data_2ID1 # _entry.id 2ID1 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.286 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2ID1 RCSB RCSB039430 WWPDB D_1000039430 # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id CvR5 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2ID1 _pdbx_database_status.recvd_initial_deposition_date 2006-09-13 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Forouhar, F.' 1 'Zhou, W.' 2 'Seetharaman, J.' 3 'Ho, C.K.' 4 'Janjua, H.' 5 'Cunningham, K.' 6 'Ma, L.C.' 7 'Xiao, R.' 8 'Liu, J.' 9 'Baran, M.' 10 'Acton, T.B.' 11 'Rost, B.' 12 'Montelione, G.T.' 13 'Tong, L.' 14 'Hunt, J.F.' 15 'Northeast Structural Genomics Consortium (NESG)' 16 # _cell.entry_id 2ID1 _cell.length_a 44.188 _cell.length_b 76.099 _cell.length_c 74.550 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2ID1 _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Hypothetical protein' 14418.881 2 ? ? ? ? 2 non-polymer syn 'IODIDE ION' 126.904 2 ? ? ? ? 3 water nat water 18.015 13 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)EIQEISKLAIEALEDIKGKDIIELDTSKLTSLFQR(MSE)IVATGDSNRQVKALANSVQVKLKEAGVDIVGSEGH ESGEWVLVDAGDVVVHV(MSE)LPAVRDYYDIEALWGGQKPSFAVGAAKPWSAVLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MEIQEISKLAIEALEDIKGKDIIELDTSKLTSLFQRMIVATGDSNRQVKALANSVQVKLKEAGVDIVGSEGHESGEWVLV DAGDVVVHVMLPAVRDYYDIEALWGGQKPSFAVGAAKPWSAVLEHHHHHH ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier CvR5 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 GLU n 1 3 ILE n 1 4 GLN n 1 5 GLU n 1 6 ILE n 1 7 SER n 1 8 LYS n 1 9 LEU n 1 10 ALA n 1 11 ILE n 1 12 GLU n 1 13 ALA n 1 14 LEU n 1 15 GLU n 1 16 ASP n 1 17 ILE n 1 18 LYS n 1 19 GLY n 1 20 LYS n 1 21 ASP n 1 22 ILE n 1 23 ILE n 1 24 GLU n 1 25 LEU n 1 26 ASP n 1 27 THR n 1 28 SER n 1 29 LYS n 1 30 LEU n 1 31 THR n 1 32 SER n 1 33 LEU n 1 34 PHE n 1 35 GLN n 1 36 ARG n 1 37 MSE n 1 38 ILE n 1 39 VAL n 1 40 ALA n 1 41 THR n 1 42 GLY n 1 43 ASP n 1 44 SER n 1 45 ASN n 1 46 ARG n 1 47 GLN n 1 48 VAL n 1 49 LYS n 1 50 ALA n 1 51 LEU n 1 52 ALA n 1 53 ASN n 1 54 SER n 1 55 VAL n 1 56 GLN n 1 57 VAL n 1 58 LYS n 1 59 LEU n 1 60 LYS n 1 61 GLU n 1 62 ALA n 1 63 GLY n 1 64 VAL n 1 65 ASP n 1 66 ILE n 1 67 VAL n 1 68 GLY n 1 69 SER n 1 70 GLU n 1 71 GLY n 1 72 HIS n 1 73 GLU n 1 74 SER n 1 75 GLY n 1 76 GLU n 1 77 TRP n 1 78 VAL n 1 79 LEU n 1 80 VAL n 1 81 ASP n 1 82 ALA n 1 83 GLY n 1 84 ASP n 1 85 VAL n 1 86 VAL n 1 87 VAL n 1 88 HIS n 1 89 VAL n 1 90 MSE n 1 91 LEU n 1 92 PRO n 1 93 ALA n 1 94 VAL n 1 95 ARG n 1 96 ASP n 1 97 TYR n 1 98 TYR n 1 99 ASP n 1 100 ILE n 1 101 GLU n 1 102 ALA n 1 103 LEU n 1 104 TRP n 1 105 GLY n 1 106 GLY n 1 107 GLN n 1 108 LYS n 1 109 PRO n 1 110 SER n 1 111 PHE n 1 112 ALA n 1 113 VAL n 1 114 GLY n 1 115 ALA n 1 116 ALA n 1 117 LYS n 1 118 PRO n 1 119 TRP n 1 120 SER n 1 121 ALA n 1 122 VAL n 1 123 LEU n 1 124 GLU n 1 125 HIS n 1 126 HIS n 1 127 HIS n 1 128 HIS n 1 129 HIS n 1 130 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Chromobacterium _entity_src_gen.pdbx_gene_src_gene CV_0518 _entity_src_gen.gene_src_species 'Chromobacterium violaceum' _entity_src_gen.gene_src_strain 'ATCC 12472' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Chromobacterium violaceum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 243365 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)+Magic' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET21 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q7P0P8_CHRVO _struct_ref.pdbx_db_accession Q7P0P8 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2ID1 A 1 ? 122 ? Q7P0P8 1 ? 122 ? 1 122 2 1 2ID1 B 1 ? 122 ? Q7P0P8 1 ? 122 ? 1 122 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2ID1 MSE A 1 ? UNP Q7P0P8 MET 1 'MODIFIED RESIDUE' 1 1 1 2ID1 MSE A 37 ? UNP Q7P0P8 MET 37 'MODIFIED RESIDUE' 37 2 1 2ID1 MSE A 90 ? UNP Q7P0P8 MET 90 'MODIFIED RESIDUE' 90 3 1 2ID1 LEU A 123 ? UNP Q7P0P8 ? ? 'EXPRESSION TAG' 123 4 1 2ID1 GLU A 124 ? UNP Q7P0P8 ? ? 'EXPRESSION TAG' 124 5 1 2ID1 HIS A 125 ? UNP Q7P0P8 ? ? 'EXPRESSION TAG' 125 6 1 2ID1 HIS A 126 ? UNP Q7P0P8 ? ? 'EXPRESSION TAG' 126 7 1 2ID1 HIS A 127 ? UNP Q7P0P8 ? ? 'EXPRESSION TAG' 127 8 1 2ID1 HIS A 128 ? UNP Q7P0P8 ? ? 'EXPRESSION TAG' 128 9 1 2ID1 HIS A 129 ? UNP Q7P0P8 ? ? 'EXPRESSION TAG' 129 10 1 2ID1 HIS A 130 ? UNP Q7P0P8 ? ? 'EXPRESSION TAG' 130 11 2 2ID1 MSE B 1 ? UNP Q7P0P8 MET 1 'MODIFIED RESIDUE' 1 12 2 2ID1 MSE B 37 ? UNP Q7P0P8 MET 37 'MODIFIED RESIDUE' 37 13 2 2ID1 MSE B 90 ? UNP Q7P0P8 MET 90 'MODIFIED RESIDUE' 90 14 2 2ID1 LEU B 123 ? UNP Q7P0P8 ? ? 'EXPRESSION TAG' 123 15 2 2ID1 GLU B 124 ? UNP Q7P0P8 ? ? 'EXPRESSION TAG' 124 16 2 2ID1 HIS B 125 ? UNP Q7P0P8 ? ? 'EXPRESSION TAG' 125 17 2 2ID1 HIS B 126 ? UNP Q7P0P8 ? ? 'EXPRESSION TAG' 126 18 2 2ID1 HIS B 127 ? UNP Q7P0P8 ? ? 'EXPRESSION TAG' 127 19 2 2ID1 HIS B 128 ? UNP Q7P0P8 ? ? 'EXPRESSION TAG' 128 20 2 2ID1 HIS B 129 ? UNP Q7P0P8 ? ? 'EXPRESSION TAG' 129 21 2 2ID1 HIS B 130 ? UNP Q7P0P8 ? ? 'EXPRESSION TAG' 130 22 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 IOD non-polymer . 'IODIDE ION' ? 'I -1' 126.904 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2ID1 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.17 _exptl_crystal.density_percent_sol 43.39 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pdbx_details ;20mM Tris, 16% PEG3350, 125mM ammonium iodide, 8% 1,3-butanediol, and 5 mM DTT, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K ; _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 4' _diffrn_detector.pdbx_collection_date 2006-06-20 _diffrn_detector.details mirrors. # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Si 111 CHANNEL' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97899 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X4A' _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X4A _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.97899 # _reflns.entry_id 2ID1 _reflns.observed_criterion_sigma_I 0 _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 26.68 _reflns.d_resolution_high 3.0 _reflns.number_obs 9635 _reflns.number_all 9722 _reflns.percent_possible_obs 99.1 _reflns.pdbx_Rmerge_I_obs 0.078 _reflns.pdbx_Rsym_value 0.065 _reflns.pdbx_netI_over_sigmaI 24.5 _reflns.B_iso_Wilson_estimate 50 _reflns.pdbx_redundancy 8.6 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 3.0 _reflns_shell.d_res_low 3.15 _reflns_shell.percent_possible_all 100 _reflns_shell.Rmerge_I_obs 0.374 _reflns_shell.pdbx_Rsym_value 0.324 _reflns_shell.meanI_over_sigI_obs 5.1 _reflns_shell.pdbx_redundancy 8.9 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 1255 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 2ID1 _refine.ls_number_reflns_obs 8827 _refine.ls_number_reflns_all 9722 _refine.pdbx_ls_sigma_I 2.0 _refine.pdbx_ls_sigma_F 2.0 _refine.pdbx_data_cutoff_high_absF 75416.44 _refine.pdbx_data_cutoff_low_absF 0.000000 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 26.68 _refine.ls_d_res_high 3.00 _refine.ls_percent_reflns_obs 90.8 _refine.ls_R_factor_obs 0.228 _refine.ls_R_factor_all 0.234 _refine.ls_R_factor_R_work 0.228 _refine.ls_R_factor_R_free 0.269 _refine.ls_R_factor_R_free_error 0.009 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 10.1 _refine.ls_number_reflns_R_free 888 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 47.3 _refine.aniso_B[1][1] -0.45 _refine.aniso_B[2][2] 8.77 _refine.aniso_B[3][3] -8.33 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.285038 _refine.solvent_model_param_bsol 12.0278 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model OVERALL _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 2ID1 _refine_analyze.Luzzati_coordinate_error_obs 0.37 _refine_analyze.Luzzati_sigma_a_obs 0.44 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.47 _refine_analyze.Luzzati_sigma_a_free 0.46 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1830 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 2 _refine_hist.number_atoms_solvent 13 _refine_hist.number_atoms_total 1845 _refine_hist.d_res_high 3.00 _refine_hist.d_res_low 26.68 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.008 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.1 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 22.8 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.74 ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 3.00 _refine_ls_shell.d_res_low 3.19 _refine_ls_shell.number_reflns_R_work 1222 _refine_ls_shell.R_factor_R_work 0.304 _refine_ls_shell.percent_reflns_obs 82.3 _refine_ls_shell.R_factor_R_free 0.304 _refine_ls_shell.R_factor_R_free_error 0.028 _refine_ls_shell.percent_reflns_R_free 9.0 _refine_ls_shell.number_reflns_R_free 121 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs 1222 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 2ID1 _struct.title 'X-Ray Crystal Structure of Protein CV0518 from Chromobacterium violaceum, Northeast Structural Genomics Consortium Target CvR5.' _struct.pdbx_descriptor 'Hypothetical protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2ID1 _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;alpha-beta protein, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 2 ? ILE A 17 ? GLU A 2 ILE A 17 1 ? 16 HELX_P HELX_P2 2 SER A 28 ? LEU A 30 ? SER A 28 LEU A 30 5 ? 3 HELX_P HELX_P3 3 SER A 44 ? ALA A 62 ? SER A 44 ALA A 62 1 ? 19 HELX_P HELX_P4 4 LEU A 91 ? ASP A 99 ? LEU A 91 ASP A 99 1 ? 9 HELX_P HELX_P5 5 ASP A 99 ? TRP A 104 ? ASP A 99 TRP A 104 1 ? 6 HELX_P HELX_P6 6 GLU B 2 ? ILE B 17 ? GLU B 2 ILE B 17 1 ? 16 HELX_P HELX_P7 7 SER B 28 ? LEU B 30 ? SER B 28 LEU B 30 5 ? 3 HELX_P HELX_P8 8 SER B 44 ? ALA B 62 ? SER B 44 ALA B 62 1 ? 19 HELX_P HELX_P9 9 LEU B 91 ? ASP B 99 ? LEU B 91 ASP B 99 1 ? 9 HELX_P HELX_P10 10 ASP B 99 ? TRP B 104 ? ASP B 99 TRP B 104 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A MSE 1 C ? ? ? 1_555 A GLU 2 N ? ? A MSE 1 A GLU 2 1_555 ? ? ? ? ? ? ? 1.334 ? covale2 covale ? ? A ARG 36 C ? ? ? 1_555 A MSE 37 N ? ? A ARG 36 A MSE 37 1_555 ? ? ? ? ? ? ? 1.327 ? covale3 covale ? ? A MSE 37 C ? ? ? 1_555 A ILE 38 N ? ? A MSE 37 A ILE 38 1_555 ? ? ? ? ? ? ? 1.323 ? covale4 covale ? ? A VAL 89 C ? ? ? 1_555 A MSE 90 N ? ? A VAL 89 A MSE 90 1_555 ? ? ? ? ? ? ? 1.330 ? covale5 covale ? ? A MSE 90 C ? ? ? 1_555 A LEU 91 N ? ? A MSE 90 A LEU 91 1_555 ? ? ? ? ? ? ? 1.330 ? covale6 covale ? ? B MSE 1 C ? ? ? 1_555 B GLU 2 N ? ? B MSE 1 B GLU 2 1_555 ? ? ? ? ? ? ? 1.330 ? covale7 covale ? ? B ARG 36 C ? ? ? 1_555 B MSE 37 N ? ? B ARG 36 B MSE 37 1_555 ? ? ? ? ? ? ? 1.328 ? covale8 covale ? ? B MSE 37 C ? ? ? 1_555 B ILE 38 N ? ? B MSE 37 B ILE 38 1_555 ? ? ? ? ? ? ? 1.323 ? covale9 covale ? ? B VAL 89 C ? ? ? 1_555 B MSE 90 N ? ? B VAL 89 B MSE 90 1_555 ? ? ? ? ? ? ? 1.327 ? covale10 covale ? ? B MSE 90 C ? ? ? 1_555 B LEU 91 N ? ? B MSE 90 B LEU 91 1_555 ? ? ? ? ? ? ? 1.327 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? parallel B 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 20 ? ASP A 26 ? LYS A 20 ASP A 26 A 2 ARG A 36 ? THR A 41 ? ARG A 36 THR A 41 A 3 VAL A 85 ? MSE A 90 ? VAL A 85 MSE A 90 A 4 TRP A 77 ? ALA A 82 ? TRP A 77 ALA A 82 B 1 LYS B 20 ? ASP B 26 ? LYS B 20 ASP B 26 B 2 ARG B 36 ? THR B 41 ? ARG B 36 THR B 41 B 3 VAL B 85 ? MSE B 90 ? VAL B 85 MSE B 90 B 4 TRP B 77 ? ALA B 82 ? TRP B 77 ALA B 82 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LYS A 20 ? N LYS A 20 O THR A 41 ? O THR A 41 A 2 3 N ILE A 38 ? N ILE A 38 O HIS A 88 ? O HIS A 88 A 3 4 O VAL A 89 ? O VAL A 89 N VAL A 78 ? N VAL A 78 B 1 2 N LYS B 20 ? N LYS B 20 O THR B 41 ? O THR B 41 B 2 3 N ILE B 38 ? N ILE B 38 O HIS B 88 ? O HIS B 88 B 3 4 O VAL B 89 ? O VAL B 89 N VAL B 78 ? N VAL B 78 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 2 _struct_site.details 'BINDING SITE FOR RESIDUE IOD A 131' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 TRP A 104 ? TRP A 104 . ? 1_555 ? 2 AC1 2 ASN B 53 ? ASN B 53 . ? 1_555 ? # _database_PDB_matrix.entry_id 2ID1 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2ID1 _atom_sites.fract_transf_matrix[1][1] 0.022631 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013141 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013414 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C I N O SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 1 MSE MSE A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 GLN 4 4 4 GLN GLN A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 MSE 37 37 37 MSE MSE A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 ASN 45 45 45 ASN ASN A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 GLN 47 47 47 GLN GLN A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 HIS 72 72 72 HIS HIS A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 TRP 77 77 77 TRP TRP A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 HIS 88 88 88 HIS HIS A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 MSE 90 90 90 MSE MSE A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 ARG 95 95 95 ARG ARG A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 TYR 97 97 97 TYR TYR A . n A 1 98 TYR 98 98 98 TYR TYR A . n A 1 99 ASP 99 99 99 ASP ASP A . n A 1 100 ILE 100 100 100 ILE ILE A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 TRP 104 104 104 TRP TRP A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 GLN 107 107 107 GLN GLN A . n A 1 108 LYS 108 108 108 LYS LYS A . n A 1 109 PRO 109 109 109 PRO PRO A . n A 1 110 SER 110 110 110 SER SER A . n A 1 111 PHE 111 111 111 PHE PHE A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 VAL 113 113 113 VAL VAL A . n A 1 114 GLY 114 114 114 GLY GLY A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 LYS 117 117 117 LYS LYS A . n A 1 118 PRO 118 118 118 PRO PRO A . n A 1 119 TRP 119 119 119 TRP TRP A . n A 1 120 SER 120 120 120 SER SER A . n A 1 121 ALA 121 121 ? ? ? A . n A 1 122 VAL 122 122 ? ? ? A . n A 1 123 LEU 123 123 ? ? ? A . n A 1 124 GLU 124 124 ? ? ? A . n A 1 125 HIS 125 125 ? ? ? A . n A 1 126 HIS 126 126 ? ? ? A . n A 1 127 HIS 127 127 ? ? ? A . n A 1 128 HIS 128 128 ? ? ? A . n A 1 129 HIS 129 129 ? ? ? A . n A 1 130 HIS 130 130 ? ? ? A . n B 1 1 MSE 1 1 1 MSE MSE B . n B 1 2 GLU 2 2 2 GLU GLU B . n B 1 3 ILE 3 3 3 ILE ILE B . n B 1 4 GLN 4 4 4 GLN GLN B . n B 1 5 GLU 5 5 5 GLU GLU B . n B 1 6 ILE 6 6 6 ILE ILE B . n B 1 7 SER 7 7 7 SER SER B . n B 1 8 LYS 8 8 8 LYS LYS B . n B 1 9 LEU 9 9 9 LEU LEU B . n B 1 10 ALA 10 10 10 ALA ALA B . n B 1 11 ILE 11 11 11 ILE ILE B . n B 1 12 GLU 12 12 12 GLU GLU B . n B 1 13 ALA 13 13 13 ALA ALA B . n B 1 14 LEU 14 14 14 LEU LEU B . n B 1 15 GLU 15 15 15 GLU GLU B . n B 1 16 ASP 16 16 16 ASP ASP B . n B 1 17 ILE 17 17 17 ILE ILE B . n B 1 18 LYS 18 18 18 LYS LYS B . n B 1 19 GLY 19 19 19 GLY GLY B . n B 1 20 LYS 20 20 20 LYS LYS B . n B 1 21 ASP 21 21 21 ASP ASP B . n B 1 22 ILE 22 22 22 ILE ILE B . n B 1 23 ILE 23 23 23 ILE ILE B . n B 1 24 GLU 24 24 24 GLU GLU B . n B 1 25 LEU 25 25 25 LEU LEU B . n B 1 26 ASP 26 26 26 ASP ASP B . n B 1 27 THR 27 27 27 THR THR B . n B 1 28 SER 28 28 28 SER SER B . n B 1 29 LYS 29 29 29 LYS LYS B . n B 1 30 LEU 30 30 30 LEU LEU B . n B 1 31 THR 31 31 31 THR THR B . n B 1 32 SER 32 32 32 SER SER B . n B 1 33 LEU 33 33 33 LEU LEU B . n B 1 34 PHE 34 34 34 PHE PHE B . n B 1 35 GLN 35 35 35 GLN GLN B . n B 1 36 ARG 36 36 36 ARG ARG B . n B 1 37 MSE 37 37 37 MSE MSE B . n B 1 38 ILE 38 38 38 ILE ILE B . n B 1 39 VAL 39 39 39 VAL VAL B . n B 1 40 ALA 40 40 40 ALA ALA B . n B 1 41 THR 41 41 41 THR THR B . n B 1 42 GLY 42 42 42 GLY GLY B . n B 1 43 ASP 43 43 43 ASP ASP B . n B 1 44 SER 44 44 44 SER SER B . n B 1 45 ASN 45 45 45 ASN ASN B . n B 1 46 ARG 46 46 46 ARG ARG B . n B 1 47 GLN 47 47 47 GLN GLN B . n B 1 48 VAL 48 48 48 VAL VAL B . n B 1 49 LYS 49 49 49 LYS LYS B . n B 1 50 ALA 50 50 50 ALA ALA B . n B 1 51 LEU 51 51 51 LEU LEU B . n B 1 52 ALA 52 52 52 ALA ALA B . n B 1 53 ASN 53 53 53 ASN ASN B . n B 1 54 SER 54 54 54 SER SER B . n B 1 55 VAL 55 55 55 VAL VAL B . n B 1 56 GLN 56 56 56 GLN GLN B . n B 1 57 VAL 57 57 57 VAL VAL B . n B 1 58 LYS 58 58 58 LYS LYS B . n B 1 59 LEU 59 59 59 LEU LEU B . n B 1 60 LYS 60 60 60 LYS LYS B . n B 1 61 GLU 61 61 61 GLU GLU B . n B 1 62 ALA 62 62 62 ALA ALA B . n B 1 63 GLY 63 63 63 GLY GLY B . n B 1 64 VAL 64 64 64 VAL VAL B . n B 1 65 ASP 65 65 65 ASP ASP B . n B 1 66 ILE 66 66 66 ILE ILE B . n B 1 67 VAL 67 67 67 VAL VAL B . n B 1 68 GLY 68 68 68 GLY GLY B . n B 1 69 SER 69 69 69 SER SER B . n B 1 70 GLU 70 70 70 GLU GLU B . n B 1 71 GLY 71 71 71 GLY GLY B . n B 1 72 HIS 72 72 72 HIS HIS B . n B 1 73 GLU 73 73 73 GLU GLU B . n B 1 74 SER 74 74 74 SER SER B . n B 1 75 GLY 75 75 75 GLY GLY B . n B 1 76 GLU 76 76 76 GLU GLU B . n B 1 77 TRP 77 77 77 TRP TRP B . n B 1 78 VAL 78 78 78 VAL VAL B . n B 1 79 LEU 79 79 79 LEU LEU B . n B 1 80 VAL 80 80 80 VAL VAL B . n B 1 81 ASP 81 81 81 ASP ASP B . n B 1 82 ALA 82 82 82 ALA ALA B . n B 1 83 GLY 83 83 83 GLY GLY B . n B 1 84 ASP 84 84 84 ASP ASP B . n B 1 85 VAL 85 85 85 VAL VAL B . n B 1 86 VAL 86 86 86 VAL VAL B . n B 1 87 VAL 87 87 87 VAL VAL B . n B 1 88 HIS 88 88 88 HIS HIS B . n B 1 89 VAL 89 89 89 VAL VAL B . n B 1 90 MSE 90 90 90 MSE MSE B . n B 1 91 LEU 91 91 91 LEU LEU B . n B 1 92 PRO 92 92 92 PRO PRO B . n B 1 93 ALA 93 93 93 ALA ALA B . n B 1 94 VAL 94 94 94 VAL VAL B . n B 1 95 ARG 95 95 95 ARG ARG B . n B 1 96 ASP 96 96 96 ASP ASP B . n B 1 97 TYR 97 97 97 TYR TYR B . n B 1 98 TYR 98 98 98 TYR TYR B . n B 1 99 ASP 99 99 99 ASP ASP B . n B 1 100 ILE 100 100 100 ILE ILE B . n B 1 101 GLU 101 101 101 GLU GLU B . n B 1 102 ALA 102 102 102 ALA ALA B . n B 1 103 LEU 103 103 103 LEU LEU B . n B 1 104 TRP 104 104 104 TRP TRP B . n B 1 105 GLY 105 105 105 GLY GLY B . n B 1 106 GLY 106 106 106 GLY GLY B . n B 1 107 GLN 107 107 107 GLN GLN B . n B 1 108 LYS 108 108 108 LYS LYS B . n B 1 109 PRO 109 109 109 PRO PRO B . n B 1 110 SER 110 110 110 SER SER B . n B 1 111 PHE 111 111 111 PHE PHE B . n B 1 112 ALA 112 112 112 ALA ALA B . n B 1 113 VAL 113 113 113 VAL VAL B . n B 1 114 GLY 114 114 114 GLY GLY B . n B 1 115 ALA 115 115 115 ALA ALA B . n B 1 116 ALA 116 116 116 ALA ALA B . n B 1 117 LYS 117 117 117 LYS LYS B . n B 1 118 PRO 118 118 118 PRO PRO B . n B 1 119 TRP 119 119 119 TRP TRP B . n B 1 120 SER 120 120 120 SER SER B . n B 1 121 ALA 121 121 ? ? ? B . n B 1 122 VAL 122 122 ? ? ? B . n B 1 123 LEU 123 123 ? ? ? B . n B 1 124 GLU 124 124 ? ? ? B . n B 1 125 HIS 125 125 ? ? ? B . n B 1 126 HIS 126 126 ? ? ? B . n B 1 127 HIS 127 127 ? ? ? B . n B 1 128 HIS 128 128 ? ? ? B . n B 1 129 HIS 129 129 ? ? ? B . n B 1 130 HIS 130 130 ? ? ? B . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.initial_of_center NESG # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 IOD 1 131 21 IOD IOD A . D 2 IOD 1 131 22 IOD IOD B . E 3 HOH 1 132 1 HOH HOH A . E 3 HOH 2 133 3 HOH HOH A . E 3 HOH 3 134 4 HOH HOH A . E 3 HOH 4 135 6 HOH HOH A . E 3 HOH 5 136 8 HOH HOH A . E 3 HOH 6 137 10 HOH HOH A . E 3 HOH 7 138 11 HOH HOH A . F 3 HOH 1 132 2 HOH HOH B . F 3 HOH 2 133 5 HOH HOH B . F 3 HOH 3 134 7 HOH HOH B . F 3 HOH 4 135 9 HOH HOH B . F 3 HOH 5 136 12 HOH HOH B . F 3 HOH 6 137 13 HOH HOH B . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 1 A MSE 1 ? MET SELENOMETHIONINE 2 A MSE 37 A MSE 37 ? MET SELENOMETHIONINE 3 A MSE 90 A MSE 90 ? MET SELENOMETHIONINE 4 B MSE 1 B MSE 1 ? MET SELENOMETHIONINE 5 B MSE 37 B MSE 37 ? MET SELENOMETHIONINE 6 B MSE 90 B MSE 90 ? MET SELENOMETHIONINE # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 author_defined_assembly ? monomeric 1 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,C,E 2 1 B,D,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2006-09-26 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2017-10-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Source and taxonomy' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Refinement description' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 4 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category software # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 4 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_software.name' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement 1.1 ? 1 ADSC 'data collection' QUANTUM ? 2 HKL-2000 'data reduction' . ? 3 SCALEPACK 'data scaling' . ? 4 SnB phasing . ? 5 SOLVE phasing . ? 6 RESOLVE phasing . ? 7 XTALVIEW refinement . ? 8 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 18 ? ? 37.35 65.87 2 1 TRP A 104 ? ? -88.98 35.37 3 1 PHE A 111 ? ? -117.44 -94.04 4 1 VAL A 113 ? ? -141.58 -24.46 5 1 ALA A 115 ? ? -162.72 45.89 6 1 LYS B 18 ? ? 37.94 65.37 7 1 TRP B 104 ? ? -88.05 34.47 8 1 PHE B 111 ? ? -117.78 -93.96 9 1 VAL B 113 ? ? -141.22 -24.42 10 1 ALA B 115 ? ? -162.49 45.48 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA 121 ? A ALA 121 2 1 Y 1 A VAL 122 ? A VAL 122 3 1 Y 1 A LEU 123 ? A LEU 123 4 1 Y 1 A GLU 124 ? A GLU 124 5 1 Y 1 A HIS 125 ? A HIS 125 6 1 Y 1 A HIS 126 ? A HIS 126 7 1 Y 1 A HIS 127 ? A HIS 127 8 1 Y 1 A HIS 128 ? A HIS 128 9 1 Y 1 A HIS 129 ? A HIS 129 10 1 Y 1 A HIS 130 ? A HIS 130 11 1 Y 1 B ALA 121 ? B ALA 121 12 1 Y 1 B VAL 122 ? B VAL 122 13 1 Y 1 B LEU 123 ? B LEU 123 14 1 Y 1 B GLU 124 ? B GLU 124 15 1 Y 1 B HIS 125 ? B HIS 125 16 1 Y 1 B HIS 126 ? B HIS 126 17 1 Y 1 B HIS 127 ? B HIS 127 18 1 Y 1 B HIS 128 ? B HIS 128 19 1 Y 1 B HIS 129 ? B HIS 129 20 1 Y 1 B HIS 130 ? B HIS 130 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'IODIDE ION' IOD 3 water HOH #