11 Y 1 A SER -10 ? A SER 12 233 11 Y 1 A GLY -9 ? A GLY 13 234 11 Y 1 A ARG -8 ? A ARG 14 235 11 Y 1 A GLU -7 ? A GLU 15 236 11 Y 1 A ASN -6 ? A ASN 16 237 11 Y 1 A LEU -5 ? A LEU 17 238 11 Y 1 A TYR -4 ? A TYR 18 239 11 Y 1 A PHE -3 ? A PHE 19 240 11 Y 1 A GLN -2 ? A GLN 20 241 11 Y 1 A GLY -1 ? A GLY 21 242 11 Y 1 A HIS 0 ? A HIS 22 243 12 Y 1 A MET -21 ? A MET 1 244 12 Y 1 A GLY -20 ? A GLY 2 245 12 Y 1 A SER -19 ? A SER 3 246 12 Y 1 A SER -18 ? A SER 4 247 12 Y 1 A HIS -17 ? A HIS 5 248 12 Y 1 A HIS -16 ? A HIS 6 249 12 Y 1 A HIS -15 ? A HIS 7 250 12 Y 1 A HIS -14 ? A HIS 8 251 12 Y 1 A HIS -13 ? A HIS 9 252 12 Y 1 A HIS -12 ? A HIS 10 253 12 Y 1 A SER -11 ? A SER 11 254 12 Y 1 A SER -10 ? A SER 12 255 12 Y 1 A GLY -9 ? A GLY 13 256 12 Y 1 A ARG -8 ? A ARG 14 257 12 Y 1 A GLU -7 ? A GLU 15 258 12 Y 1 A ASN -6 ? A ASN 16 259 12 Y 1 A LEU -5 ? A LEU 17 260 12 Y 1 A TYR -4 ? A TYR 18 261 12 Y 1 A PHE -3 ? A PHE 19 262 12 Y 1 A GLN -2 ? A GLN 20 263 12 Y 1 A GLY -1 ? A GLY 21 264 12 Y 1 A HIS 0 ? A HIS 22 265 13 Y 1 A MET -21 ? A MET 1 266 13 Y 1 A GLY -20 ? A GLY 2 267 13 Y 1 A SER -19 ? A SER 3 268 13 Y 1 A SER -18 ? A SER 4 269 13 Y 1 A HIS -17 ? A HIS 5 270 13 Y 1 A HIS -16 ? A HIS 6 271 13 Y 1 A HIS -15 ? A HIS 7 272 13 Y 1 A HIS -14 ? A HIS 8 273 13 Y 1 A HIS -13 ? A HIS 9 274 13 Y 1 A HIS -12 ? A HIS 10 275 13 Y 1 A SER -11 ? A SER 11 276 13 Y 1 A SER -10 ? A SER 12 277 13 Y 1 A GLY -9 ? A GLY 13 278 13 Y 1 A ARG -8 ? A ARG 14 279 13 Y 1 A GLU -7 ? A GLU 15 280 13 Y 1 A ASN -6 ? A ASN 16 281 13 Y 1 A LEU -5 ? A LEU 17 282 13 Y 1 A TYR -4 ? A TYR 18 283 13 Y 1 A PHE -3 ? A PHE 19 284 13 Y 1 A GLN -2 ? A GLN 20 285 13 Y 1 A GLY -1 ? A GLY 21 286 13 Y 1 A HIS 0 ? A HIS 22 287 14 Y 1 A MET -21 ? A MET 1 288 14 Y 1 A GLY -20 ? A GLY 2 289 14 Y 1 A SER -19 ? A SER 3 290 14 Y 1 A SER -18 ? A SER 4 291 14 Y 1 A HIS -17 ? A HIS 5 292 14 Y 1 A HIS -16 ? A HIS 6 293 14 Y 1 A HIS -15 ? A HIS 7 294 14 Y 1 A HIS -14 ? A HIS 8 295 14 Y 1 A HIS -13 ? A HIS 9 296 14 Y 1 A HIS -12 ? A HIS 10 297 14 Y 1 A SER -11 ? A SER 11 298 14 Y 1 A SER -10 ? A SER 12 299 14 Y 1 A GLY -9 ? A GLY 13 300 14 Y 1 A ARG -8 ? A ARG 14 301 14 Y 1 A GLU -7 ? A GLU 15 302 14 Y 1 A ASN -6 ? A ASN 16 303 14 Y 1 A LEU -5 ? A LEU 17 304 14 Y 1 A TYR -4 ? A TYR 18 305 14 Y 1 A PHE -3 ? A PHE 19 306 14 Y 1 A GLN -2 ? A GLN 20 307 14 Y 1 A GLY -1 ? A GLY 21 308 14 Y 1 A HIS 0 ? A HIS 22 309 15 Y 1 A MET -21 ? A MET 1 310 15 Y 1 A GLY -20 ? A GLY 2 311 15 Y 1 A SER -19 ? A SER 3 312 15 Y 1 A SER -18 ? A SER 4 313 15 Y 1 A HIS -17 ? A HIS 5 314 15 Y 1 A HIS -16 ? A HIS 6 315 15 Y 1 A HIS -15 ? A HIS 7 316 15 Y 1 A HIS -14 ? A HIS 8 317 15 Y 1 A HIS -13 ? A HIS 9 318 15 Y 1 A HIS -12 ? A HIS 10 319 15 Y 1 A SER -11 ? A SER 11 320 15 Y 1 A SER -10 ? A SER 12 321 15 Y 1 A GLY -9 ? A GLY 13 322 15 Y 1 A ARG -8 ? A ARG 14 323 15 Y 1 A GLU -7 ? A GLU 15 324 15 Y 1 A ASN -6 ? A ASN 16 325 15 Y 1 A LEU -5 ? A LEU 17 326 15 Y 1 A TYR -4 ? A TYR 18 327 15 Y 1 A PHE -3 ? A PHE 19 328 15 Y 1 A GLN -2 ? A GLN 20 329 15 Y 1 A GLY -1 ? A GLY 21 330 15 Y 1 A HIS 0 ? A HIS 22 331 16 Y 1 A MET -21 ? A MET 1 332 16 Y 1 A GLY -20 ? A GLY 2 333 16 Y 1 A SER -19 ? A SER 3 334 16 Y 1 A SER -18 ? A SER 4 335 16 Y 1 A HIS -17 ? A HIS 5 336 16 Y 1 A HIS -16 ? A HIS 6 337 16 Y 1 A HIS -15 ? A HIS 7 338 16 Y 1 A HIS -14 ? A HIS 8 339 16 Y 1 A HIS -13 ? A HIS 9 340 16 Y 1 A HIS -12 ? A HIS 10 341 16 Y 1 A SER -11 ? A SER 11 342 16 Y 1 A SER -10 ? A SER 12 343 16 Y 1 A GLY -9 ? A GLY 13 344 16 Y 1 A ARG -8 ? A ARG 14 345 16 Y 1 A GLU -7 ? A GLU 15 346 16 Y 1 A ASN -6 ? A ASN 16 347 16 Y 1 A LEU -5 ? A LEU 17 348 16 Y 1 A TYR -4 ? A TYR 18 349 16 Y 1 A PHE -3 ? A PHE 19 350 16 Y 1 A GLN -2 ? A GLN 20 351 16 Y 1 A GLY -1 ? A GLY 21 352 16 Y 1 A HIS 0 ? A HIS 22 353 17 Y 1 A MET -21 ? A MET 1 354 17 Y 1 A GLY -20 ? A GLY 2 355 17 Y 1 A SER -19 ? A SER 3 356 17 Y 1 A SER -18 ? A SER 4 357 17 Y 1 A HIS -17 ? A HIS 5 358 17 Y 1 A HIS -16 ? A HIS 6 359 17 Y 1 A HIS -15 ? A HIS 7 360 17 Y 1 A HIS -14 ? A HIS 8 361 17 Y 1 A HIS -13 ? A HIS 9 362 17 Y 1 A HIS -12 ? A HIS 10 363 17 Y 1 A SER -11 ? A SER 11 364 17 Y 1 A SER -10 ? A SER 12 365 17 Y 1 A GLY -9 ? A GLY 13 366 17 Y 1 A ARG -8 ? A ARG 14 367 17 Y 1 A GLU -7 ? A GLU 15 368 17 Y 1 A ASN -6 ? A ASN 16 369 17 Y 1 A LEU -5 ? A LEU 17 370 17 Y 1 A TYR -4 ? A TYR 18 371 17 Y 1 A PHE -3 ? A PHE 19 372 17 Y 1 A GLN -2 ? A GLN 20 373 17 Y 1 A GLY -1 ? A GLY 21 374 17 Y 1 A HIS 0 ? A HIS 22 375 18 Y 1 A MET -21 ? A MET 1 376 18 Y 1 A GLY -20 ? A GLY 2 377 18 Y 1 A SER -19 ? A SER 3 378 18 Y 1 A SER -18 ? A SER 4 379 18 Y 1 A HIS -17 ? A HIS 5 380 18 Y 1 A HIS -16 ? A HIS 6 381 18 Y 1 A HIS -15 ? A HIS 7 382 18 Y 1 A HIS -14 ? A HIS 8 383 18 Y 1 A HIS -13 ? A HIS 9 384 18 Y 1 A HIS -12 ? A HIS 10 385 18 Y 1 A SER -11 ? A SER 11 386 18 Y 1 A SER -10 ? A SER 12 387 18 Y 1 A GLY -9 ? A GLY 13 388 18 Y 1 A ARG -8 ? A ARG 14 389 18 Y 1 A GLU -7 ? A GLU 15 390 18 Y 1 A ASN -6 ? A ASN 16 391 18 Y 1 A LEU -5 ? A LEU 17 392 18 Y 1 A TYR -4 ? A TYR 18 393 18 Y 1 A PHE -3 ? A PHE 19 394 18 Y 1 A GLN -2 ? A GLN 20 395 18 Y 1 A GLY -1 ? A GLY 21 396 18 Y 1 A HIS 0 ? A HIS 22 397 19 Y 1 A MET -21 ? A MET 1 398 19 Y 1 A GLY -20 ? A GLY 2 399 19 Y 1 A SER -19 ? A SER 3 400 19 Y 1 A SER -18 ? A SER 4 401 19 Y 1 A HIS -17 ? A HIS 5 402 19 Y 1 A HIS -16 ? A HIS 6 403 19 Y 1 A HIS -15 ? A HIS 7 404 19 Y 1 A HIS -14 ? A HIS 8 405 19 Y 1 A HIS -13 ? A HIS 9 406 19 Y 1 A HIS -12 ? A HIS 10 407 19 Y 1 A SER -11 ? A SER 11 408 19 Y 1 A SER -10 ? A SER 12 409 19 Y 1 A GLY -9 ? A GLY 13 410 19 Y 1 A ARG -8 ? A ARG 14 411 19 Y 1 A GLU -7 ? A GLU 15 412 19 Y 1 A ASN -6 ? A ASN 16 413 19 Y 1 A LEU -5 ? A LEU 17 414 19 Y 1 A TYR -4 ? A TYR 18 415 19 Y 1 A PHE -3 ? A PHE 19 416 19 Y 1 A GLN -2 ? A GLN 20 417 19 Y 1 A GLY -1 ? A GLY 21 418 19 Y 1 A HIS 0 ? A HIS 22 419 20 Y 1 A MET -21 ? A MET 1 420 20 Y 1 A GLY -20 ? A GLY 2 421 20 Y 1 A SER -19 ? A SER 3 422 20 Y 1 A SER -18 ? A SER 4 423 20 Y 1 A HIS -17 ? A HIS 5 424 20 Y 1 A HIS -16 ? A HIS 6 425 20 Y 1 A HIS -15 ? A HIS 7 426 20 Y 1 A HIS -14 ? A HIS 8 427 20 Y 1 A HIS -13 ? A HIS 9 428 20 Y 1 A HIS -12 ? A HIS 10 429 20 Y 1 A SER -11 ? A SER 11 430 20 Y 1 A SER -10 ? A SER 12 431 20 Y 1 A GLY -9 ? A GLY 13 432 20 Y 1 A ARG -8 ? A ARG 14 433 20 Y 1 A GLU -7 ? A GLU 15 434 20 Y 1 A ASN -6 ? A ASN 16 435 20 Y 1 A LEU -5 ? A LEU 17 436 20 Y 1 A TYR -4 ? A TYR 18 437 20 Y 1 A PHE -3 ? A PHE 19 438 20 Y 1 A GLN -2 ? A GLN 20 439 20 Y 1 A GLY -1 ? A GLY 21 440 20 Y 1 A HIS 0 ? A HIS 22 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 INOVA Varian 600 ? 2 AVANCE Bruker 600 ? # _atom_sites.entry_id 2HG6 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_