data_2HJM # _entry.id 2HJM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2HJM RCSB RCSB038418 WWPDB D_1000038418 # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id PF1176 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2HJM _pdbx_database_status.recvd_initial_deposition_date 2006-06-30 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Chen, L.Q.' 1 'Liu, Z.-J.' 2 'Rose, J.P.' 3 'Wang, B.-C.' 4 'Southeast Collaboratory for Structural Genomics (SECSG)' 5 # _citation.id primary _citation.title 'Crystal structure of a singleton protein PF1176 from P. furiosus' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Rose, J.P.' 1 primary 'Liu, Z.-J.' 2 primary 'Wang, B.-C.' 3 # _cell.entry_id 2HJM _cell.length_a 62.680 _cell.length_b 64.240 _cell.length_c 111.650 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 16 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2HJM _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Hypothetical protein PF1176' 12043.573 4 ? ? ? ? 2 water nat water 18.015 2 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;HHHHHH(MSE)DLVEKVKELCLELEEENLAKAIERFITLTHGIEKTRGEAFAKASIYGFLEGILTTLK(MSE)KYSNEKI ETLLNEVKTAREETEALLRKPRPPLLVDNDL ; _entity_poly.pdbx_seq_one_letter_code_can ;HHHHHHMDLVEKVKELCLELEEENLAKAIERFITLTHGIEKTRGEAFAKASIYGFLEGILTTLKMKYSNEKIETLLNEVK TAREETEALLRKPRPPLLVDNDL ; _entity_poly.pdbx_strand_id A,B,C,D _entity_poly.pdbx_target_identifier PF1176 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 HIS n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 MSE n 1 8 ASP n 1 9 LEU n 1 10 VAL n 1 11 GLU n 1 12 LYS n 1 13 VAL n 1 14 LYS n 1 15 GLU n 1 16 LEU n 1 17 CYS n 1 18 LEU n 1 19 GLU n 1 20 LEU n 1 21 GLU n 1 22 GLU n 1 23 GLU n 1 24 ASN n 1 25 LEU n 1 26 ALA n 1 27 LYS n 1 28 ALA n 1 29 ILE n 1 30 GLU n 1 31 ARG n 1 32 PHE n 1 33 ILE n 1 34 THR n 1 35 LEU n 1 36 THR n 1 37 HIS n 1 38 GLY n 1 39 ILE n 1 40 GLU n 1 41 LYS n 1 42 THR n 1 43 ARG n 1 44 GLY n 1 45 GLU n 1 46 ALA n 1 47 PHE n 1 48 ALA n 1 49 LYS n 1 50 ALA n 1 51 SER n 1 52 ILE n 1 53 TYR n 1 54 GLY n 1 55 PHE n 1 56 LEU n 1 57 GLU n 1 58 GLY n 1 59 ILE n 1 60 LEU n 1 61 THR n 1 62 THR n 1 63 LEU n 1 64 LYS n 1 65 MSE n 1 66 LYS n 1 67 TYR n 1 68 SER n 1 69 ASN n 1 70 GLU n 1 71 LYS n 1 72 ILE n 1 73 GLU n 1 74 THR n 1 75 LEU n 1 76 LEU n 1 77 ASN n 1 78 GLU n 1 79 VAL n 1 80 LYS n 1 81 THR n 1 82 ALA n 1 83 ARG n 1 84 GLU n 1 85 GLU n 1 86 THR n 1 87 GLU n 1 88 ALA n 1 89 LEU n 1 90 LEU n 1 91 ARG n 1 92 LYS n 1 93 PRO n 1 94 ARG n 1 95 PRO n 1 96 PRO n 1 97 LEU n 1 98 LEU n 1 99 VAL n 1 100 ASP n 1 101 ASN n 1 102 ASP n 1 103 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Pyrococcus _entity_src_gen.pdbx_gene_src_gene pf1176 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pyrococcus furiosus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2261 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pf1176 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8U1N0_PYRFU _struct_ref.pdbx_db_accession Q8U1N0 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MDLVEKVKELCLELEEENLAKAIERFITLTHGIEKTRGEAFAKASIYGFLEGILTTLKMKYSNEKIETLLNEVKTAREET EALLRKPRPPLLVDNDL ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2HJM A 7 ? 103 ? Q8U1N0 1 ? 97 ? 1 97 2 1 2HJM B 7 ? 103 ? Q8U1N0 1 ? 97 ? 1 97 3 1 2HJM C 7 ? 103 ? Q8U1N0 1 ? 97 ? 1 97 4 1 2HJM D 7 ? 103 ? Q8U1N0 1 ? 97 ? 1 97 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2HJM HIS A 1 ? UNP Q8U1N0 ? ? 'EXPRESSION TAG' -5 1 1 2HJM HIS A 2 ? UNP Q8U1N0 ? ? 'EXPRESSION TAG' -4 2 1 2HJM HIS A 3 ? UNP Q8U1N0 ? ? 'EXPRESSION TAG' -3 3 1 2HJM HIS A 4 ? UNP Q8U1N0 ? ? 'EXPRESSION TAG' -2 4 1 2HJM HIS A 5 ? UNP Q8U1N0 ? ? 'EXPRESSION TAG' -1 5 1 2HJM HIS A 6 ? UNP Q8U1N0 ? ? 'EXPRESSION TAG' 0 6 1 2HJM MSE A 7 ? UNP Q8U1N0 MET 1 'MODIFIED RESIDUE' 1 7 1 2HJM MSE A 65 ? UNP Q8U1N0 MET 59 'MODIFIED RESIDUE' 59 8 2 2HJM HIS B 1 ? UNP Q8U1N0 ? ? 'EXPRESSION TAG' -5 9 2 2HJM HIS B 2 ? UNP Q8U1N0 ? ? 'EXPRESSION TAG' -4 10 2 2HJM HIS B 3 ? UNP Q8U1N0 ? ? 'EXPRESSION TAG' -3 11 2 2HJM HIS B 4 ? UNP Q8U1N0 ? ? 'EXPRESSION TAG' -2 12 2 2HJM HIS B 5 ? UNP Q8U1N0 ? ? 'EXPRESSION TAG' -1 13 2 2HJM HIS B 6 ? UNP Q8U1N0 ? ? 'EXPRESSION TAG' 0 14 2 2HJM MSE B 7 ? UNP Q8U1N0 MET 1 'MODIFIED RESIDUE' 1 15 2 2HJM MSE B 65 ? UNP Q8U1N0 MET 59 'MODIFIED RESIDUE' 59 16 3 2HJM HIS C 1 ? UNP Q8U1N0 ? ? 'EXPRESSION TAG' -5 17 3 2HJM HIS C 2 ? UNP Q8U1N0 ? ? 'EXPRESSION TAG' -4 18 3 2HJM HIS C 3 ? UNP Q8U1N0 ? ? 'EXPRESSION TAG' -3 19 3 2HJM HIS C 4 ? UNP Q8U1N0 ? ? 'EXPRESSION TAG' -2 20 3 2HJM HIS C 5 ? UNP Q8U1N0 ? ? 'EXPRESSION TAG' -1 21 3 2HJM HIS C 6 ? UNP Q8U1N0 ? ? 'EXPRESSION TAG' 0 22 3 2HJM MSE C 7 ? UNP Q8U1N0 MET 1 'MODIFIED RESIDUE' 1 23 3 2HJM MSE C 65 ? UNP Q8U1N0 MET 59 'MODIFIED RESIDUE' 59 24 4 2HJM HIS D 1 ? UNP Q8U1N0 ? ? 'EXPRESSION TAG' -5 25 4 2HJM HIS D 2 ? UNP Q8U1N0 ? ? 'EXPRESSION TAG' -4 26 4 2HJM HIS D 3 ? UNP Q8U1N0 ? ? 'EXPRESSION TAG' -3 27 4 2HJM HIS D 4 ? UNP Q8U1N0 ? ? 'EXPRESSION TAG' -2 28 4 2HJM HIS D 5 ? UNP Q8U1N0 ? ? 'EXPRESSION TAG' -1 29 4 2HJM HIS D 6 ? UNP Q8U1N0 ? ? 'EXPRESSION TAG' 0 30 4 2HJM MSE D 7 ? UNP Q8U1N0 MET 1 'MODIFIED RESIDUE' 1 31 4 2HJM MSE D 65 ? UNP Q8U1N0 MET 59 'MODIFIED RESIDUE' 59 32 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2HJM _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.33 _exptl_crystal.density_percent_sol 47.26 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 5.2 _exptl_crystal_grow.pdbx_details '100mM Na3 Citrate pH 5.2, 30% PEG400, VAPOR DIFFUSION, temperature 298K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'MARMOSAIC 300 mm CCD' _diffrn_detector.pdbx_collection_date 2006-03-02 _diffrn_detector.details Rosenbaum # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator SI220 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9724 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 22-ID' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 22-ID _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.9724 # _reflns.entry_id 2HJM _reflns.observed_criterion_sigma_F 0 _reflns.observed_criterion_sigma_I 0. _reflns.d_resolution_high 2.7 _reflns.d_resolution_low 50 _reflns.number_all 12787 _reflns.number_obs 12787 _reflns.percent_possible_obs 99.9 _reflns.pdbx_Rmerge_I_obs 0.082 _reflns.pdbx_Rsym_value 0.082 _reflns.pdbx_netI_over_sigmaI 12.1 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 14.0 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.7 _reflns_shell.d_res_low 2.8 _reflns_shell.percent_possible_all 98.9 _reflns_shell.Rmerge_I_obs 0.649 _reflns_shell.pdbx_Rsym_value 0.6 _reflns_shell.meanI_over_sigI_obs 3.53 _reflns_shell.pdbx_redundancy 11.5 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 1242 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 2HJM _refine.ls_d_res_high 2.9 _refine.ls_d_res_low 30 _refine.pdbx_ls_sigma_F 0 _refine.pdbx_ls_sigma_I ? _refine.ls_number_reflns_all 19286 _refine.ls_number_reflns_obs 18779 _refine.ls_number_reflns_R_free 1437 _refine.ls_percent_reflns_obs 97.4 _refine.ls_R_factor_all 0.23 _refine.ls_R_factor_obs 0.23 _refine.ls_R_factor_R_work 0.2276 _refine.ls_R_factor_R_free 0.2789 _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_ls_cross_valid_method ? _refine.pdbx_R_Free_selection_details Random _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_isotropic_thermal_model ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.details ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_overall_ESU_R ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2585 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 2 _refine_hist.number_atoms_total 2587 _refine_hist.d_res_high 2.9 _refine_hist.d_res_low 30 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.0074 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.16 ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 2HJM _struct.title 'Crystal structure of a singleton protein PF1176 from P. furiosus' _struct.pdbx_descriptor 'Hypothetical protein PF1176' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2HJM _struct_keywords.pdbx_keywords 'structural genomics, unknown function' _struct_keywords.text ;Singleton protein pf1176, structural genomics, SECSG, PSI, Protein Structure Initiative, Southeast Collaboratory for Structural Genomics, unknown function ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 1 ? E N N 2 ? F N N 2 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 HIS A 5 ? GLU A 19 ? HIS A -1 GLU A 13 1 ? 15 HELX_P HELX_P2 2 GLU A 22 ? LEU A 35 ? GLU A 16 LEU A 29 1 ? 14 HELX_P HELX_P3 3 HIS A 37 ? GLY A 44 ? HIS A 31 GLY A 38 1 ? 8 HELX_P HELX_P4 4 GLY A 44 ? LYS A 64 ? GLY A 38 LYS A 58 1 ? 21 HELX_P HELX_P5 5 ASN A 69 ? ALA A 88 ? ASN A 63 ALA A 82 1 ? 20 HELX_P HELX_P6 6 HIS B 5 ? GLU B 19 ? HIS B -1 GLU B 13 1 ? 15 HELX_P HELX_P7 7 GLU B 22 ? THR B 36 ? GLU B 16 THR B 30 1 ? 15 HELX_P HELX_P8 8 GLY B 38 ? GLY B 44 ? GLY B 32 GLY B 38 1 ? 7 HELX_P HELX_P9 9 GLY B 44 ? LYS B 64 ? GLY B 38 LYS B 58 1 ? 21 HELX_P HELX_P10 10 ASN B 69 ? ALA B 88 ? ASN B 63 ALA B 82 1 ? 20 HELX_P HELX_P11 11 HIS C 5 ? LEU C 20 ? HIS C -1 LEU C 14 1 ? 16 HELX_P HELX_P12 12 GLU C 22 ? HIS C 37 ? GLU C 16 HIS C 31 1 ? 16 HELX_P HELX_P13 13 GLY C 38 ? GLY C 44 ? GLY C 32 GLY C 38 1 ? 7 HELX_P HELX_P14 14 GLY C 44 ? LYS C 64 ? GLY C 38 LYS C 58 1 ? 21 HELX_P HELX_P15 15 ASN C 69 ? ALA C 88 ? ASN C 63 ALA C 82 1 ? 20 HELX_P HELX_P16 16 HIS D 5 ? LEU D 20 ? HIS D -1 LEU D 14 1 ? 16 HELX_P HELX_P17 17 GLU D 22 ? THR D 36 ? GLU D 16 THR D 30 1 ? 15 HELX_P HELX_P18 18 GLY D 38 ? GLY D 44 ? GLY D 32 GLY D 38 1 ? 7 HELX_P HELX_P19 19 GLY D 44 ? TYR D 67 ? GLY D 38 TYR D 61 1 ? 24 HELX_P HELX_P20 20 ASN D 69 ? ALA D 88 ? ASN D 63 ALA D 82 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A HIS 6 C ? ? ? 1_555 A MSE 7 N ? ? A HIS 0 A MSE 1 1_555 ? ? ? ? ? ? ? 1.330 ? covale2 covale ? ? A MSE 7 C ? ? ? 1_555 A ASP 8 N ? ? A MSE 1 A ASP 2 1_555 ? ? ? ? ? ? ? 1.325 ? covale3 covale ? ? A LYS 64 C ? ? ? 1_555 A MSE 65 N ? ? A LYS 58 A MSE 59 1_555 ? ? ? ? ? ? ? 1.331 ? covale4 covale ? ? A MSE 65 C ? ? ? 1_555 A LYS 66 N ? ? A MSE 59 A LYS 60 1_555 ? ? ? ? ? ? ? 1.332 ? covale5 covale ? ? B HIS 6 C ? ? ? 1_555 B MSE 7 N ? ? B HIS 0 B MSE 1 1_555 ? ? ? ? ? ? ? 1.333 ? covale6 covale ? ? B MSE 7 C ? ? ? 1_555 B ASP 8 N ? ? B MSE 1 B ASP 2 1_555 ? ? ? ? ? ? ? 1.324 ? covale7 covale ? ? B LYS 64 C ? ? ? 1_555 B MSE 65 N ? ? B LYS 58 B MSE 59 1_555 ? ? ? ? ? ? ? 1.327 ? covale8 covale ? ? B MSE 65 C ? ? ? 1_555 B LYS 66 N ? ? B MSE 59 B LYS 60 1_555 ? ? ? ? ? ? ? 1.332 ? covale9 covale ? ? C HIS 6 C ? ? ? 1_555 C MSE 7 N ? ? C HIS 0 C MSE 1 1_555 ? ? ? ? ? ? ? 1.330 ? covale10 covale ? ? C MSE 7 C ? ? ? 1_555 C ASP 8 N ? ? C MSE 1 C ASP 2 1_555 ? ? ? ? ? ? ? 1.322 ? covale11 covale ? ? C LYS 64 C ? ? ? 1_555 C MSE 65 N ? ? C LYS 58 C MSE 59 1_555 ? ? ? ? ? ? ? 1.332 ? covale12 covale ? ? C MSE 65 C ? ? ? 1_555 C LYS 66 N ? ? C MSE 59 C LYS 60 1_555 ? ? ? ? ? ? ? 1.331 ? covale13 covale ? ? D HIS 6 C ? ? ? 1_555 D MSE 7 N ? ? D HIS 0 D MSE 1 1_555 ? ? ? ? ? ? ? 1.329 ? covale14 covale ? ? D MSE 7 C ? ? ? 1_555 D ASP 8 N ? ? D MSE 1 D ASP 2 1_555 ? ? ? ? ? ? ? 1.325 ? covale15 covale ? ? D LYS 64 C ? ? ? 1_555 D MSE 65 N ? ? D LYS 58 D MSE 59 1_555 ? ? ? ? ? ? ? 1.325 ? covale16 covale ? ? D MSE 65 C ? ? ? 1_555 D LYS 66 N ? ? D MSE 59 D LYS 60 1_555 ? ? ? ? ? ? ? 1.329 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _database_PDB_matrix.entry_id 2HJM _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2HJM _atom_sites.fract_transf_matrix[1][1] 0.015954 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015567 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008957 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 HIS 1 -5 -5 HIS HIS A . n A 1 2 HIS 2 -4 -4 HIS HIS A . n A 1 3 HIS 3 -3 -3 HIS HIS A . n A 1 4 HIS 4 -2 -2 HIS HIS A . n A 1 5 HIS 5 -1 -1 HIS HIS A . n A 1 6 HIS 6 0 0 HIS HIS A . n A 1 7 MSE 7 1 1 MSE MSE A . n A 1 8 ASP 8 2 2 ASP ASP A . n A 1 9 LEU 9 3 3 LEU LEU A . n A 1 10 VAL 10 4 4 VAL VAL A . n A 1 11 GLU 11 5 5 GLU GLU A . n A 1 12 LYS 12 6 6 LYS LYS A . n A 1 13 VAL 13 7 7 VAL VAL A . n A 1 14 LYS 14 8 8 LYS LYS A . n A 1 15 GLU 15 9 9 GLU GLU A . n A 1 16 LEU 16 10 10 LEU LEU A . n A 1 17 CYS 17 11 11 CYS CYS A . n A 1 18 LEU 18 12 12 LEU LEU A . n A 1 19 GLU 19 13 13 GLU GLU A . n A 1 20 LEU 20 14 14 LEU LEU A . n A 1 21 GLU 21 15 15 GLU GLU A . n A 1 22 GLU 22 16 16 GLU GLU A . n A 1 23 GLU 23 17 17 GLU GLU A . n A 1 24 ASN 24 18 18 ASN ASN A . n A 1 25 LEU 25 19 19 LEU LEU A . n A 1 26 ALA 26 20 20 ALA ALA A . n A 1 27 LYS 27 21 21 LYS LYS A . n A 1 28 ALA 28 22 22 ALA ALA A . n A 1 29 ILE 29 23 23 ILE ILE A . n A 1 30 GLU 30 24 24 GLU GLU A . n A 1 31 ARG 31 25 25 ARG ARG A . n A 1 32 PHE 32 26 26 PHE PHE A . n A 1 33 ILE 33 27 27 ILE ILE A . n A 1 34 THR 34 28 28 THR THR A . n A 1 35 LEU 35 29 29 LEU LEU A . n A 1 36 THR 36 30 30 THR THR A . n A 1 37 HIS 37 31 31 HIS HIS A . n A 1 38 GLY 38 32 32 GLY GLY A . n A 1 39 ILE 39 33 33 ILE ILE A . n A 1 40 GLU 40 34 34 GLU GLU A . n A 1 41 LYS 41 35 35 LYS LYS A . n A 1 42 THR 42 36 36 THR THR A . n A 1 43 ARG 43 37 37 ARG ARG A . n A 1 44 GLY 44 38 38 GLY GLY A . n A 1 45 GLU 45 39 39 GLU GLU A . n A 1 46 ALA 46 40 40 ALA ALA A . n A 1 47 PHE 47 41 41 PHE PHE A . n A 1 48 ALA 48 42 42 ALA ALA A . n A 1 49 LYS 49 43 43 LYS LYS A . n A 1 50 ALA 50 44 44 ALA ALA A . n A 1 51 SER 51 45 45 SER SER A . n A 1 52 ILE 52 46 46 ILE ILE A . n A 1 53 TYR 53 47 47 TYR TYR A . n A 1 54 GLY 54 48 48 GLY GLY A . n A 1 55 PHE 55 49 49 PHE PHE A . n A 1 56 LEU 56 50 50 LEU LEU A . n A 1 57 GLU 57 51 51 GLU GLU A . n A 1 58 GLY 58 52 52 GLY GLY A . n A 1 59 ILE 59 53 53 ILE ILE A . n A 1 60 LEU 60 54 54 LEU LEU A . n A 1 61 THR 61 55 55 THR THR A . n A 1 62 THR 62 56 56 THR THR A . n A 1 63 LEU 63 57 57 LEU LEU A . n A 1 64 LYS 64 58 58 LYS LYS A . n A 1 65 MSE 65 59 59 MSE MSE A . n A 1 66 LYS 66 60 60 LYS LYS A . n A 1 67 TYR 67 61 61 TYR TYR A . n A 1 68 SER 68 62 62 SER SER A . n A 1 69 ASN 69 63 63 ASN ASN A . n A 1 70 GLU 70 64 64 GLU GLU A . n A 1 71 LYS 71 65 65 LYS LYS A . n A 1 72 ILE 72 66 66 ILE ILE A . n A 1 73 GLU 73 67 67 GLU GLU A . n A 1 74 THR 74 68 68 THR THR A . n A 1 75 LEU 75 69 69 LEU LEU A . n A 1 76 LEU 76 70 70 LEU LEU A . n A 1 77 ASN 77 71 71 ASN ASN A . n A 1 78 GLU 78 72 72 GLU GLU A . n A 1 79 VAL 79 73 73 VAL VAL A . n A 1 80 LYS 80 74 74 LYS LYS A . n A 1 81 THR 81 75 75 THR THR A . n A 1 82 ALA 82 76 76 ALA ALA A . n A 1 83 ARG 83 77 77 ARG ARG A . n A 1 84 GLU 84 78 78 GLU GLU A . n A 1 85 GLU 85 79 79 GLU GLU A . n A 1 86 THR 86 80 80 THR THR A . n A 1 87 GLU 87 81 81 GLU GLU A . n A 1 88 ALA 88 82 82 ALA ALA A . n A 1 89 LEU 89 83 83 LEU LEU A . n A 1 90 LEU 90 84 84 LEU LEU A . n A 1 91 ARG 91 85 85 ARG ARG A . n A 1 92 LYS 92 86 ? ? ? A . n A 1 93 PRO 93 87 ? ? ? A . n A 1 94 ARG 94 88 ? ? ? A . n A 1 95 PRO 95 89 ? ? ? A . n A 1 96 PRO 96 90 ? ? ? A . n A 1 97 LEU 97 91 ? ? ? A . n A 1 98 LEU 98 92 ? ? ? A . n A 1 99 VAL 99 93 ? ? ? A . n A 1 100 ASP 100 94 ? ? ? A . n A 1 101 ASN 101 95 ? ? ? A . n A 1 102 ASP 102 96 ? ? ? A . n A 1 103 LEU 103 97 ? ? ? A . n B 1 1 HIS 1 -5 -5 HIS HIS B . n B 1 2 HIS 2 -4 -4 HIS HIS B . n B 1 3 HIS 3 -3 -3 HIS HIS B . n B 1 4 HIS 4 -2 -2 HIS HIS B . n B 1 5 HIS 5 -1 -1 HIS HIS B . n B 1 6 HIS 6 0 0 HIS HIS B . n B 1 7 MSE 7 1 1 MSE MSE B . n B 1 8 ASP 8 2 2 ASP ASP B . n B 1 9 LEU 9 3 3 LEU LEU B . n B 1 10 VAL 10 4 4 VAL VAL B . n B 1 11 GLU 11 5 5 GLU GLU B . n B 1 12 LYS 12 6 6 LYS LYS B . n B 1 13 VAL 13 7 7 VAL VAL B . n B 1 14 LYS 14 8 8 LYS LYS B . n B 1 15 GLU 15 9 9 GLU GLU B . n B 1 16 LEU 16 10 10 LEU LEU B . n B 1 17 CYS 17 11 11 CYS CYS B . n B 1 18 LEU 18 12 12 LEU LEU B . n B 1 19 GLU 19 13 13 GLU GLU B . n B 1 20 LEU 20 14 14 LEU LEU B . n B 1 21 GLU 21 15 15 GLU GLU B . n B 1 22 GLU 22 16 16 GLU GLU B . n B 1 23 GLU 23 17 17 GLU GLU B . n B 1 24 ASN 24 18 18 ASN ASN B . n B 1 25 LEU 25 19 19 LEU LEU B . n B 1 26 ALA 26 20 20 ALA ALA B . n B 1 27 LYS 27 21 21 LYS LYS B . n B 1 28 ALA 28 22 22 ALA ALA B . n B 1 29 ILE 29 23 23 ILE ILE B . n B 1 30 GLU 30 24 24 GLU GLU B . n B 1 31 ARG 31 25 25 ARG ARG B . n B 1 32 PHE 32 26 26 PHE PHE B . n B 1 33 ILE 33 27 27 ILE ILE B . n B 1 34 THR 34 28 28 THR THR B . n B 1 35 LEU 35 29 29 LEU LEU B . n B 1 36 THR 36 30 30 THR THR B . n B 1 37 HIS 37 31 31 HIS HIS B . n B 1 38 GLY 38 32 32 GLY GLY B . n B 1 39 ILE 39 33 33 ILE ILE B . n B 1 40 GLU 40 34 34 GLU GLU B . n B 1 41 LYS 41 35 35 LYS LYS B . n B 1 42 THR 42 36 36 THR THR B . n B 1 43 ARG 43 37 37 ARG ARG B . n B 1 44 GLY 44 38 38 GLY GLY B . n B 1 45 GLU 45 39 39 GLU GLU B . n B 1 46 ALA 46 40 40 ALA ALA B . n B 1 47 PHE 47 41 41 PHE PHE B . n B 1 48 ALA 48 42 42 ALA ALA B . n B 1 49 LYS 49 43 43 LYS LYS B . n B 1 50 ALA 50 44 44 ALA ALA B . n B 1 51 SER 51 45 45 SER SER B . n B 1 52 ILE 52 46 46 ILE ILE B . n B 1 53 TYR 53 47 47 TYR TYR B . n B 1 54 GLY 54 48 48 GLY GLY B . n B 1 55 PHE 55 49 49 PHE PHE B . n B 1 56 LEU 56 50 50 LEU LEU B . n B 1 57 GLU 57 51 51 GLU GLU B . n B 1 58 GLY 58 52 52 GLY GLY B . n B 1 59 ILE 59 53 53 ILE ILE B . n B 1 60 LEU 60 54 54 LEU LEU B . n B 1 61 THR 61 55 55 THR THR B . n B 1 62 THR 62 56 56 THR THR B . n B 1 63 LEU 63 57 57 LEU LEU B . n B 1 64 LYS 64 58 58 LYS LYS B . n B 1 65 MSE 65 59 59 MSE MSE B . n B 1 66 LYS 66 60 60 LYS LYS B . n B 1 67 TYR 67 61 61 TYR TYR B . n B 1 68 SER 68 62 62 SER SER B . n B 1 69 ASN 69 63 63 ASN ASN B . n B 1 70 GLU 70 64 64 GLU GLU B . n B 1 71 LYS 71 65 65 LYS LYS B . n B 1 72 ILE 72 66 66 ILE ILE B . n B 1 73 GLU 73 67 67 GLU GLU B . n B 1 74 THR 74 68 68 THR THR B . n B 1 75 LEU 75 69 69 LEU LEU B . n B 1 76 LEU 76 70 70 LEU LEU B . n B 1 77 ASN 77 71 71 ASN ASN B . n B 1 78 GLU 78 72 72 GLU GLU B . n B 1 79 VAL 79 73 73 VAL VAL B . n B 1 80 LYS 80 74 74 LYS LYS B . n B 1 81 THR 81 75 75 THR THR B . n B 1 82 ALA 82 76 76 ALA ALA B . n B 1 83 ARG 83 77 77 ARG ARG B . n B 1 84 GLU 84 78 78 GLU GLU B . n B 1 85 GLU 85 79 79 GLU GLU B . n B 1 86 THR 86 80 80 THR THR B . n B 1 87 GLU 87 81 81 GLU GLU B . n B 1 88 ALA 88 82 82 ALA ALA B . n B 1 89 LEU 89 83 83 LEU LEU B . n B 1 90 LEU 90 84 84 LEU LEU B . n B 1 91 ARG 91 85 85 ARG ARG B . n B 1 92 LYS 92 86 ? ? ? B . n B 1 93 PRO 93 87 ? ? ? B . n B 1 94 ARG 94 88 ? ? ? B . n B 1 95 PRO 95 89 ? ? ? B . n B 1 96 PRO 96 90 ? ? ? B . n B 1 97 LEU 97 91 ? ? ? B . n B 1 98 LEU 98 92 ? ? ? B . n B 1 99 VAL 99 93 ? ? ? B . n B 1 100 ASP 100 94 ? ? ? B . n B 1 101 ASN 101 95 ? ? ? B . n B 1 102 ASP 102 96 ? ? ? B . n B 1 103 LEU 103 97 ? ? ? B . n C 1 1 HIS 1 -5 ? ? ? C . n C 1 2 HIS 2 -4 -4 HIS HIS C . n C 1 3 HIS 3 -3 -3 HIS HIS C . n C 1 4 HIS 4 -2 -2 HIS HIS C . n C 1 5 HIS 5 -1 -1 HIS HIS C . n C 1 6 HIS 6 0 0 HIS HIS C . n C 1 7 MSE 7 1 1 MSE MSE C . n C 1 8 ASP 8 2 2 ASP ASP C . n C 1 9 LEU 9 3 3 LEU LEU C . n C 1 10 VAL 10 4 4 VAL VAL C . n C 1 11 GLU 11 5 5 GLU GLU C . n C 1 12 LYS 12 6 6 LYS LYS C . n C 1 13 VAL 13 7 7 VAL VAL C . n C 1 14 LYS 14 8 8 LYS LYS C . n C 1 15 GLU 15 9 9 GLU GLU C . n C 1 16 LEU 16 10 10 LEU LEU C . n C 1 17 CYS 17 11 11 CYS CYS C . n C 1 18 LEU 18 12 12 LEU LEU C . n C 1 19 GLU 19 13 13 GLU GLU C . n C 1 20 LEU 20 14 14 LEU LEU C . n C 1 21 GLU 21 15 15 GLU GLU C . n C 1 22 GLU 22 16 16 GLU GLU C . n C 1 23 GLU 23 17 17 GLU GLU C . n C 1 24 ASN 24 18 18 ASN ASN C . n C 1 25 LEU 25 19 19 LEU LEU C . n C 1 26 ALA 26 20 20 ALA ALA C . n C 1 27 LYS 27 21 21 LYS LYS C . n C 1 28 ALA 28 22 22 ALA ALA C . n C 1 29 ILE 29 23 23 ILE ILE C . n C 1 30 GLU 30 24 24 GLU GLU C . n C 1 31 ARG 31 25 25 ARG ARG C . n C 1 32 PHE 32 26 26 PHE PHE C . n C 1 33 ILE 33 27 27 ILE ILE C . n C 1 34 THR 34 28 28 THR THR C . n C 1 35 LEU 35 29 29 LEU LEU C . n C 1 36 THR 36 30 30 THR THR C . n C 1 37 HIS 37 31 31 HIS HIS C . n C 1 38 GLY 38 32 32 GLY GLY C . n C 1 39 ILE 39 33 33 ILE ILE C . n C 1 40 GLU 40 34 34 GLU GLU C . n C 1 41 LYS 41 35 35 LYS LYS C . n C 1 42 THR 42 36 36 THR THR C . n C 1 43 ARG 43 37 37 ARG ARG C . n C 1 44 GLY 44 38 38 GLY GLY C . n C 1 45 GLU 45 39 39 GLU GLU C . n C 1 46 ALA 46 40 40 ALA ALA C . n C 1 47 PHE 47 41 41 PHE PHE C . n C 1 48 ALA 48 42 42 ALA ALA C . n C 1 49 LYS 49 43 43 LYS LYS C . n C 1 50 ALA 50 44 44 ALA ALA C . n C 1 51 SER 51 45 45 SER SER C . n C 1 52 ILE 52 46 46 ILE ILE C . n C 1 53 TYR 53 47 47 TYR TYR C . n C 1 54 GLY 54 48 48 GLY GLY C . n C 1 55 PHE 55 49 49 PHE PHE C . n C 1 56 LEU 56 50 50 LEU LEU C . n C 1 57 GLU 57 51 51 GLU GLU C . n C 1 58 GLY 58 52 52 GLY GLY C . n C 1 59 ILE 59 53 53 ILE ILE C . n C 1 60 LEU 60 54 54 LEU LEU C . n C 1 61 THR 61 55 55 THR THR C . n C 1 62 THR 62 56 56 THR THR C . n C 1 63 LEU 63 57 57 LEU LEU C . n C 1 64 LYS 64 58 58 LYS LYS C . n C 1 65 MSE 65 59 59 MSE MSE C . n C 1 66 LYS 66 60 60 LYS LYS C . n C 1 67 TYR 67 61 61 TYR TYR C . n C 1 68 SER 68 62 62 SER SER C . n C 1 69 ASN 69 63 63 ASN ASN C . n C 1 70 GLU 70 64 64 GLU GLU C . n C 1 71 LYS 71 65 65 LYS LYS C . n C 1 72 ILE 72 66 66 ILE ILE C . n C 1 73 GLU 73 67 67 GLU GLU C . n C 1 74 THR 74 68 68 THR THR C . n C 1 75 LEU 75 69 69 LEU LEU C . n C 1 76 LEU 76 70 70 LEU LEU C . n C 1 77 ASN 77 71 71 ASN ASN C . n C 1 78 GLU 78 72 72 GLU GLU C . n C 1 79 VAL 79 73 73 VAL VAL C . n C 1 80 LYS 80 74 74 LYS LYS C . n C 1 81 THR 81 75 75 THR THR C . n C 1 82 ALA 82 76 76 ALA ALA C . n C 1 83 ARG 83 77 77 ARG ARG C . n C 1 84 GLU 84 78 78 GLU GLU C . n C 1 85 GLU 85 79 79 GLU GLU C . n C 1 86 THR 86 80 80 THR THR C . n C 1 87 GLU 87 81 81 GLU GLU C . n C 1 88 ALA 88 82 82 ALA ALA C . n C 1 89 LEU 89 83 83 LEU LEU C . n C 1 90 LEU 90 84 84 LEU LEU C . n C 1 91 ARG 91 85 85 ARG ARG C . n C 1 92 LYS 92 86 ? ? ? C . n C 1 93 PRO 93 87 ? ? ? C . n C 1 94 ARG 94 88 ? ? ? C . n C 1 95 PRO 95 89 ? ? ? C . n C 1 96 PRO 96 90 ? ? ? C . n C 1 97 LEU 97 91 ? ? ? C . n C 1 98 LEU 98 92 ? ? ? C . n C 1 99 VAL 99 93 ? ? ? C . n C 1 100 ASP 100 94 ? ? ? C . n C 1 101 ASN 101 95 ? ? ? C . n C 1 102 ASP 102 96 ? ? ? C . n C 1 103 LEU 103 97 ? ? ? C . n D 1 1 HIS 1 -5 ? ? ? D . n D 1 2 HIS 2 -4 -4 HIS HIS D . n D 1 3 HIS 3 -3 -3 HIS HIS D . n D 1 4 HIS 4 -2 -2 HIS HIS D . n D 1 5 HIS 5 -1 -1 HIS HIS D . n D 1 6 HIS 6 0 0 HIS HIS D . n D 1 7 MSE 7 1 1 MSE MSE D . n D 1 8 ASP 8 2 2 ASP ASP D . n D 1 9 LEU 9 3 3 LEU LEU D . n D 1 10 VAL 10 4 4 VAL VAL D . n D 1 11 GLU 11 5 5 GLU GLU D . n D 1 12 LYS 12 6 6 LYS LYS D . n D 1 13 VAL 13 7 7 VAL VAL D . n D 1 14 LYS 14 8 8 LYS LYS D . n D 1 15 GLU 15 9 9 GLU GLU D . n D 1 16 LEU 16 10 10 LEU LEU D . n D 1 17 CYS 17 11 11 CYS CYS D . n D 1 18 LEU 18 12 12 LEU LEU D . n D 1 19 GLU 19 13 13 GLU GLU D . n D 1 20 LEU 20 14 14 LEU LEU D . n D 1 21 GLU 21 15 15 GLU GLU D . n D 1 22 GLU 22 16 16 GLU GLU D . n D 1 23 GLU 23 17 17 GLU GLU D . n D 1 24 ASN 24 18 18 ASN ASN D . n D 1 25 LEU 25 19 19 LEU LEU D . n D 1 26 ALA 26 20 20 ALA ALA D . n D 1 27 LYS 27 21 21 LYS LYS D . n D 1 28 ALA 28 22 22 ALA ALA D . n D 1 29 ILE 29 23 23 ILE ILE D . n D 1 30 GLU 30 24 24 GLU GLU D . n D 1 31 ARG 31 25 25 ARG ARG D . n D 1 32 PHE 32 26 26 PHE PHE D . n D 1 33 ILE 33 27 27 ILE ILE D . n D 1 34 THR 34 28 28 THR THR D . n D 1 35 LEU 35 29 29 LEU LEU D . n D 1 36 THR 36 30 30 THR THR D . n D 1 37 HIS 37 31 31 HIS HIS D . n D 1 38 GLY 38 32 32 GLY GLY D . n D 1 39 ILE 39 33 33 ILE ILE D . n D 1 40 GLU 40 34 34 GLU GLU D . n D 1 41 LYS 41 35 35 LYS LYS D . n D 1 42 THR 42 36 36 THR THR D . n D 1 43 ARG 43 37 37 ARG ARG D . n D 1 44 GLY 44 38 38 GLY GLY D . n D 1 45 GLU 45 39 39 GLU GLU D . n D 1 46 ALA 46 40 40 ALA ALA D . n D 1 47 PHE 47 41 41 PHE PHE D . n D 1 48 ALA 48 42 42 ALA ALA D . n D 1 49 LYS 49 43 43 LYS LYS D . n D 1 50 ALA 50 44 44 ALA ALA D . n D 1 51 SER 51 45 45 SER SER D . n D 1 52 ILE 52 46 46 ILE ILE D . n D 1 53 TYR 53 47 47 TYR TYR D . n D 1 54 GLY 54 48 48 GLY GLY D . n D 1 55 PHE 55 49 49 PHE PHE D . n D 1 56 LEU 56 50 50 LEU LEU D . n D 1 57 GLU 57 51 51 GLU GLU D . n D 1 58 GLY 58 52 52 GLY GLY D . n D 1 59 ILE 59 53 53 ILE ILE D . n D 1 60 LEU 60 54 54 LEU LEU D . n D 1 61 THR 61 55 55 THR THR D . n D 1 62 THR 62 56 56 THR THR D . n D 1 63 LEU 63 57 57 LEU LEU D . n D 1 64 LYS 64 58 58 LYS LYS D . n D 1 65 MSE 65 59 59 MSE MSE D . n D 1 66 LYS 66 60 60 LYS LYS D . n D 1 67 TYR 67 61 61 TYR TYR D . n D 1 68 SER 68 62 62 SER SER D . n D 1 69 ASN 69 63 63 ASN ASN D . n D 1 70 GLU 70 64 64 GLU GLU D . n D 1 71 LYS 71 65 65 LYS LYS D . n D 1 72 ILE 72 66 66 ILE ILE D . n D 1 73 GLU 73 67 67 GLU GLU D . n D 1 74 THR 74 68 68 THR THR D . n D 1 75 LEU 75 69 69 LEU LEU D . n D 1 76 LEU 76 70 70 LEU LEU D . n D 1 77 ASN 77 71 71 ASN ASN D . n D 1 78 GLU 78 72 72 GLU GLU D . n D 1 79 VAL 79 73 73 VAL VAL D . n D 1 80 LYS 80 74 74 LYS LYS D . n D 1 81 THR 81 75 75 THR THR D . n D 1 82 ALA 82 76 76 ALA ALA D . n D 1 83 ARG 83 77 77 ARG ARG D . n D 1 84 GLU 84 78 78 GLU GLU D . n D 1 85 GLU 85 79 79 GLU GLU D . n D 1 86 THR 86 80 80 THR THR D . n D 1 87 GLU 87 81 81 GLU GLU D . n D 1 88 ALA 88 82 82 ALA ALA D . n D 1 89 LEU 89 83 83 LEU LEU D . n D 1 90 LEU 90 84 84 LEU LEU D . n D 1 91 ARG 91 85 85 ARG ARG D . n D 1 92 LYS 92 86 ? ? ? D . n D 1 93 PRO 93 87 ? ? ? D . n D 1 94 ARG 94 88 ? ? ? D . n D 1 95 PRO 95 89 ? ? ? D . n D 1 96 PRO 96 90 ? ? ? D . n D 1 97 LEU 97 91 ? ? ? D . n D 1 98 LEU 98 92 ? ? ? D . n D 1 99 VAL 99 93 ? ? ? D . n D 1 100 ASP 100 94 ? ? ? D . n D 1 101 ASN 101 95 ? ? ? D . n D 1 102 ASP 102 96 ? ? ? D . n D 1 103 LEU 103 97 ? ? ? D . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Southeast Collaboratory for Structural Genomics' _pdbx_SG_project.initial_of_center SECSG # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code E 2 HOH 1 98 2 HOH HOH A . F 2 HOH 1 98 1 HOH HOH B . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 7 A MSE 1 ? MET SELENOMETHIONINE 2 A MSE 65 A MSE 59 ? MET SELENOMETHIONINE 3 B MSE 7 B MSE 1 ? MET SELENOMETHIONINE 4 B MSE 65 B MSE 59 ? MET SELENOMETHIONINE 5 C MSE 7 C MSE 1 ? MET SELENOMETHIONINE 6 C MSE 65 C MSE 59 ? MET SELENOMETHIONINE 7 D MSE 7 D MSE 1 ? MET SELENOMETHIONINE 8 D MSE 65 D MSE 59 ? MET SELENOMETHIONINE # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PQS tetrameric 4 2 software_defined_assembly PISA dimeric 2 3 software_defined_assembly PISA dimeric 2 4 software_defined_assembly PISA dimeric 2 5 software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C,D,E,F 2 1 C,D 3 1 A,B,E,F 4 1 A,C,E 5 1 B,F 5 2 D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 2 'ABSA (A^2)' 2130 ? 2 MORE -19 ? 2 'SSA (A^2)' 8780 ? 3 'ABSA (A^2)' 2240 ? 3 MORE -18 ? 3 'SSA (A^2)' 9110 ? 4 'ABSA (A^2)' 1740 ? 4 MORE -10 ? 4 'SSA (A^2)' 9170 ? 5 'ABSA (A^2)' 1800 ? 5 MORE -9 ? 5 'SSA (A^2)' 9560 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 3_644 -x+1,y-1/2,-z-1/2 -1.0000000000 0.0000000000 0.0000000000 62.6800000000 0.0000000000 1.0000000000 0.0000000000 -32.1200000000 0.0000000000 0.0000000000 -1.0000000000 -55.8250000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-07-03 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal SCA2STRUCTURE 'model building' . ? 1 CNS refinement . ? 2 HKL-2000 'data reduction' . ? 3 HKL-2000 'data scaling' . ? 4 SCA2STRUCTURE phasing . ? 5 # _pdbx_database_remark.id 300 _pdbx_database_remark.text ;BIOMOLECULE THIS ENTRY CONTAINS THE CRYSTALLOGRAPHIC ASYMMETRIC UNIT WHICH CONSISTS OF 4 CHAIN(S). THE BIOLOGICAL UNIT IS UNKNOWN. ; # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A -4 ? ? -159.79 58.28 2 1 HIS A 0 ? ? 45.71 -134.15 3 1 GLU A 13 ? ? -57.25 -3.43 4 1 GLU A 15 ? ? 85.48 -27.95 5 1 GLU A 16 ? ? -59.93 96.69 6 1 LEU A 29 ? ? -64.69 22.39 7 1 THR A 30 ? ? -145.19 29.84 8 1 ASN A 63 ? ? -36.86 115.21 9 1 HIS B 0 ? ? 46.26 -128.45 10 1 GLU B 16 ? ? -113.14 67.72 11 1 LYS B 60 ? ? -144.09 -4.54 12 1 HIS C 0 ? ? 35.77 -138.09 13 1 GLU C 15 ? ? 74.91 42.39 14 1 HIS C 31 ? ? 6.46 -96.44 15 1 LYS C 60 ? ? -128.83 -109.69 16 1 TYR C 61 ? ? -45.85 167.91 17 1 HIS D 0 ? ? 45.58 -140.24 18 1 THR D 30 ? ? -77.39 44.37 19 1 ILE D 33 ? ? -27.27 -40.81 20 1 ILE D 53 ? ? -54.58 -70.86 21 1 LEU D 54 ? ? -46.77 -17.38 22 1 LYS D 58 ? ? -61.51 11.91 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A HIS -5 ? CG ? A HIS 1 CG 2 1 Y 1 A HIS -5 ? ND1 ? A HIS 1 ND1 3 1 Y 1 A HIS -5 ? CD2 ? A HIS 1 CD2 4 1 Y 1 A HIS -5 ? CE1 ? A HIS 1 CE1 5 1 Y 1 A HIS -5 ? NE2 ? A HIS 1 NE2 6 1 Y 1 A HIS 0 ? CB ? A HIS 6 CB 7 1 Y 1 A HIS 0 ? CG ? A HIS 6 CG 8 1 Y 1 A HIS 0 ? ND1 ? A HIS 6 ND1 9 1 Y 1 A HIS 0 ? CD2 ? A HIS 6 CD2 10 1 Y 1 A HIS 0 ? CE1 ? A HIS 6 CE1 11 1 Y 1 A HIS 0 ? NE2 ? A HIS 6 NE2 12 1 Y 1 A MSE 1 ? CG ? A MSE 7 CG 13 1 Y 1 A MSE 1 ? SE ? A MSE 7 SE 14 1 Y 1 A MSE 1 ? CE ? A MSE 7 CE 15 1 Y 1 A GLU 13 ? CG ? A GLU 19 CG 16 1 Y 1 A GLU 13 ? CD ? A GLU 19 CD 17 1 Y 1 A GLU 13 ? OE1 ? A GLU 19 OE1 18 1 Y 1 A GLU 13 ? OE2 ? A GLU 19 OE2 19 1 Y 1 A GLU 15 ? CG ? A GLU 21 CG 20 1 Y 1 A GLU 15 ? CD ? A GLU 21 CD 21 1 Y 1 A GLU 15 ? OE1 ? A GLU 21 OE1 22 1 Y 1 A GLU 15 ? OE2 ? A GLU 21 OE2 23 1 Y 1 A GLU 17 ? CG ? A GLU 23 CG 24 1 Y 1 A GLU 17 ? CD ? A GLU 23 CD 25 1 Y 1 A GLU 17 ? OE1 ? A GLU 23 OE1 26 1 Y 1 A GLU 17 ? OE2 ? A GLU 23 OE2 27 1 Y 1 A ASN 18 ? CG ? A ASN 24 CG 28 1 Y 1 A ASN 18 ? OD1 ? A ASN 24 OD1 29 1 Y 1 A ASN 18 ? ND2 ? A ASN 24 ND2 30 1 Y 1 A LYS 21 ? CG ? A LYS 27 CG 31 1 Y 1 A LYS 21 ? CD ? A LYS 27 CD 32 1 Y 1 A LYS 21 ? CE ? A LYS 27 CE 33 1 Y 1 A LYS 21 ? NZ ? A LYS 27 NZ 34 1 Y 1 A ARG 25 ? CG ? A ARG 31 CG 35 1 Y 1 A ARG 25 ? CD ? A ARG 31 CD 36 1 Y 1 A ARG 25 ? NE ? A ARG 31 NE 37 1 Y 1 A ARG 25 ? CZ ? A ARG 31 CZ 38 1 Y 1 A ARG 25 ? NH1 ? A ARG 31 NH1 39 1 Y 1 A ARG 25 ? NH2 ? A ARG 31 NH2 40 1 Y 1 A ILE 27 ? CG1 ? A ILE 33 CG1 41 1 Y 1 A ILE 27 ? CG2 ? A ILE 33 CG2 42 1 Y 1 A ILE 27 ? CD1 ? A ILE 33 CD1 43 1 Y 1 A THR 28 ? OG1 ? A THR 34 OG1 44 1 Y 1 A THR 28 ? CG2 ? A THR 34 CG2 45 1 Y 1 A LEU 29 ? CG ? A LEU 35 CG 46 1 Y 1 A LEU 29 ? CD1 ? A LEU 35 CD1 47 1 Y 1 A LEU 29 ? CD2 ? A LEU 35 CD2 48 1 Y 1 A THR 30 ? OG1 ? A THR 36 OG1 49 1 Y 1 A THR 30 ? CG2 ? A THR 36 CG2 50 1 Y 1 A HIS 31 ? CG ? A HIS 37 CG 51 1 Y 1 A HIS 31 ? ND1 ? A HIS 37 ND1 52 1 Y 1 A HIS 31 ? CD2 ? A HIS 37 CD2 53 1 Y 1 A HIS 31 ? CE1 ? A HIS 37 CE1 54 1 Y 1 A HIS 31 ? NE2 ? A HIS 37 NE2 55 1 Y 1 A ILE 33 ? CG1 ? A ILE 39 CG1 56 1 Y 1 A ILE 33 ? CG2 ? A ILE 39 CG2 57 1 Y 1 A ILE 33 ? CD1 ? A ILE 39 CD1 58 1 Y 1 A LYS 35 ? CG ? A LYS 41 CG 59 1 Y 1 A LYS 35 ? CD ? A LYS 41 CD 60 1 Y 1 A LYS 35 ? CE ? A LYS 41 CE 61 1 Y 1 A LYS 35 ? NZ ? A LYS 41 NZ 62 1 Y 1 A LYS 58 ? CG ? A LYS 64 CG 63 1 Y 1 A LYS 58 ? CD ? A LYS 64 CD 64 1 Y 1 A LYS 58 ? CE ? A LYS 64 CE 65 1 Y 1 A LYS 58 ? NZ ? A LYS 64 NZ 66 1 Y 1 A LYS 60 ? CG ? A LYS 66 CG 67 1 Y 1 A LYS 60 ? CD ? A LYS 66 CD 68 1 Y 1 A LYS 60 ? CE ? A LYS 66 CE 69 1 Y 1 A LYS 60 ? NZ ? A LYS 66 NZ 70 1 Y 1 A SER 62 ? OG ? A SER 68 OG 71 1 Y 1 A GLU 64 ? CG ? A GLU 70 CG 72 1 Y 1 A GLU 64 ? CD ? A GLU 70 CD 73 1 Y 1 A GLU 64 ? OE1 ? A GLU 70 OE1 74 1 Y 1 A GLU 64 ? OE2 ? A GLU 70 OE2 75 1 Y 1 A LYS 65 ? CG ? A LYS 71 CG 76 1 Y 1 A LYS 65 ? CD ? A LYS 71 CD 77 1 Y 1 A LYS 65 ? CE ? A LYS 71 CE 78 1 Y 1 A LYS 65 ? NZ ? A LYS 71 NZ 79 1 Y 1 A GLU 67 ? CG ? A GLU 73 CG 80 1 Y 1 A GLU 67 ? CD ? A GLU 73 CD 81 1 Y 1 A GLU 67 ? OE1 ? A GLU 73 OE1 82 1 Y 1 A GLU 67 ? OE2 ? A GLU 73 OE2 83 1 Y 1 A THR 68 ? OG1 ? A THR 74 OG1 84 1 Y 1 A THR 68 ? CG2 ? A THR 74 CG2 85 1 Y 1 A ASN 71 ? CG ? A ASN 77 CG 86 1 Y 1 A ASN 71 ? OD1 ? A ASN 77 OD1 87 1 Y 1 A ASN 71 ? ND2 ? A ASN 77 ND2 88 1 Y 1 A LYS 74 ? CG ? A LYS 80 CG 89 1 Y 1 A LYS 74 ? CD ? A LYS 80 CD 90 1 Y 1 A LYS 74 ? CE ? A LYS 80 CE 91 1 Y 1 A LYS 74 ? NZ ? A LYS 80 NZ 92 1 Y 1 A ARG 85 ? CG ? A ARG 91 CG 93 1 Y 1 A ARG 85 ? CD ? A ARG 91 CD 94 1 Y 1 A ARG 85 ? NE ? A ARG 91 NE 95 1 Y 1 A ARG 85 ? CZ ? A ARG 91 CZ 96 1 Y 1 A ARG 85 ? NH1 ? A ARG 91 NH1 97 1 Y 1 A ARG 85 ? NH2 ? A ARG 91 NH2 98 1 Y 1 B HIS -5 ? CG ? B HIS 1 CG 99 1 Y 1 B HIS -5 ? ND1 ? B HIS 1 ND1 100 1 Y 1 B HIS -5 ? CD2 ? B HIS 1 CD2 101 1 Y 1 B HIS -5 ? CE1 ? B HIS 1 CE1 102 1 Y 1 B HIS -5 ? NE2 ? B HIS 1 NE2 103 1 Y 1 B HIS -4 ? CG ? B HIS 2 CG 104 1 Y 1 B HIS -4 ? ND1 ? B HIS 2 ND1 105 1 Y 1 B HIS -4 ? CD2 ? B HIS 2 CD2 106 1 Y 1 B HIS -4 ? CE1 ? B HIS 2 CE1 107 1 Y 1 B HIS -4 ? NE2 ? B HIS 2 NE2 108 1 Y 1 B HIS -3 ? CG ? B HIS 3 CG 109 1 Y 1 B HIS -3 ? ND1 ? B HIS 3 ND1 110 1 Y 1 B HIS -3 ? CD2 ? B HIS 3 CD2 111 1 Y 1 B HIS -3 ? CE1 ? B HIS 3 CE1 112 1 Y 1 B HIS -3 ? NE2 ? B HIS 3 NE2 113 1 Y 1 B HIS 0 ? CB ? B HIS 6 CB 114 1 Y 1 B HIS 0 ? CG ? B HIS 6 CG 115 1 Y 1 B HIS 0 ? ND1 ? B HIS 6 ND1 116 1 Y 1 B HIS 0 ? CD2 ? B HIS 6 CD2 117 1 Y 1 B HIS 0 ? CE1 ? B HIS 6 CE1 118 1 Y 1 B HIS 0 ? NE2 ? B HIS 6 NE2 119 1 Y 1 B MSE 1 ? CG ? B MSE 7 CG 120 1 Y 1 B MSE 1 ? SE ? B MSE 7 SE 121 1 Y 1 B MSE 1 ? CE ? B MSE 7 CE 122 1 Y 1 B LYS 6 ? CG ? B LYS 12 CG 123 1 Y 1 B LYS 6 ? CD ? B LYS 12 CD 124 1 Y 1 B LYS 6 ? CE ? B LYS 12 CE 125 1 Y 1 B LYS 6 ? NZ ? B LYS 12 NZ 126 1 Y 1 B GLU 13 ? CG ? B GLU 19 CG 127 1 Y 1 B GLU 13 ? CD ? B GLU 19 CD 128 1 Y 1 B GLU 13 ? OE1 ? B GLU 19 OE1 129 1 Y 1 B GLU 13 ? OE2 ? B GLU 19 OE2 130 1 Y 1 B GLU 15 ? CG ? B GLU 21 CG 131 1 Y 1 B GLU 15 ? CD ? B GLU 21 CD 132 1 Y 1 B GLU 15 ? OE1 ? B GLU 21 OE1 133 1 Y 1 B GLU 15 ? OE2 ? B GLU 21 OE2 134 1 Y 1 B LYS 21 ? CG ? B LYS 27 CG 135 1 Y 1 B LYS 21 ? CD ? B LYS 27 CD 136 1 Y 1 B LYS 21 ? CE ? B LYS 27 CE 137 1 Y 1 B LYS 21 ? NZ ? B LYS 27 NZ 138 1 Y 1 B THR 30 ? OG1 ? B THR 36 OG1 139 1 Y 1 B THR 30 ? CG2 ? B THR 36 CG2 140 1 Y 1 B HIS 31 ? CG ? B HIS 37 CG 141 1 Y 1 B HIS 31 ? ND1 ? B HIS 37 ND1 142 1 Y 1 B HIS 31 ? CD2 ? B HIS 37 CD2 143 1 Y 1 B HIS 31 ? CE1 ? B HIS 37 CE1 144 1 Y 1 B HIS 31 ? NE2 ? B HIS 37 NE2 145 1 Y 1 B LYS 35 ? CG ? B LYS 41 CG 146 1 Y 1 B LYS 35 ? CD ? B LYS 41 CD 147 1 Y 1 B LYS 35 ? CE ? B LYS 41 CE 148 1 Y 1 B LYS 35 ? NZ ? B LYS 41 NZ 149 1 Y 1 B LYS 60 ? CG ? B LYS 66 CG 150 1 Y 1 B LYS 60 ? CD ? B LYS 66 CD 151 1 Y 1 B LYS 60 ? CE ? B LYS 66 CE 152 1 Y 1 B LYS 60 ? NZ ? B LYS 66 NZ 153 1 Y 1 B SER 62 ? OG ? B SER 68 OG 154 1 Y 1 B GLU 64 ? CG ? B GLU 70 CG 155 1 Y 1 B GLU 64 ? CD ? B GLU 70 CD 156 1 Y 1 B GLU 64 ? OE1 ? B GLU 70 OE1 157 1 Y 1 B GLU 64 ? OE2 ? B GLU 70 OE2 158 1 Y 1 B LYS 65 ? CG ? B LYS 71 CG 159 1 Y 1 B LYS 65 ? CD ? B LYS 71 CD 160 1 Y 1 B LYS 65 ? CE ? B LYS 71 CE 161 1 Y 1 B LYS 65 ? NZ ? B LYS 71 NZ 162 1 Y 1 B GLU 67 ? CG ? B GLU 73 CG 163 1 Y 1 B GLU 67 ? CD ? B GLU 73 CD 164 1 Y 1 B GLU 67 ? OE1 ? B GLU 73 OE1 165 1 Y 1 B GLU 67 ? OE2 ? B GLU 73 OE2 166 1 Y 1 B ASN 71 ? CG ? B ASN 77 CG 167 1 Y 1 B ASN 71 ? OD1 ? B ASN 77 OD1 168 1 Y 1 B ASN 71 ? ND2 ? B ASN 77 ND2 169 1 Y 1 B LYS 74 ? CG ? B LYS 80 CG 170 1 Y 1 B LYS 74 ? CD ? B LYS 80 CD 171 1 Y 1 B LYS 74 ? CE ? B LYS 80 CE 172 1 Y 1 B LYS 74 ? NZ ? B LYS 80 NZ 173 1 Y 1 B ARG 85 ? CG ? B ARG 91 CG 174 1 Y 1 B ARG 85 ? CD ? B ARG 91 CD 175 1 Y 1 B ARG 85 ? NE ? B ARG 91 NE 176 1 Y 1 B ARG 85 ? CZ ? B ARG 91 CZ 177 1 Y 1 B ARG 85 ? NH1 ? B ARG 91 NH1 178 1 Y 1 B ARG 85 ? NH2 ? B ARG 91 NH2 179 1 Y 1 C HIS -4 ? CG ? C HIS 2 CG 180 1 Y 1 C HIS -4 ? ND1 ? C HIS 2 ND1 181 1 Y 1 C HIS -4 ? CD2 ? C HIS 2 CD2 182 1 Y 1 C HIS -4 ? CE1 ? C HIS 2 CE1 183 1 Y 1 C HIS -4 ? NE2 ? C HIS 2 NE2 184 1 Y 1 C HIS 0 ? CB ? C HIS 6 CB 185 1 Y 1 C HIS 0 ? CG ? C HIS 6 CG 186 1 Y 1 C HIS 0 ? ND1 ? C HIS 6 ND1 187 1 Y 1 C HIS 0 ? CD2 ? C HIS 6 CD2 188 1 Y 1 C HIS 0 ? CE1 ? C HIS 6 CE1 189 1 Y 1 C HIS 0 ? NE2 ? C HIS 6 NE2 190 1 Y 1 C MSE 1 ? CG ? C MSE 7 CG 191 1 Y 1 C MSE 1 ? SE ? C MSE 7 SE 192 1 Y 1 C MSE 1 ? CE ? C MSE 7 CE 193 1 Y 1 C LYS 6 ? CG ? C LYS 12 CG 194 1 Y 1 C LYS 6 ? CD ? C LYS 12 CD 195 1 Y 1 C LYS 6 ? CE ? C LYS 12 CE 196 1 Y 1 C LYS 6 ? NZ ? C LYS 12 NZ 197 1 Y 1 C GLU 9 ? CG ? C GLU 15 CG 198 1 Y 1 C GLU 9 ? CD ? C GLU 15 CD 199 1 Y 1 C GLU 9 ? OE1 ? C GLU 15 OE1 200 1 Y 1 C GLU 9 ? OE2 ? C GLU 15 OE2 201 1 Y 1 C GLU 17 ? CG ? C GLU 23 CG 202 1 Y 1 C GLU 17 ? CD ? C GLU 23 CD 203 1 Y 1 C GLU 17 ? OE1 ? C GLU 23 OE1 204 1 Y 1 C GLU 17 ? OE2 ? C GLU 23 OE2 205 1 Y 1 C ASN 18 ? CG ? C ASN 24 CG 206 1 Y 1 C ASN 18 ? OD1 ? C ASN 24 OD1 207 1 Y 1 C ASN 18 ? ND2 ? C ASN 24 ND2 208 1 Y 1 C LYS 21 ? CG ? C LYS 27 CG 209 1 Y 1 C LYS 21 ? CD ? C LYS 27 CD 210 1 Y 1 C LYS 21 ? CE ? C LYS 27 CE 211 1 Y 1 C LYS 21 ? NZ ? C LYS 27 NZ 212 1 Y 1 C GLU 24 ? CG ? C GLU 30 CG 213 1 Y 1 C GLU 24 ? CD ? C GLU 30 CD 214 1 Y 1 C GLU 24 ? OE1 ? C GLU 30 OE1 215 1 Y 1 C GLU 24 ? OE2 ? C GLU 30 OE2 216 1 Y 1 C ARG 25 ? CG ? C ARG 31 CG 217 1 Y 1 C ARG 25 ? CD ? C ARG 31 CD 218 1 Y 1 C ARG 25 ? NE ? C ARG 31 NE 219 1 Y 1 C ARG 25 ? CZ ? C ARG 31 CZ 220 1 Y 1 C ARG 25 ? NH1 ? C ARG 31 NH1 221 1 Y 1 C ARG 25 ? NH2 ? C ARG 31 NH2 222 1 Y 1 C ILE 27 ? CG1 ? C ILE 33 CG1 223 1 Y 1 C ILE 27 ? CG2 ? C ILE 33 CG2 224 1 Y 1 C ILE 27 ? CD1 ? C ILE 33 CD1 225 1 Y 1 C THR 28 ? OG1 ? C THR 34 OG1 226 1 Y 1 C THR 28 ? CG2 ? C THR 34 CG2 227 1 Y 1 C LEU 29 ? CG ? C LEU 35 CG 228 1 Y 1 C LEU 29 ? CD1 ? C LEU 35 CD1 229 1 Y 1 C LEU 29 ? CD2 ? C LEU 35 CD2 230 1 Y 1 C THR 30 ? OG1 ? C THR 36 OG1 231 1 Y 1 C THR 30 ? CG2 ? C THR 36 CG2 232 1 Y 1 C HIS 31 ? CG ? C HIS 37 CG 233 1 Y 1 C HIS 31 ? ND1 ? C HIS 37 ND1 234 1 Y 1 C HIS 31 ? CD2 ? C HIS 37 CD2 235 1 Y 1 C HIS 31 ? CE1 ? C HIS 37 CE1 236 1 Y 1 C HIS 31 ? NE2 ? C HIS 37 NE2 237 1 Y 1 C GLU 34 ? CG ? C GLU 40 CG 238 1 Y 1 C GLU 34 ? CD ? C GLU 40 CD 239 1 Y 1 C GLU 34 ? OE1 ? C GLU 40 OE1 240 1 Y 1 C GLU 34 ? OE2 ? C GLU 40 OE2 241 1 Y 1 C LYS 35 ? CG ? C LYS 41 CG 242 1 Y 1 C LYS 35 ? CD ? C LYS 41 CD 243 1 Y 1 C LYS 35 ? CE ? C LYS 41 CE 244 1 Y 1 C LYS 35 ? NZ ? C LYS 41 NZ 245 1 Y 1 C LYS 60 ? CG ? C LYS 66 CG 246 1 Y 1 C LYS 60 ? CD ? C LYS 66 CD 247 1 Y 1 C LYS 60 ? CE ? C LYS 66 CE 248 1 Y 1 C LYS 60 ? NZ ? C LYS 66 NZ 249 1 Y 1 C SER 62 ? OG ? C SER 68 OG 250 1 Y 1 C LYS 65 ? CG ? C LYS 71 CG 251 1 Y 1 C LYS 65 ? CD ? C LYS 71 CD 252 1 Y 1 C LYS 65 ? CE ? C LYS 71 CE 253 1 Y 1 C LYS 65 ? NZ ? C LYS 71 NZ 254 1 Y 1 C GLU 67 ? CG ? C GLU 73 CG 255 1 Y 1 C GLU 67 ? CD ? C GLU 73 CD 256 1 Y 1 C GLU 67 ? OE1 ? C GLU 73 OE1 257 1 Y 1 C GLU 67 ? OE2 ? C GLU 73 OE2 258 1 Y 1 C ASN 71 ? CG ? C ASN 77 CG 259 1 Y 1 C ASN 71 ? OD1 ? C ASN 77 OD1 260 1 Y 1 C ASN 71 ? ND2 ? C ASN 77 ND2 261 1 Y 1 C LYS 74 ? CG ? C LYS 80 CG 262 1 Y 1 C LYS 74 ? CD ? C LYS 80 CD 263 1 Y 1 C LYS 74 ? CE ? C LYS 80 CE 264 1 Y 1 C LYS 74 ? NZ ? C LYS 80 NZ 265 1 Y 1 C ARG 85 ? CG ? C ARG 91 CG 266 1 Y 1 C ARG 85 ? CD ? C ARG 91 CD 267 1 Y 1 C ARG 85 ? NE ? C ARG 91 NE 268 1 Y 1 C ARG 85 ? CZ ? C ARG 91 CZ 269 1 Y 1 C ARG 85 ? NH1 ? C ARG 91 NH1 270 1 Y 1 C ARG 85 ? NH2 ? C ARG 91 NH2 271 1 Y 1 D HIS -4 ? CG ? D HIS 2 CG 272 1 Y 1 D HIS -4 ? ND1 ? D HIS 2 ND1 273 1 Y 1 D HIS -4 ? CD2 ? D HIS 2 CD2 274 1 Y 1 D HIS -4 ? CE1 ? D HIS 2 CE1 275 1 Y 1 D HIS -4 ? NE2 ? D HIS 2 NE2 276 1 Y 1 D HIS -3 ? CG ? D HIS 3 CG 277 1 Y 1 D HIS -3 ? ND1 ? D HIS 3 ND1 278 1 Y 1 D HIS -3 ? CD2 ? D HIS 3 CD2 279 1 Y 1 D HIS -3 ? CE1 ? D HIS 3 CE1 280 1 Y 1 D HIS -3 ? NE2 ? D HIS 3 NE2 281 1 Y 1 D HIS 0 ? CB ? D HIS 6 CB 282 1 Y 1 D HIS 0 ? CG ? D HIS 6 CG 283 1 Y 1 D HIS 0 ? ND1 ? D HIS 6 ND1 284 1 Y 1 D HIS 0 ? CD2 ? D HIS 6 CD2 285 1 Y 1 D HIS 0 ? CE1 ? D HIS 6 CE1 286 1 Y 1 D HIS 0 ? NE2 ? D HIS 6 NE2 287 1 Y 1 D MSE 1 ? CG ? D MSE 7 CG 288 1 Y 1 D MSE 1 ? SE ? D MSE 7 SE 289 1 Y 1 D MSE 1 ? CE ? D MSE 7 CE 290 1 Y 1 D LYS 6 ? CG ? D LYS 12 CG 291 1 Y 1 D LYS 6 ? CD ? D LYS 12 CD 292 1 Y 1 D LYS 6 ? CE ? D LYS 12 CE 293 1 Y 1 D LYS 6 ? NZ ? D LYS 12 NZ 294 1 Y 1 D GLU 13 ? CG ? D GLU 19 CG 295 1 Y 1 D GLU 13 ? CD ? D GLU 19 CD 296 1 Y 1 D GLU 13 ? OE1 ? D GLU 19 OE1 297 1 Y 1 D GLU 13 ? OE2 ? D GLU 19 OE2 298 1 Y 1 D GLU 15 ? CG ? D GLU 21 CG 299 1 Y 1 D GLU 15 ? CD ? D GLU 21 CD 300 1 Y 1 D GLU 15 ? OE1 ? D GLU 21 OE1 301 1 Y 1 D GLU 15 ? OE2 ? D GLU 21 OE2 302 1 Y 1 D GLU 17 ? CG ? D GLU 23 CG 303 1 Y 1 D GLU 17 ? CD ? D GLU 23 CD 304 1 Y 1 D GLU 17 ? OE1 ? D GLU 23 OE1 305 1 Y 1 D GLU 17 ? OE2 ? D GLU 23 OE2 306 1 Y 1 D LYS 21 ? CG ? D LYS 27 CG 307 1 Y 1 D LYS 21 ? CD ? D LYS 27 CD 308 1 Y 1 D LYS 21 ? CE ? D LYS 27 CE 309 1 Y 1 D LYS 21 ? NZ ? D LYS 27 NZ 310 1 Y 1 D GLU 24 ? CG ? D GLU 30 CG 311 1 Y 1 D GLU 24 ? CD ? D GLU 30 CD 312 1 Y 1 D GLU 24 ? OE1 ? D GLU 30 OE1 313 1 Y 1 D GLU 24 ? OE2 ? D GLU 30 OE2 314 1 Y 0 D ARG 25 ? CG ? D ARG 31 CG 315 1 Y 0 D ARG 25 ? CD ? D ARG 31 CD 316 1 Y 0 D ARG 25 ? NE ? D ARG 31 NE 317 1 Y 0 D ARG 25 ? CZ ? D ARG 31 CZ 318 1 Y 0 D ARG 25 ? NH1 ? D ARG 31 NH1 319 1 Y 0 D ARG 25 ? NH2 ? D ARG 31 NH2 320 1 Y 1 D ILE 27 ? CG1 ? D ILE 33 CG1 321 1 Y 1 D ILE 27 ? CG2 ? D ILE 33 CG2 322 1 Y 1 D ILE 27 ? CD1 ? D ILE 33 CD1 323 1 Y 1 D THR 28 ? OG1 ? D THR 34 OG1 324 1 Y 1 D THR 28 ? CG2 ? D THR 34 CG2 325 1 Y 1 D LEU 29 ? CG ? D LEU 35 CG 326 1 Y 1 D LEU 29 ? CD1 ? D LEU 35 CD1 327 1 Y 1 D LEU 29 ? CD2 ? D LEU 35 CD2 328 1 Y 1 D THR 30 ? OG1 ? D THR 36 OG1 329 1 Y 1 D THR 30 ? CG2 ? D THR 36 CG2 330 1 Y 1 D HIS 31 ? CG ? D HIS 37 CG 331 1 Y 1 D HIS 31 ? ND1 ? D HIS 37 ND1 332 1 Y 1 D HIS 31 ? CD2 ? D HIS 37 CD2 333 1 Y 1 D HIS 31 ? CE1 ? D HIS 37 CE1 334 1 Y 1 D HIS 31 ? NE2 ? D HIS 37 NE2 335 1 Y 1 D ILE 33 ? CG1 ? D ILE 39 CG1 336 1 Y 1 D ILE 33 ? CG2 ? D ILE 39 CG2 337 1 Y 1 D ILE 33 ? CD1 ? D ILE 39 CD1 338 1 Y 1 D LYS 35 ? CG ? D LYS 41 CG 339 1 Y 1 D LYS 35 ? CD ? D LYS 41 CD 340 1 Y 1 D LYS 35 ? CE ? D LYS 41 CE 341 1 Y 1 D LYS 35 ? NZ ? D LYS 41 NZ 342 1 Y 1 D LYS 60 ? CG ? D LYS 66 CG 343 1 Y 1 D LYS 60 ? CD ? D LYS 66 CD 344 1 Y 1 D LYS 60 ? CE ? D LYS 66 CE 345 1 Y 1 D LYS 60 ? NZ ? D LYS 66 NZ 346 1 Y 1 D SER 62 ? OG ? D SER 68 OG 347 1 Y 1 D GLU 64 ? CG ? D GLU 70 CG 348 1 Y 1 D GLU 64 ? CD ? D GLU 70 CD 349 1 Y 1 D GLU 64 ? OE1 ? D GLU 70 OE1 350 1 Y 1 D GLU 64 ? OE2 ? D GLU 70 OE2 351 1 Y 1 D LYS 65 ? CG ? D LYS 71 CG 352 1 Y 1 D LYS 65 ? CD ? D LYS 71 CD 353 1 Y 1 D LYS 65 ? CE ? D LYS 71 CE 354 1 Y 1 D LYS 65 ? NZ ? D LYS 71 NZ 355 1 Y 1 D THR 68 ? OG1 ? D THR 74 OG1 356 1 Y 1 D THR 68 ? CG2 ? D THR 74 CG2 357 1 Y 1 D ASN 71 ? CG ? D ASN 77 CG 358 1 Y 1 D ASN 71 ? OD1 ? D ASN 77 OD1 359 1 Y 1 D ASN 71 ? ND2 ? D ASN 77 ND2 360 1 Y 1 D LYS 74 ? CG ? D LYS 80 CG 361 1 Y 1 D LYS 74 ? CD ? D LYS 80 CD 362 1 Y 1 D LYS 74 ? CE ? D LYS 80 CE 363 1 Y 1 D LYS 74 ? NZ ? D LYS 80 NZ 364 1 Y 1 D ARG 85 ? CG ? D ARG 91 CG 365 1 Y 1 D ARG 85 ? CD ? D ARG 91 CD 366 1 Y 1 D ARG 85 ? NE ? D ARG 91 NE 367 1 Y 1 D ARG 85 ? CZ ? D ARG 91 CZ 368 1 Y 1 D ARG 85 ? NH1 ? D ARG 91 NH1 369 1 Y 1 D ARG 85 ? NH2 ? D ARG 91 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LYS 86 ? A LYS 92 2 1 Y 1 A PRO 87 ? A PRO 93 3 1 Y 1 A ARG 88 ? A ARG 94 4 1 Y 1 A PRO 89 ? A PRO 95 5 1 Y 1 A PRO 90 ? A PRO 96 6 1 Y 1 A LEU 91 ? A LEU 97 7 1 Y 1 A LEU 92 ? A LEU 98 8 1 Y 1 A VAL 93 ? A VAL 99 9 1 Y 1 A ASP 94 ? A ASP 100 10 1 Y 1 A ASN 95 ? A ASN 101 11 1 Y 1 A ASP 96 ? A ASP 102 12 1 Y 1 A LEU 97 ? A LEU 103 13 1 Y 1 B LYS 86 ? B LYS 92 14 1 Y 1 B PRO 87 ? B PRO 93 15 1 Y 1 B ARG 88 ? B ARG 94 16 1 Y 1 B PRO 89 ? B PRO 95 17 1 Y 1 B PRO 90 ? B PRO 96 18 1 Y 1 B LEU 91 ? B LEU 97 19 1 Y 1 B LEU 92 ? B LEU 98 20 1 Y 1 B VAL 93 ? B VAL 99 21 1 Y 1 B ASP 94 ? B ASP 100 22 1 Y 1 B ASN 95 ? B ASN 101 23 1 Y 1 B ASP 96 ? B ASP 102 24 1 Y 1 B LEU 97 ? B LEU 103 25 1 Y 1 C HIS -5 ? C HIS 1 26 1 Y 1 C LYS 86 ? C LYS 92 27 1 Y 1 C PRO 87 ? C PRO 93 28 1 Y 1 C ARG 88 ? C ARG 94 29 1 Y 1 C PRO 89 ? C PRO 95 30 1 Y 1 C PRO 90 ? C PRO 96 31 1 Y 1 C LEU 91 ? C LEU 97 32 1 Y 1 C LEU 92 ? C LEU 98 33 1 Y 1 C VAL 93 ? C VAL 99 34 1 Y 1 C ASP 94 ? C ASP 100 35 1 Y 1 C ASN 95 ? C ASN 101 36 1 Y 1 C ASP 96 ? C ASP 102 37 1 Y 1 C LEU 97 ? C LEU 103 38 1 Y 1 D HIS -5 ? D HIS 1 39 1 Y 1 D LYS 86 ? D LYS 92 40 1 Y 1 D PRO 87 ? D PRO 93 41 1 Y 1 D ARG 88 ? D ARG 94 42 1 Y 1 D PRO 89 ? D PRO 95 43 1 Y 1 D PRO 90 ? D PRO 96 44 1 Y 1 D LEU 91 ? D LEU 97 45 1 Y 1 D LEU 92 ? D LEU 98 46 1 Y 1 D VAL 93 ? D VAL 99 47 1 Y 1 D ASP 94 ? D ASP 100 48 1 Y 1 D ASN 95 ? D ASN 101 49 1 Y 1 D ASP 96 ? D ASP 102 50 1 Y 1 D LEU 97 ? D LEU 103 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #