data_2IY8 # _entry.id 2IY8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.329 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2IY8 PDBE EBI-29377 WWPDB D_1290029377 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 2C83 unspecified 'STRUCTURAL ANALYSIS OF THE ALPHA-2,6- SIALYLTRANSFERASE PM0188' PDB 2C84 unspecified 'ALPHA-2,6-SIALYLTRANSFERASE PM0188 WITH CMP' PDB 2EX0 unspecified 'CRYSTAL STRUCTURE OF MULTIFUNCTIONAL SIALYLTRANSFERASE FROMPASTEURELLA MULTOCIDA' PDB 2EX1 unspecified 'CRYSTAL STRUCTURE OF MUTIFUNCTIONAL SIALYLTRANSFERASE FROMPASTEURELLA MULTOCIDA WITH CMP BOUND' PDB 2IY7 unspecified 'CRYSTAL STRUCTURE OF THE SIALYLTRANSFERASE PM0188 WITH CMP-3FNEUAC' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2IY8 _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2006-07-13 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kim, D.U.' 1 ? 'Cho, H.S.' 2 ? # _citation.id primary _citation.title 'Structural analysis of sialyltransferase PM0188 from Pasteurella multocida complexed with donor analogue and acceptor sugar.' _citation.journal_abbrev 'Bmb Rep' _citation.journal_volume 41 _citation.page_first 48 _citation.page_last 54 _citation.year 2008 _citation.journal_id_ASTM ? _citation.country KR _citation.journal_id_ISSN 1976-6696 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18304450 _citation.pdbx_database_id_DOI 10.5483/bmbrep.2008.41.1.048 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kim, D.U.' 1 ? primary 'Yoo, J.H.' 2 ? primary 'Lee, Y.J.' 3 ? primary 'Kim, K.S.' 4 ? primary 'Cho, H.S.' 5 ? # _cell.entry_id 2IY8 _cell.length_a 64.736 _cell.length_b 65.447 _cell.length_c 105.645 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2IY8 _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'PROTEIN PM0188' 45534.484 1 ? ? ? ? 2 branched man 'beta-D-galactopyranose-(1-4)-beta-D-glucopyranose' 342.297 1 ? ? ? ? 3 non-polymer syn ;CYTIDINE-5'-MONOPHOSPHATE-3-FLUORO-N-ACETYL-NEURAMINIC ACID ; 632.442 1 ? ? ? ? 4 water nat water 18.015 130 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'SIALYLTRANSFERASE PM0188' 2 beta-lactose # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;SKTITLYLDPASLPALNQL(MSE)DFTQNNEDKTHPRIFGLSRFKIPDNIITQYQNIHFVELKDNRPTEALFTILDQYPG NIELNIHLNIAHSVQLIRPILAYRFKHLDRVSIQQLNLYDDGS(MSE)EYVDLEKEENKDISAEIKQAEKQLSHYLLTGK IKFDNPTIARYVWQSAFPVKYHFLSTDYFEKAEFLQPLKEYLAENYQK(MSE)DWTAYQQLTPEQQAFYLTLVGFNDEVK QSLEVQQAKFIFTGTTTWEGNTEVREYYAQQQLNLLNHFTQAEGDLFIGDHYKIYFKGHPRGGEINDYILNNAKNITNIP ANISFEVL(MSE)(MSE)TGLLPDKVGGVASSLYFSLPKEKISHIIFTSNKQVKSKEDALNNPYVKV(MSE)RRLGIIDE SQVIFWDSLKELG ; _entity_poly.pdbx_seq_one_letter_code_can ;SKTITLYLDPASLPALNQLMDFTQNNEDKTHPRIFGLSRFKIPDNIITQYQNIHFVELKDNRPTEALFTILDQYPGNIEL NIHLNIAHSVQLIRPILAYRFKHLDRVSIQQLNLYDDGSMEYVDLEKEENKDISAEIKQAEKQLSHYLLTGKIKFDNPTI ARYVWQSAFPVKYHFLSTDYFEKAEFLQPLKEYLAENYQKMDWTAYQQLTPEQQAFYLTLVGFNDEVKQSLEVQQAKFIF TGTTTWEGNTEVREYYAQQQLNLLNHFTQAEGDLFIGDHYKIYFKGHPRGGEINDYILNNAKNITNIPANISFEVLMMTG LLPDKVGGVASSLYFSLPKEKISHIIFTSNKQVKSKEDALNNPYVKVMRRLGIIDESQVIFWDSLKELG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 LYS n 1 3 THR n 1 4 ILE n 1 5 THR n 1 6 LEU n 1 7 TYR n 1 8 LEU n 1 9 ASP n 1 10 PRO n 1 11 ALA n 1 12 SER n 1 13 LEU n 1 14 PRO n 1 15 ALA n 1 16 LEU n 1 17 ASN n 1 18 GLN n 1 19 LEU n 1 20 MSE n 1 21 ASP n 1 22 PHE n 1 23 THR n 1 24 GLN n 1 25 ASN n 1 26 ASN n 1 27 GLU n 1 28 ASP n 1 29 LYS n 1 30 THR n 1 31 HIS n 1 32 PRO n 1 33 ARG n 1 34 ILE n 1 35 PHE n 1 36 GLY n 1 37 LEU n 1 38 SER n 1 39 ARG n 1 40 PHE n 1 41 LYS n 1 42 ILE n 1 43 PRO n 1 44 ASP n 1 45 ASN n 1 46 ILE n 1 47 ILE n 1 48 THR n 1 49 GLN n 1 50 TYR n 1 51 GLN n 1 52 ASN n 1 53 ILE n 1 54 HIS n 1 55 PHE n 1 56 VAL n 1 57 GLU n 1 58 LEU n 1 59 LYS n 1 60 ASP n 1 61 ASN n 1 62 ARG n 1 63 PRO n 1 64 THR n 1 65 GLU n 1 66 ALA n 1 67 LEU n 1 68 PHE n 1 69 THR n 1 70 ILE n 1 71 LEU n 1 72 ASP n 1 73 GLN n 1 74 TYR n 1 75 PRO n 1 76 GLY n 1 77 ASN n 1 78 ILE n 1 79 GLU n 1 80 LEU n 1 81 ASN n 1 82 ILE n 1 83 HIS n 1 84 LEU n 1 85 ASN n 1 86 ILE n 1 87 ALA n 1 88 HIS n 1 89 SER n 1 90 VAL n 1 91 GLN n 1 92 LEU n 1 93 ILE n 1 94 ARG n 1 95 PRO n 1 96 ILE n 1 97 LEU n 1 98 ALA n 1 99 TYR n 1 100 ARG n 1 101 PHE n 1 102 LYS n 1 103 HIS n 1 104 LEU n 1 105 ASP n 1 106 ARG n 1 107 VAL n 1 108 SER n 1 109 ILE n 1 110 GLN n 1 111 GLN n 1 112 LEU n 1 113 ASN n 1 114 LEU n 1 115 TYR n 1 116 ASP n 1 117 ASP n 1 118 GLY n 1 119 SER n 1 120 MSE n 1 121 GLU n 1 122 TYR n 1 123 VAL n 1 124 ASP n 1 125 LEU n 1 126 GLU n 1 127 LYS n 1 128 GLU n 1 129 GLU n 1 130 ASN n 1 131 LYS n 1 132 ASP n 1 133 ILE n 1 134 SER n 1 135 ALA n 1 136 GLU n 1 137 ILE n 1 138 LYS n 1 139 GLN n 1 140 ALA n 1 141 GLU n 1 142 LYS n 1 143 GLN n 1 144 LEU n 1 145 SER n 1 146 HIS n 1 147 TYR n 1 148 LEU n 1 149 LEU n 1 150 THR n 1 151 GLY n 1 152 LYS n 1 153 ILE n 1 154 LYS n 1 155 PHE n 1 156 ASP n 1 157 ASN n 1 158 PRO n 1 159 THR n 1 160 ILE n 1 161 ALA n 1 162 ARG n 1 163 TYR n 1 164 VAL n 1 165 TRP n 1 166 GLN n 1 167 SER n 1 168 ALA n 1 169 PHE n 1 170 PRO n 1 171 VAL n 1 172 LYS n 1 173 TYR n 1 174 HIS n 1 175 PHE n 1 176 LEU n 1 177 SER n 1 178 THR n 1 179 ASP n 1 180 TYR n 1 181 PHE n 1 182 GLU n 1 183 LYS n 1 184 ALA n 1 185 GLU n 1 186 PHE n 1 187 LEU n 1 188 GLN n 1 189 PRO n 1 190 LEU n 1 191 LYS n 1 192 GLU n 1 193 TYR n 1 194 LEU n 1 195 ALA n 1 196 GLU n 1 197 ASN n 1 198 TYR n 1 199 GLN n 1 200 LYS n 1 201 MSE n 1 202 ASP n 1 203 TRP n 1 204 THR n 1 205 ALA n 1 206 TYR n 1 207 GLN n 1 208 GLN n 1 209 LEU n 1 210 THR n 1 211 PRO n 1 212 GLU n 1 213 GLN n 1 214 GLN n 1 215 ALA n 1 216 PHE n 1 217 TYR n 1 218 LEU n 1 219 THR n 1 220 LEU n 1 221 VAL n 1 222 GLY n 1 223 PHE n 1 224 ASN n 1 225 ASP n 1 226 GLU n 1 227 VAL n 1 228 LYS n 1 229 GLN n 1 230 SER n 1 231 LEU n 1 232 GLU n 1 233 VAL n 1 234 GLN n 1 235 GLN n 1 236 ALA n 1 237 LYS n 1 238 PHE n 1 239 ILE n 1 240 PHE n 1 241 THR n 1 242 GLY n 1 243 THR n 1 244 THR n 1 245 THR n 1 246 TRP n 1 247 GLU n 1 248 GLY n 1 249 ASN n 1 250 THR n 1 251 GLU n 1 252 VAL n 1 253 ARG n 1 254 GLU n 1 255 TYR n 1 256 TYR n 1 257 ALA n 1 258 GLN n 1 259 GLN n 1 260 GLN n 1 261 LEU n 1 262 ASN n 1 263 LEU n 1 264 LEU n 1 265 ASN n 1 266 HIS n 1 267 PHE n 1 268 THR n 1 269 GLN n 1 270 ALA n 1 271 GLU n 1 272 GLY n 1 273 ASP n 1 274 LEU n 1 275 PHE n 1 276 ILE n 1 277 GLY n 1 278 ASP n 1 279 HIS n 1 280 TYR n 1 281 LYS n 1 282 ILE n 1 283 TYR n 1 284 PHE n 1 285 LYS n 1 286 GLY n 1 287 HIS n 1 288 PRO n 1 289 ARG n 1 290 GLY n 1 291 GLY n 1 292 GLU n 1 293 ILE n 1 294 ASN n 1 295 ASP n 1 296 TYR n 1 297 ILE n 1 298 LEU n 1 299 ASN n 1 300 ASN n 1 301 ALA n 1 302 LYS n 1 303 ASN n 1 304 ILE n 1 305 THR n 1 306 ASN n 1 307 ILE n 1 308 PRO n 1 309 ALA n 1 310 ASN n 1 311 ILE n 1 312 SER n 1 313 PHE n 1 314 GLU n 1 315 VAL n 1 316 LEU n 1 317 MSE n 1 318 MSE n 1 319 THR n 1 320 GLY n 1 321 LEU n 1 322 LEU n 1 323 PRO n 1 324 ASP n 1 325 LYS n 1 326 VAL n 1 327 GLY n 1 328 GLY n 1 329 VAL n 1 330 ALA n 1 331 SER n 1 332 SER n 1 333 LEU n 1 334 TYR n 1 335 PHE n 1 336 SER n 1 337 LEU n 1 338 PRO n 1 339 LYS n 1 340 GLU n 1 341 LYS n 1 342 ILE n 1 343 SER n 1 344 HIS n 1 345 ILE n 1 346 ILE n 1 347 PHE n 1 348 THR n 1 349 SER n 1 350 ASN n 1 351 LYS n 1 352 GLN n 1 353 VAL n 1 354 LYS n 1 355 SER n 1 356 LYS n 1 357 GLU n 1 358 ASP n 1 359 ALA n 1 360 LEU n 1 361 ASN n 1 362 ASN n 1 363 PRO n 1 364 TYR n 1 365 VAL n 1 366 LYS n 1 367 VAL n 1 368 MSE n 1 369 ARG n 1 370 ARG n 1 371 LEU n 1 372 GLY n 1 373 ILE n 1 374 ILE n 1 375 ASP n 1 376 GLU n 1 377 SER n 1 378 GLN n 1 379 VAL n 1 380 ILE n 1 381 PHE n 1 382 TRP n 1 383 ASP n 1 384 SER n 1 385 LEU n 1 386 LYS n 1 387 GLU n 1 388 LEU n 1 389 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'PASTEURELLA MULTOCIDA' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 747 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector PET15B _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform 1 UNP Q9CP67_PASMU 1 ? ? Q9CP67 ? 2 PDB 2IY8 1 ? ? 2IY8 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2IY8 A 1 ? 388 ? Q9CP67 25 ? 412 ? 25 412 2 2 2IY8 A 389 ? 389 ? 2IY8 413 ? 413 ? 413 413 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2IY8 ASN A 81 ? UNP Q9CP67 ASP 105 conflict 105 1 1 2IY8 GLN A 111 ? UNP Q9CP67 ARG 135 conflict 135 2 1 2IY8 GLU A 251 ? UNP Q9CP67 ASP 275 conflict 275 3 1 2IY8 GLU A 271 ? UNP Q9CP67 GLY 295 conflict 295 4 1 2IY8 GLU A 387 ? UNP Q9CP67 GLN 411 conflict 411 5 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BGC 'D-saccharide, beta linking' . beta-D-glucopyranose ? 'C6 H12 O6' 180.156 CSF 'RNA linking' n ;CYTIDINE-5'-MONOPHOSPHATE-3-FLUORO-N-ACETYL-NEURAMINIC ACID ; CMP-3FNEUAC 'C20 H30 F N4 O16 P' 632.442 GAL 'D-saccharide, beta linking' . beta-D-galactopyranose ? 'C6 H12 O6' 180.156 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2IY8 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.44 _exptl_crystal.density_percent_sol 49.21 _exptl_crystal.description NONE # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details 'pH 6.5' # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type RIGAKU _diffrn_detector.pdbx_collection_date ? _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'RIGAKU RAXIS IV 100' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength 1.5418 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 2IY8 _reflns.observed_criterion_sigma_I 0.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 40.00 _reflns.d_resolution_high 2.50 _reflns.number_obs 14602 _reflns.number_all ? _reflns.percent_possible_obs 91.3 _reflns.pdbx_Rmerge_I_obs 0.09 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 14.90 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 6.6 _reflns.pdbx_CC_half ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_Rrim_I_all ? # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 2.50 _reflns_shell.d_res_low 2.59 _reflns_shell.percent_possible_all 87.3 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 3.90 _reflns_shell.pdbx_redundancy 4.6 _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_Rrim_I_all ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 2IY8 _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 14602 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF 10000 _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 15.0 _refine.ls_d_res_high 2.50 _refine.ls_percent_reflns_obs 91.3 _refine.ls_R_factor_obs 0.2347 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2347 _refine.ls_R_factor_R_free 0.2444 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.6 _refine.ls_number_reflns_R_free 730 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] 1.886 _refine.aniso_B[2][2] 3.882 _refine.aniso_B[3][3] -5.768 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][3] 0.000 _refine.solvent_model_details ? _refine.solvent_model_param_ksol 0.321608 _refine.solvent_model_param_bsol 18.5122 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 3107 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 65 _refine_hist.number_atoms_solvent 130 _refine_hist.number_atoms_total 3302 _refine_hist.d_res_high 2.50 _refine_hist.d_res_low 15.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.010862 ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_bond_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.58753 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_na ? ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d_prot ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? c_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? # loop_ _pdbx_xplor_file.pdbx_refine_id _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file 'X-RAY DIFFRACTION' 1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 2 WATER_REP.PARAM WATER.TOP 'X-RAY DIFFRACTION' 3 CSF_MSD.PAR CSF_MSD.TOP 'X-RAY DIFFRACTION' 4 LAT.PAR LAT.TOP # _struct.entry_id 2IY8 _struct.title 'Crystal structure of the sialyltransferase PM0188 with CMP-3FNeuAc and lactose' _struct.pdbx_descriptor 'PROTEIN PM0188' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2IY8 _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text 'TRANSFERASE, PM0188, SIALYLTRANSFERASE, CMP-3FNEUAC, LACTOSE, HYPOTHETICAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 12 ? GLN A 24 ? SER A 36 GLN A 48 1 ? 13 HELX_P HELX_P2 2 PRO A 43 ? THR A 48 ? PRO A 67 THR A 72 1 ? 6 HELX_P HELX_P3 3 GLU A 65 ? GLN A 73 ? GLU A 89 GLN A 97 1 ? 9 HELX_P HELX_P4 4 HIS A 88 ? LYS A 102 ? HIS A 112 LYS A 126 1 ? 15 HELX_P HELX_P5 5 SER A 119 ? LYS A 127 ? SER A 143 LYS A 151 1 ? 9 HELX_P HELX_P6 6 ASP A 132 ? GLY A 151 ? ASP A 156 GLY A 175 1 ? 20 HELX_P HELX_P7 7 ASN A 157 ? ARG A 162 ? ASN A 181 ARG A 186 1 ? 6 HELX_P HELX_P8 8 TYR A 163 ? ALA A 168 ? TYR A 187 ALA A 192 5 ? 6 HELX_P HELX_P9 9 SER A 177 ? ALA A 184 ? SER A 201 ALA A 208 1 ? 8 HELX_P HELX_P10 10 LEU A 187 ? ALA A 195 ? LEU A 211 ALA A 219 1 ? 9 HELX_P HELX_P11 11 THR A 210 ? VAL A 221 ? THR A 234 VAL A 245 1 ? 12 HELX_P HELX_P12 12 ASN A 224 ? LEU A 231 ? ASN A 248 LEU A 255 1 ? 8 HELX_P HELX_P13 13 ASN A 249 ? GLN A 269 ? ASN A 273 GLN A 293 1 ? 21 HELX_P HELX_P14 14 GLY A 291 ? ALA A 301 ? GLY A 315 ALA A 325 1 ? 11 HELX_P HELX_P15 15 PHE A 313 ? THR A 319 ? PHE A 337 THR A 343 1 ? 7 HELX_P HELX_P16 16 SER A 331 ? SER A 336 ? SER A 355 SER A 360 5 ? 6 HELX_P HELX_P17 17 PRO A 338 ? GLU A 340 ? PRO A 362 GLU A 364 5 ? 3 HELX_P HELX_P18 18 ASN A 362 ? LEU A 371 ? ASN A 386 LEU A 395 1 ? 10 HELX_P HELX_P19 19 ASP A 383 ? LEU A 385 ? ASP A 407 LEU A 409 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A LEU 19 C ? ? ? 1_555 A MSE 20 N ? ? A LEU 43 A MSE 44 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale2 covale both ? A MSE 20 C ? ? ? 1_555 A ASP 21 N ? ? A MSE 44 A ASP 45 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale3 covale both ? A SER 119 C ? ? ? 1_555 A MSE 120 N ? ? A SER 143 A MSE 144 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale4 covale both ? A MSE 120 C ? ? ? 1_555 A GLU 121 N ? ? A MSE 144 A GLU 145 1_555 ? ? ? ? ? ? ? 1.323 ? ? covale5 covale both ? A LYS 200 C ? ? ? 1_555 A MSE 201 N ? ? A LYS 224 A MSE 225 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale6 covale both ? A MSE 201 C ? ? ? 1_555 A ASP 202 N ? ? A MSE 225 A ASP 226 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale7 covale both ? A LEU 316 C ? ? ? 1_555 A MSE 317 N ? ? A LEU 340 A MSE 341 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale8 covale both ? A MSE 317 C ? ? ? 1_555 A MSE 318 N ? ? A MSE 341 A MSE 342 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale9 covale both ? A MSE 318 C ? ? ? 1_555 A THR 319 N ? ? A MSE 342 A THR 343 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale10 covale both ? A VAL 367 C ? ? ? 1_555 A MSE 368 N ? ? A VAL 391 A MSE 392 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale11 covale both ? A MSE 368 C ? ? ? 1_555 A ARG 369 N ? ? A MSE 392 A ARG 393 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale12 covale both ? B BGC . O4 ? ? ? 1_555 B GAL . C1 ? ? B BGC 1 B GAL 2 1_555 ? ? ? ? ? ? ? 1.406 sing ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA ? 7 ? AB ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? parallel AA 2 3 ? parallel AA 3 4 ? parallel AA 4 5 ? parallel AA 5 6 ? parallel AA 6 7 ? parallel AB 1 2 ? parallel AB 2 3 ? parallel AB 3 4 ? parallel AB 4 5 ? parallel AB 5 6 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 ILE A 53 ? PHE A 55 ? ILE A 77 PHE A 79 AA 2 ARG A 33 ? LEU A 37 ? ARG A 57 LEU A 61 AA 3 LYS A 2 ? ASP A 9 ? LYS A 26 ASP A 33 AA 4 ILE A 78 ? ASN A 85 ? ILE A 102 ASN A 109 AA 5 VAL A 107 ? TYR A 115 ? VAL A 131 TYR A 139 AA 6 VAL A 171 ? PHE A 175 ? VAL A 195 PHE A 199 AA 7 TYR A 198 ? LYS A 200 ? TYR A 222 LYS A 224 AB 1 ILE A 304 ? ASN A 306 ? ILE A 328 ASN A 330 AB 2 LYS A 281 ? LYS A 285 ? LYS A 305 LYS A 309 AB 3 LYS A 237 ? THR A 241 ? LYS A 261 THR A 265 AB 4 LYS A 325 ? VAL A 329 ? LYS A 349 VAL A 353 AB 5 ILE A 342 ? PHE A 347 ? ILE A 366 PHE A 371 AB 6 ILE A 380 ? PHE A 381 ? ILE A 404 PHE A 405 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N HIS A 54 ? N HIS A 78 O ARG A 33 ? O ARG A 57 AA 2 3 N ILE A 34 ? N ILE A 58 O THR A 5 ? O THR A 29 AA 3 4 N ILE A 4 ? N ILE A 28 O GLU A 79 ? O GLU A 103 AA 4 5 N LEU A 80 ? N LEU A 104 O SER A 108 ? O SER A 132 AA 5 6 N LEU A 114 ? N LEU A 138 O LYS A 172 ? O LYS A 196 AA 6 7 N PHE A 175 ? N PHE A 199 O GLN A 199 ? O GLN A 223 AB 1 2 N THR A 305 ? N THR A 329 O ILE A 282 ? O ILE A 306 AB 2 3 N TYR A 283 ? N TYR A 307 O PHE A 238 ? O PHE A 262 AB 3 4 N ILE A 239 ? N ILE A 263 O LYS A 325 ? O LYS A 349 AB 4 5 O VAL A 326 ? O VAL A 350 N SER A 343 ? N SER A 367 AB 5 6 N PHE A 347 ? N PHE A 371 O ILE A 380 ? O ILE A 404 # _database_PDB_matrix.entry_id 2IY8 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2IY8 _atom_sites.fract_transf_matrix[1][1] 0.015447 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015280 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009466 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C F N O P SE # loop_ _database_PDB_caveat.text 'CSF A 1415 HAS WRONG CHIRALITY AT ATOM C7A' # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 25 25 SER SER A . n A 1 2 LYS 2 26 26 LYS LYS A . n A 1 3 THR 3 27 27 THR THR A . n A 1 4 ILE 4 28 28 ILE ILE A . n A 1 5 THR 5 29 29 THR THR A . n A 1 6 LEU 6 30 30 LEU LEU A . n A 1 7 TYR 7 31 31 TYR TYR A . n A 1 8 LEU 8 32 32 LEU LEU A . n A 1 9 ASP 9 33 33 ASP ASP A . n A 1 10 PRO 10 34 34 PRO PRO A . n A 1 11 ALA 11 35 35 ALA ALA A . n A 1 12 SER 12 36 36 SER SER A . n A 1 13 LEU 13 37 37 LEU LEU A . n A 1 14 PRO 14 38 38 PRO PRO A . n A 1 15 ALA 15 39 39 ALA ALA A . n A 1 16 LEU 16 40 40 LEU LEU A . n A 1 17 ASN 17 41 41 ASN ASN A . n A 1 18 GLN 18 42 42 GLN GLN A . n A 1 19 LEU 19 43 43 LEU LEU A . n A 1 20 MSE 20 44 44 MSE MSE A . n A 1 21 ASP 21 45 45 ASP ASP A . n A 1 22 PHE 22 46 46 PHE PHE A . n A 1 23 THR 23 47 47 THR THR A . n A 1 24 GLN 24 48 48 GLN GLN A . n A 1 25 ASN 25 49 49 ASN ASN A . n A 1 26 ASN 26 50 50 ASN ASN A . n A 1 27 GLU 27 51 51 GLU GLU A . n A 1 28 ASP 28 52 52 ASP ASP A . n A 1 29 LYS 29 53 53 LYS LYS A . n A 1 30 THR 30 54 54 THR THR A . n A 1 31 HIS 31 55 55 HIS HIS A . n A 1 32 PRO 32 56 56 PRO PRO A . n A 1 33 ARG 33 57 57 ARG ARG A . n A 1 34 ILE 34 58 58 ILE ILE A . n A 1 35 PHE 35 59 59 PHE PHE A . n A 1 36 GLY 36 60 60 GLY GLY A . n A 1 37 LEU 37 61 61 LEU LEU A . n A 1 38 SER 38 62 62 SER SER A . n A 1 39 ARG 39 63 63 ARG ARG A . n A 1 40 PHE 40 64 64 PHE PHE A . n A 1 41 LYS 41 65 65 LYS LYS A . n A 1 42 ILE 42 66 66 ILE ILE A . n A 1 43 PRO 43 67 67 PRO PRO A . n A 1 44 ASP 44 68 68 ASP ASP A . n A 1 45 ASN 45 69 69 ASN ASN A . n A 1 46 ILE 46 70 70 ILE ILE A . n A 1 47 ILE 47 71 71 ILE ILE A . n A 1 48 THR 48 72 72 THR THR A . n A 1 49 GLN 49 73 73 GLN GLN A . n A 1 50 TYR 50 74 74 TYR TYR A . n A 1 51 GLN 51 75 75 GLN GLN A . n A 1 52 ASN 52 76 76 ASN ASN A . n A 1 53 ILE 53 77 77 ILE ILE A . n A 1 54 HIS 54 78 78 HIS HIS A . n A 1 55 PHE 55 79 79 PHE PHE A . n A 1 56 VAL 56 80 80 VAL VAL A . n A 1 57 GLU 57 81 81 GLU GLU A . n A 1 58 LEU 58 82 82 LEU LEU A . n A 1 59 LYS 59 83 83 LYS LYS A . n A 1 60 ASP 60 84 84 ASP ASP A . n A 1 61 ASN 61 85 85 ASN ASN A . n A 1 62 ARG 62 86 86 ARG ARG A . n A 1 63 PRO 63 87 87 PRO PRO A . n A 1 64 THR 64 88 88 THR THR A . n A 1 65 GLU 65 89 89 GLU GLU A . n A 1 66 ALA 66 90 90 ALA ALA A . n A 1 67 LEU 67 91 91 LEU LEU A . n A 1 68 PHE 68 92 92 PHE PHE A . n A 1 69 THR 69 93 93 THR THR A . n A 1 70 ILE 70 94 94 ILE ILE A . n A 1 71 LEU 71 95 95 LEU LEU A . n A 1 72 ASP 72 96 96 ASP ASP A . n A 1 73 GLN 73 97 97 GLN GLN A . n A 1 74 TYR 74 98 98 TYR TYR A . n A 1 75 PRO 75 99 99 PRO PRO A . n A 1 76 GLY 76 100 100 GLY GLY A . n A 1 77 ASN 77 101 101 ASN ASN A . n A 1 78 ILE 78 102 102 ILE ILE A . n A 1 79 GLU 79 103 103 GLU GLU A . n A 1 80 LEU 80 104 104 LEU LEU A . n A 1 81 ASN 81 105 105 ASN ASN A . n A 1 82 ILE 82 106 106 ILE ILE A . n A 1 83 HIS 83 107 107 HIS HIS A . n A 1 84 LEU 84 108 108 LEU LEU A . n A 1 85 ASN 85 109 109 ASN ASN A . n A 1 86 ILE 86 110 110 ILE ILE A . n A 1 87 ALA 87 111 111 ALA ALA A . n A 1 88 HIS 88 112 112 HIS HIS A . n A 1 89 SER 89 113 113 SER SER A . n A 1 90 VAL 90 114 114 VAL VAL A . n A 1 91 GLN 91 115 115 GLN GLN A . n A 1 92 LEU 92 116 116 LEU LEU A . n A 1 93 ILE 93 117 117 ILE ILE A . n A 1 94 ARG 94 118 118 ARG ARG A . n A 1 95 PRO 95 119 119 PRO PRO A . n A 1 96 ILE 96 120 120 ILE ILE A . n A 1 97 LEU 97 121 121 LEU LEU A . n A 1 98 ALA 98 122 122 ALA ALA A . n A 1 99 TYR 99 123 123 TYR TYR A . n A 1 100 ARG 100 124 124 ARG ARG A . n A 1 101 PHE 101 125 125 PHE PHE A . n A 1 102 LYS 102 126 126 LYS LYS A . n A 1 103 HIS 103 127 127 HIS HIS A . n A 1 104 LEU 104 128 128 LEU LEU A . n A 1 105 ASP 105 129 129 ASP ASP A . n A 1 106 ARG 106 130 130 ARG ARG A . n A 1 107 VAL 107 131 131 VAL VAL A . n A 1 108 SER 108 132 132 SER SER A . n A 1 109 ILE 109 133 133 ILE ILE A . n A 1 110 GLN 110 134 134 GLN GLN A . n A 1 111 GLN 111 135 135 GLN GLN A . n A 1 112 LEU 112 136 136 LEU LEU A . n A 1 113 ASN 113 137 137 ASN ASN A . n A 1 114 LEU 114 138 138 LEU LEU A . n A 1 115 TYR 115 139 139 TYR TYR A . n A 1 116 ASP 116 140 140 ASP ASP A . n A 1 117 ASP 117 141 141 ASP ASP A . n A 1 118 GLY 118 142 142 GLY GLY A . n A 1 119 SER 119 143 143 SER SER A . n A 1 120 MSE 120 144 144 MSE MSE A . n A 1 121 GLU 121 145 145 GLU GLU A . n A 1 122 TYR 122 146 146 TYR TYR A . n A 1 123 VAL 123 147 147 VAL VAL A . n A 1 124 ASP 124 148 148 ASP ASP A . n A 1 125 LEU 125 149 149 LEU LEU A . n A 1 126 GLU 126 150 150 GLU GLU A . n A 1 127 LYS 127 151 151 LYS LYS A . n A 1 128 GLU 128 152 152 GLU GLU A . n A 1 129 GLU 129 153 153 GLU GLU A . n A 1 130 ASN 130 154 154 ASN ASN A . n A 1 131 LYS 131 155 155 LYS LYS A . n A 1 132 ASP 132 156 156 ASP ASP A . n A 1 133 ILE 133 157 157 ILE ILE A . n A 1 134 SER 134 158 158 SER SER A . n A 1 135 ALA 135 159 159 ALA ALA A . n A 1 136 GLU 136 160 160 GLU GLU A . n A 1 137 ILE 137 161 161 ILE ILE A . n A 1 138 LYS 138 162 162 LYS LYS A . n A 1 139 GLN 139 163 163 GLN GLN A . n A 1 140 ALA 140 164 164 ALA ALA A . n A 1 141 GLU 141 165 165 GLU GLU A . n A 1 142 LYS 142 166 166 LYS LYS A . n A 1 143 GLN 143 167 167 GLN GLN A . n A 1 144 LEU 144 168 168 LEU LEU A . n A 1 145 SER 145 169 169 SER SER A . n A 1 146 HIS 146 170 170 HIS HIS A . n A 1 147 TYR 147 171 171 TYR TYR A . n A 1 148 LEU 148 172 172 LEU LEU A . n A 1 149 LEU 149 173 173 LEU LEU A . n A 1 150 THR 150 174 174 THR THR A . n A 1 151 GLY 151 175 175 GLY GLY A . n A 1 152 LYS 152 176 176 LYS LYS A . n A 1 153 ILE 153 177 177 ILE ILE A . n A 1 154 LYS 154 178 178 LYS LYS A . n A 1 155 PHE 155 179 179 PHE PHE A . n A 1 156 ASP 156 180 180 ASP ASP A . n A 1 157 ASN 157 181 181 ASN ASN A . n A 1 158 PRO 158 182 182 PRO PRO A . n A 1 159 THR 159 183 183 THR THR A . n A 1 160 ILE 160 184 184 ILE ILE A . n A 1 161 ALA 161 185 185 ALA ALA A . n A 1 162 ARG 162 186 186 ARG ARG A . n A 1 163 TYR 163 187 187 TYR TYR A . n A 1 164 VAL 164 188 188 VAL VAL A . n A 1 165 TRP 165 189 189 TRP TRP A . n A 1 166 GLN 166 190 190 GLN GLN A . n A 1 167 SER 167 191 191 SER SER A . n A 1 168 ALA 168 192 192 ALA ALA A . n A 1 169 PHE 169 193 193 PHE PHE A . n A 1 170 PRO 170 194 194 PRO PRO A . n A 1 171 VAL 171 195 195 VAL VAL A . n A 1 172 LYS 172 196 196 LYS LYS A . n A 1 173 TYR 173 197 197 TYR TYR A . n A 1 174 HIS 174 198 198 HIS HIS A . n A 1 175 PHE 175 199 199 PHE PHE A . n A 1 176 LEU 176 200 200 LEU LEU A . n A 1 177 SER 177 201 201 SER SER A . n A 1 178 THR 178 202 202 THR THR A . n A 1 179 ASP 179 203 203 ASP ASP A . n A 1 180 TYR 180 204 204 TYR TYR A . n A 1 181 PHE 181 205 205 PHE PHE A . n A 1 182 GLU 182 206 206 GLU GLU A . n A 1 183 LYS 183 207 207 LYS LYS A . n A 1 184 ALA 184 208 208 ALA ALA A . n A 1 185 GLU 185 209 209 GLU GLU A . n A 1 186 PHE 186 210 210 PHE PHE A . n A 1 187 LEU 187 211 211 LEU LEU A . n A 1 188 GLN 188 212 212 GLN GLN A . n A 1 189 PRO 189 213 213 PRO PRO A . n A 1 190 LEU 190 214 214 LEU LEU A . n A 1 191 LYS 191 215 215 LYS LYS A . n A 1 192 GLU 192 216 216 GLU GLU A . n A 1 193 TYR 193 217 217 TYR TYR A . n A 1 194 LEU 194 218 218 LEU LEU A . n A 1 195 ALA 195 219 219 ALA ALA A . n A 1 196 GLU 196 220 220 GLU GLU A . n A 1 197 ASN 197 221 221 ASN ASN A . n A 1 198 TYR 198 222 222 TYR TYR A . n A 1 199 GLN 199 223 223 GLN GLN A . n A 1 200 LYS 200 224 224 LYS LYS A . n A 1 201 MSE 201 225 225 MSE MSE A . n A 1 202 ASP 202 226 226 ASP ASP A . n A 1 203 TRP 203 227 227 TRP TRP A . n A 1 204 THR 204 228 228 THR THR A . n A 1 205 ALA 205 229 229 ALA ALA A . n A 1 206 TYR 206 230 230 TYR TYR A . n A 1 207 GLN 207 231 231 GLN GLN A . n A 1 208 GLN 208 232 232 GLN GLN A . n A 1 209 LEU 209 233 233 LEU LEU A . n A 1 210 THR 210 234 234 THR THR A . n A 1 211 PRO 211 235 235 PRO PRO A . n A 1 212 GLU 212 236 236 GLU GLU A . n A 1 213 GLN 213 237 237 GLN GLN A . n A 1 214 GLN 214 238 238 GLN GLN A . n A 1 215 ALA 215 239 239 ALA ALA A . n A 1 216 PHE 216 240 240 PHE PHE A . n A 1 217 TYR 217 241 241 TYR TYR A . n A 1 218 LEU 218 242 242 LEU LEU A . n A 1 219 THR 219 243 243 THR THR A . n A 1 220 LEU 220 244 244 LEU LEU A . n A 1 221 VAL 221 245 245 VAL VAL A . n A 1 222 GLY 222 246 246 GLY GLY A . n A 1 223 PHE 223 247 247 PHE PHE A . n A 1 224 ASN 224 248 248 ASN ASN A . n A 1 225 ASP 225 249 249 ASP ASP A . n A 1 226 GLU 226 250 250 GLU GLU A . n A 1 227 VAL 227 251 251 VAL VAL A . n A 1 228 LYS 228 252 252 LYS LYS A . n A 1 229 GLN 229 253 253 GLN GLN A . n A 1 230 SER 230 254 254 SER SER A . n A 1 231 LEU 231 255 255 LEU LEU A . n A 1 232 GLU 232 256 256 GLU GLU A . n A 1 233 VAL 233 257 257 VAL VAL A . n A 1 234 GLN 234 258 258 GLN GLN A . n A 1 235 GLN 235 259 259 GLN GLN A . n A 1 236 ALA 236 260 260 ALA ALA A . n A 1 237 LYS 237 261 261 LYS LYS A . n A 1 238 PHE 238 262 262 PHE PHE A . n A 1 239 ILE 239 263 263 ILE ILE A . n A 1 240 PHE 240 264 264 PHE PHE A . n A 1 241 THR 241 265 265 THR THR A . n A 1 242 GLY 242 266 266 GLY GLY A . n A 1 243 THR 243 267 267 THR THR A . n A 1 244 THR 244 268 268 THR THR A . n A 1 245 THR 245 269 269 THR THR A . n A 1 246 TRP 246 270 270 TRP TRP A . n A 1 247 GLU 247 271 271 GLU GLU A . n A 1 248 GLY 248 272 272 GLY GLY A . n A 1 249 ASN 249 273 273 ASN ASN A . n A 1 250 THR 250 274 274 THR THR A . n A 1 251 GLU 251 275 275 GLU GLU A . n A 1 252 VAL 252 276 276 VAL VAL A . n A 1 253 ARG 253 277 277 ARG ARG A . n A 1 254 GLU 254 278 278 GLU GLU A . n A 1 255 TYR 255 279 279 TYR TYR A . n A 1 256 TYR 256 280 280 TYR TYR A . n A 1 257 ALA 257 281 281 ALA ALA A . n A 1 258 GLN 258 282 282 GLN GLN A . n A 1 259 GLN 259 283 283 GLN GLN A . n A 1 260 GLN 260 284 284 GLN GLN A . n A 1 261 LEU 261 285 285 LEU LEU A . n A 1 262 ASN 262 286 286 ASN ASN A . n A 1 263 LEU 263 287 287 LEU LEU A . n A 1 264 LEU 264 288 288 LEU LEU A . n A 1 265 ASN 265 289 289 ASN ASN A . n A 1 266 HIS 266 290 290 HIS HIS A . n A 1 267 PHE 267 291 291 PHE PHE A . n A 1 268 THR 268 292 292 THR THR A . n A 1 269 GLN 269 293 293 GLN GLN A . n A 1 270 ALA 270 294 294 ALA ALA A . n A 1 271 GLU 271 295 295 GLU GLU A . n A 1 272 GLY 272 296 296 GLY GLY A . n A 1 273 ASP 273 297 297 ASP ASP A . n A 1 274 LEU 274 298 298 LEU LEU A . n A 1 275 PHE 275 299 299 PHE PHE A . n A 1 276 ILE 276 300 300 ILE ILE A . n A 1 277 GLY 277 301 301 GLY GLY A . n A 1 278 ASP 278 302 302 ASP ASP A . n A 1 279 HIS 279 303 303 HIS HIS A . n A 1 280 TYR 280 304 304 TYR TYR A . n A 1 281 LYS 281 305 305 LYS LYS A . n A 1 282 ILE 282 306 306 ILE ILE A . n A 1 283 TYR 283 307 307 TYR TYR A . n A 1 284 PHE 284 308 308 PHE PHE A . n A 1 285 LYS 285 309 309 LYS LYS A . n A 1 286 GLY 286 310 310 GLY GLY A . n A 1 287 HIS 287 311 311 HIS HIS A . n A 1 288 PRO 288 312 312 PRO PRO A . n A 1 289 ARG 289 313 313 ARG ARG A . n A 1 290 GLY 290 314 314 GLY GLY A . n A 1 291 GLY 291 315 315 GLY GLY A . n A 1 292 GLU 292 316 316 GLU GLU A . n A 1 293 ILE 293 317 317 ILE ILE A . n A 1 294 ASN 294 318 318 ASN ASN A . n A 1 295 ASP 295 319 319 ASP ASP A . n A 1 296 TYR 296 320 320 TYR TYR A . n A 1 297 ILE 297 321 321 ILE ILE A . n A 1 298 LEU 298 322 322 LEU LEU A . n A 1 299 ASN 299 323 323 ASN ASN A . n A 1 300 ASN 300 324 324 ASN ASN A . n A 1 301 ALA 301 325 325 ALA ALA A . n A 1 302 LYS 302 326 326 LYS LYS A . n A 1 303 ASN 303 327 327 ASN ASN A . n A 1 304 ILE 304 328 328 ILE ILE A . n A 1 305 THR 305 329 329 THR THR A . n A 1 306 ASN 306 330 330 ASN ASN A . n A 1 307 ILE 307 331 331 ILE ILE A . n A 1 308 PRO 308 332 332 PRO PRO A . n A 1 309 ALA 309 333 333 ALA ALA A . n A 1 310 ASN 310 334 334 ASN ASN A . n A 1 311 ILE 311 335 335 ILE ILE A . n A 1 312 SER 312 336 336 SER SER A . n A 1 313 PHE 313 337 337 PHE PHE A . n A 1 314 GLU 314 338 338 GLU GLU A . n A 1 315 VAL 315 339 339 VAL VAL A . n A 1 316 LEU 316 340 340 LEU LEU A . n A 1 317 MSE 317 341 341 MSE MSE A . n A 1 318 MSE 318 342 342 MSE MSE A . n A 1 319 THR 319 343 343 THR THR A . n A 1 320 GLY 320 344 344 GLY GLY A . n A 1 321 LEU 321 345 345 LEU LEU A . n A 1 322 LEU 322 346 346 LEU LEU A . n A 1 323 PRO 323 347 347 PRO PRO A . n A 1 324 ASP 324 348 348 ASP ASP A . n A 1 325 LYS 325 349 349 LYS LYS A . n A 1 326 VAL 326 350 350 VAL VAL A . n A 1 327 GLY 327 351 351 GLY GLY A . n A 1 328 GLY 328 352 352 GLY GLY A . n A 1 329 VAL 329 353 353 VAL VAL A . n A 1 330 ALA 330 354 354 ALA ALA A . n A 1 331 SER 331 355 355 SER SER A . n A 1 332 SER 332 356 356 SER SER A . n A 1 333 LEU 333 357 357 LEU LEU A . n A 1 334 TYR 334 358 358 TYR TYR A . n A 1 335 PHE 335 359 359 PHE PHE A . n A 1 336 SER 336 360 360 SER SER A . n A 1 337 LEU 337 361 361 LEU LEU A . n A 1 338 PRO 338 362 362 PRO PRO A . n A 1 339 LYS 339 363 363 LYS LYS A . n A 1 340 GLU 340 364 364 GLU GLU A . n A 1 341 LYS 341 365 365 LYS LYS A . n A 1 342 ILE 342 366 366 ILE ILE A . n A 1 343 SER 343 367 367 SER SER A . n A 1 344 HIS 344 368 368 HIS HIS A . n A 1 345 ILE 345 369 369 ILE ILE A . n A 1 346 ILE 346 370 370 ILE ILE A . n A 1 347 PHE 347 371 371 PHE PHE A . n A 1 348 THR 348 372 372 THR THR A . n A 1 349 SER 349 373 ? ? ? A . n A 1 350 ASN 350 374 ? ? ? A . n A 1 351 LYS 351 375 ? ? ? A . n A 1 352 GLN 352 376 ? ? ? A . n A 1 353 VAL 353 377 ? ? ? A . n A 1 354 LYS 354 378 ? ? ? A . n A 1 355 SER 355 379 ? ? ? A . n A 1 356 LYS 356 380 ? ? ? A . n A 1 357 GLU 357 381 ? ? ? A . n A 1 358 ASP 358 382 ? ? ? A . n A 1 359 ALA 359 383 ? ? ? A . n A 1 360 LEU 360 384 ? ? ? A . n A 1 361 ASN 361 385 385 ASN ASN A . n A 1 362 ASN 362 386 386 ASN ASN A . n A 1 363 PRO 363 387 387 PRO PRO A . n A 1 364 TYR 364 388 388 TYR TYR A . n A 1 365 VAL 365 389 389 VAL VAL A . n A 1 366 LYS 366 390 390 LYS LYS A . n A 1 367 VAL 367 391 391 VAL VAL A . n A 1 368 MSE 368 392 392 MSE MSE A . n A 1 369 ARG 369 393 393 ARG ARG A . n A 1 370 ARG 370 394 394 ARG ARG A . n A 1 371 LEU 371 395 395 LEU LEU A . n A 1 372 GLY 372 396 396 GLY GLY A . n A 1 373 ILE 373 397 397 ILE ILE A . n A 1 374 ILE 374 398 398 ILE ILE A . n A 1 375 ASP 375 399 399 ASP ASP A . n A 1 376 GLU 376 400 400 GLU GLU A . n A 1 377 SER 377 401 401 SER SER A . n A 1 378 GLN 378 402 402 GLN GLN A . n A 1 379 VAL 379 403 403 VAL VAL A . n A 1 380 ILE 380 404 404 ILE ILE A . n A 1 381 PHE 381 405 405 PHE PHE A . n A 1 382 TRP 382 406 406 TRP TRP A . n A 1 383 ASP 383 407 407 ASP ASP A . n A 1 384 SER 384 408 408 SER SER A . n A 1 385 LEU 385 409 409 LEU LEU A . n A 1 386 LYS 386 410 410 LYS LYS A . n A 1 387 GLU 387 411 411 GLU GLU A . n A 1 388 LEU 388 412 412 LEU LEU A . n A 1 389 GLY 389 413 413 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 CSF 1 1415 1415 CSF CSF A . D 4 HOH 1 2001 2001 HOH HOH A . D 4 HOH 2 2002 2002 HOH HOH A . D 4 HOH 3 2003 2003 HOH HOH A . D 4 HOH 4 2004 2004 HOH HOH A . D 4 HOH 5 2005 2005 HOH HOH A . D 4 HOH 6 2006 2006 HOH HOH A . D 4 HOH 7 2007 2007 HOH HOH A . D 4 HOH 8 2008 2008 HOH HOH A . D 4 HOH 9 2009 2009 HOH HOH A . D 4 HOH 10 2010 2010 HOH HOH A . D 4 HOH 11 2011 2011 HOH HOH A . D 4 HOH 12 2012 2012 HOH HOH A . D 4 HOH 13 2013 2013 HOH HOH A . D 4 HOH 14 2014 2014 HOH HOH A . D 4 HOH 15 2015 2015 HOH HOH A . D 4 HOH 16 2016 2016 HOH HOH A . D 4 HOH 17 2017 2017 HOH HOH A . D 4 HOH 18 2018 2018 HOH HOH A . D 4 HOH 19 2019 2019 HOH HOH A . D 4 HOH 20 2020 2020 HOH HOH A . D 4 HOH 21 2021 2021 HOH HOH A . D 4 HOH 22 2022 2022 HOH HOH A . D 4 HOH 23 2023 2023 HOH HOH A . D 4 HOH 24 2024 2024 HOH HOH A . D 4 HOH 25 2025 2025 HOH HOH A . D 4 HOH 26 2026 2026 HOH HOH A . D 4 HOH 27 2027 2027 HOH HOH A . D 4 HOH 28 2028 2028 HOH HOH A . D 4 HOH 29 2029 2029 HOH HOH A . D 4 HOH 30 2030 2030 HOH HOH A . D 4 HOH 31 2031 2031 HOH HOH A . D 4 HOH 32 2032 2032 HOH HOH A . D 4 HOH 33 2033 2033 HOH HOH A . D 4 HOH 34 2034 2034 HOH HOH A . D 4 HOH 35 2035 2035 HOH HOH A . D 4 HOH 36 2036 2036 HOH HOH A . D 4 HOH 37 2037 2037 HOH HOH A . D 4 HOH 38 2038 2038 HOH HOH A . D 4 HOH 39 2039 2039 HOH HOH A . D 4 HOH 40 2040 2040 HOH HOH A . D 4 HOH 41 2041 2041 HOH HOH A . D 4 HOH 42 2042 2042 HOH HOH A . D 4 HOH 43 2043 2043 HOH HOH A . D 4 HOH 44 2044 2044 HOH HOH A . D 4 HOH 45 2045 2045 HOH HOH A . D 4 HOH 46 2046 2046 HOH HOH A . D 4 HOH 47 2047 2047 HOH HOH A . D 4 HOH 48 2048 2048 HOH HOH A . D 4 HOH 49 2049 2049 HOH HOH A . D 4 HOH 50 2050 2050 HOH HOH A . D 4 HOH 51 2051 2051 HOH HOH A . D 4 HOH 52 2052 2052 HOH HOH A . D 4 HOH 53 2053 2053 HOH HOH A . D 4 HOH 54 2054 2054 HOH HOH A . D 4 HOH 55 2055 2055 HOH HOH A . D 4 HOH 56 2056 2056 HOH HOH A . D 4 HOH 57 2057 2057 HOH HOH A . D 4 HOH 58 2058 2058 HOH HOH A . D 4 HOH 59 2059 2059 HOH HOH A . D 4 HOH 60 2060 2060 HOH HOH A . D 4 HOH 61 2061 2061 HOH HOH A . D 4 HOH 62 2062 2062 HOH HOH A . D 4 HOH 63 2063 2063 HOH HOH A . D 4 HOH 64 2064 2064 HOH HOH A . D 4 HOH 65 2065 2065 HOH HOH A . D 4 HOH 66 2066 2066 HOH HOH A . D 4 HOH 67 2067 2067 HOH HOH A . D 4 HOH 68 2068 2068 HOH HOH A . D 4 HOH 69 2069 2069 HOH HOH A . D 4 HOH 70 2070 2070 HOH HOH A . D 4 HOH 71 2071 2071 HOH HOH A . D 4 HOH 72 2072 2072 HOH HOH A . D 4 HOH 73 2073 2073 HOH HOH A . D 4 HOH 74 2074 2074 HOH HOH A . D 4 HOH 75 2075 2075 HOH HOH A . D 4 HOH 76 2076 2076 HOH HOH A . D 4 HOH 77 2077 2077 HOH HOH A . D 4 HOH 78 2078 2078 HOH HOH A . D 4 HOH 79 2079 2079 HOH HOH A . D 4 HOH 80 2080 2080 HOH HOH A . D 4 HOH 81 2081 2081 HOH HOH A . D 4 HOH 82 2082 2082 HOH HOH A . D 4 HOH 83 2083 2083 HOH HOH A . D 4 HOH 84 2084 2084 HOH HOH A . D 4 HOH 85 2085 2085 HOH HOH A . D 4 HOH 86 2086 2086 HOH HOH A . D 4 HOH 87 2087 2087 HOH HOH A . D 4 HOH 88 2088 2088 HOH HOH A . D 4 HOH 89 2089 2089 HOH HOH A . D 4 HOH 90 2090 2090 HOH HOH A . D 4 HOH 91 2091 2091 HOH HOH A . D 4 HOH 92 2092 2092 HOH HOH A . D 4 HOH 93 2093 2093 HOH HOH A . D 4 HOH 94 2094 2094 HOH HOH A . D 4 HOH 95 2095 2095 HOH HOH A . D 4 HOH 96 2096 2096 HOH HOH A . D 4 HOH 97 2097 2097 HOH HOH A . D 4 HOH 98 2098 2098 HOH HOH A . D 4 HOH 99 2099 2099 HOH HOH A . D 4 HOH 100 2100 2100 HOH HOH A . D 4 HOH 101 2101 2101 HOH HOH A . D 4 HOH 102 2102 2102 HOH HOH A . D 4 HOH 103 2103 2103 HOH HOH A . D 4 HOH 104 2104 2104 HOH HOH A . D 4 HOH 105 2105 2105 HOH HOH A . D 4 HOH 106 2106 2106 HOH HOH A . D 4 HOH 107 2107 2107 HOH HOH A . D 4 HOH 108 2108 2108 HOH HOH A . D 4 HOH 109 2109 2109 HOH HOH A . D 4 HOH 110 2110 2110 HOH HOH A . D 4 HOH 111 2111 2111 HOH HOH A . D 4 HOH 112 2112 2112 HOH HOH A . D 4 HOH 113 2113 2113 HOH HOH A . D 4 HOH 114 2114 2114 HOH HOH A . D 4 HOH 115 2115 2115 HOH HOH A . D 4 HOH 116 2116 2116 HOH HOH A . D 4 HOH 117 2117 2117 HOH HOH A . D 4 HOH 118 2118 2118 HOH HOH A . D 4 HOH 119 2119 2119 HOH HOH A . D 4 HOH 120 2120 2120 HOH HOH A . D 4 HOH 121 2121 2121 HOH HOH A . D 4 HOH 122 2122 2122 HOH HOH A . D 4 HOH 123 2123 2123 HOH HOH A . D 4 HOH 124 2124 2124 HOH HOH A . D 4 HOH 125 2125 2125 HOH HOH A . D 4 HOH 126 2126 2126 HOH HOH A . D 4 HOH 127 2127 2127 HOH HOH A . D 4 HOH 128 2128 2128 HOH HOH A . D 4 HOH 129 2129 2129 HOH HOH A . D 4 HOH 130 2130 2130 HOH HOH A . # _pdbx_molecule_features.prd_id PRD_900004 _pdbx_molecule_features.name beta-lactose _pdbx_molecule_features.type Oligosaccharide _pdbx_molecule_features.class Nutrient _pdbx_molecule_features.details oligosaccharide # _pdbx_molecule.instance_id 1 _pdbx_molecule.prd_id PRD_900004 _pdbx_molecule.asym_id B # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 20 A MSE 44 ? MET SELENOMETHIONINE 2 A MSE 120 A MSE 144 ? MET SELENOMETHIONINE 3 A MSE 201 A MSE 225 ? MET SELENOMETHIONINE 4 A MSE 317 A MSE 341 ? MET SELENOMETHIONINE 5 A MSE 318 A MSE 342 ? MET SELENOMETHIONINE 6 A MSE 368 A MSE 392 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-09-18 2 'Structure model' 1 1 2011-06-02 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2018-05-23 5 'Structure model' 1 4 2019-10-09 6 'Structure model' 2 0 2020-07-29 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 6 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Structure summary' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Database references' 8 5 'Structure model' 'Derived calculations' 9 5 'Structure model' Other 10 6 'Structure model' Advisory 11 6 'Structure model' 'Atomic model' 12 6 'Structure model' 'Data collection' 13 6 'Structure model' 'Derived calculations' 14 6 'Structure model' 'Non-polymer description' 15 6 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' citation 2 4 'Structure model' diffrn_detector 3 4 'Structure model' struct 4 5 'Structure model' citation 5 5 'Structure model' pdbx_database_status 6 5 'Structure model' struct_conn 7 6 'Structure model' atom_site 8 6 'Structure model' chem_comp 9 6 'Structure model' database_PDB_caveat 10 6 'Structure model' entity 11 6 'Structure model' entity_name_com 12 6 'Structure model' pdbx_branch_scheme 13 6 'Structure model' pdbx_chem_comp_identifier 14 6 'Structure model' pdbx_entity_branch 15 6 'Structure model' pdbx_entity_branch_descriptor 16 6 'Structure model' pdbx_entity_branch_link 17 6 'Structure model' pdbx_entity_branch_list 18 6 'Structure model' pdbx_entity_nonpoly 19 6 'Structure model' pdbx_molecule_features 20 6 'Structure model' pdbx_nonpoly_scheme 21 6 'Structure model' struct_conn 22 6 'Structure model' struct_site 23 6 'Structure model' struct_site_gen # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_citation.page_last' 2 4 'Structure model' '_diffrn_detector.detector' 3 4 'Structure model' '_struct.title' 4 5 'Structure model' '_citation.journal_abbrev' 5 5 'Structure model' '_citation.pdbx_database_id_DOI' 6 5 'Structure model' '_citation.title' 7 5 'Structure model' '_pdbx_database_status.status_code_sf' 8 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 9 6 'Structure model' '_atom_site.B_iso_or_equiv' 10 6 'Structure model' '_atom_site.Cartn_x' 11 6 'Structure model' '_atom_site.Cartn_y' 12 6 'Structure model' '_atom_site.Cartn_z' 13 6 'Structure model' '_atom_site.auth_asym_id' 14 6 'Structure model' '_atom_site.auth_atom_id' 15 6 'Structure model' '_atom_site.auth_comp_id' 16 6 'Structure model' '_atom_site.auth_seq_id' 17 6 'Structure model' '_atom_site.label_atom_id' 18 6 'Structure model' '_atom_site.label_comp_id' 19 6 'Structure model' '_chem_comp.formula' 20 6 'Structure model' '_chem_comp.formula_weight' 21 6 'Structure model' '_chem_comp.id' 22 6 'Structure model' '_chem_comp.mon_nstd_flag' 23 6 'Structure model' '_chem_comp.name' 24 6 'Structure model' '_chem_comp.pdbx_synonyms' 25 6 'Structure model' '_chem_comp.type' 26 6 'Structure model' '_entity.formula_weight' 27 6 'Structure model' '_entity.pdbx_description' 28 6 'Structure model' '_entity.type' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal _software.date _software.type _software.location _software.language CNS refinement 1.1 ? 1 ? ? ? ? HKL-2000 'data scaling' . ? 2 ? ? ? ? MOLREP phasing . ? 3 ? ? ? ? # _pdbx_entry_details.entry_id 2IY8 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ;NCBI NUMBER IS NP_245125. 5 AMINO ACIDS; 105, 135, 275, 295 AND 411 ARE SILENT MUTATIONS ; _pdbx_entry_details.has_ligand_of_interest ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 2039 ? ? O A HOH 2088 ? ? 0.97 2 1 OE2 A GLU 209 ? ? O A HOH 2068 ? ? 1.57 3 1 OE1 A GLU 209 ? ? O A HOH 2068 ? ? 1.68 4 1 CD A GLU 209 ? ? O A HOH 2068 ? ? 1.78 5 1 CB A ASN 273 ? ? O A HOH 2089 ? ? 2.16 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 2027 ? ? 1_555 O A HOH 2045 ? ? 4_456 1.80 2 1 O A HOH 2078 ? ? 1_555 O A HOH 2112 ? ? 3_655 1.83 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 C A TYR 98 ? ? N A PRO 99 ? ? CA A PRO 99 ? ? 128.54 119.30 9.24 1.50 Y 2 1 CA A LEU 357 ? ? CB A LEU 357 ? ? CG A LEU 357 ? ? 130.08 115.30 14.78 2.30 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 33 ? ? -175.97 127.90 2 1 ALA A 35 ? ? -98.13 -137.60 3 1 SER A 36 ? ? -118.04 -71.79 4 1 HIS A 127 ? ? -150.63 51.03 5 1 ALA A 219 ? ? 38.31 -104.42 6 1 ASN A 273 ? ? -36.09 110.19 7 1 HIS A 303 ? ? -148.14 -0.67 8 1 LYS A 309 ? ? -119.37 79.91 9 1 LYS A 326 ? ? -97.70 -107.02 10 1 PRO A 332 ? ? -29.06 114.05 11 1 HIS A 368 ? ? -176.40 138.83 12 1 SER A 401 ? ? -46.95 167.51 13 1 TRP A 406 ? ? -18.57 -68.13 # _pdbx_validate_chiral.id 1 _pdbx_validate_chiral.PDB_model_num 1 _pdbx_validate_chiral.auth_atom_id C7A _pdbx_validate_chiral.label_alt_id ? _pdbx_validate_chiral.auth_asym_id A _pdbx_validate_chiral.auth_comp_id CSF _pdbx_validate_chiral.auth_seq_id 1415 _pdbx_validate_chiral.PDB_ins_code ? _pdbx_validate_chiral.details 'WRONG HAND' _pdbx_validate_chiral.omega . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 373 ? A SER 349 2 1 Y 1 A ASN 374 ? A ASN 350 3 1 Y 1 A LYS 375 ? A LYS 351 4 1 Y 1 A GLN 376 ? A GLN 352 5 1 Y 1 A VAL 377 ? A VAL 353 6 1 Y 1 A LYS 378 ? A LYS 354 7 1 Y 1 A SER 379 ? A SER 355 8 1 Y 1 A LYS 380 ? A LYS 356 9 1 Y 1 A GLU 381 ? A GLU 357 10 1 Y 1 A ASP 382 ? A ASP 358 11 1 Y 1 A ALA 383 ? A ALA 359 12 1 Y 1 A LEU 384 ? A LEU 360 # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero B 2 BGC 1 B BGC 1 A LAT 1414 n B 2 GAL 2 B GAL 2 A LAT 1414 n # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier BGC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpb BGC 'COMMON NAME' GMML 1.0 b-D-glucopyranose BGC 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-Glcp BGC 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Glc GAL 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGalpb GAL 'COMMON NAME' GMML 1.0 b-D-galactopyranose GAL 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-Galp GAL 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Gal # _pdbx_entity_branch.entity_id 2 _pdbx_entity_branch.type oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 2 DGalpb1-4DGlcpb1-ROH 'Glycam Condensed Sequence' GMML 1.0 2 2 'WURCS=2.0/2,2,1/[a2122h-1b_1-5][a2112h-1b_1-5]/1-2/a4-b1' WURCS PDB2Glycan 1.1.0 3 2 '[][b-D-Glcp]{[(4+1)][b-D-Galp]{}}' LINUCS PDB-CARE ? # _pdbx_entity_branch_link.link_id 1 _pdbx_entity_branch_link.entity_id 2 _pdbx_entity_branch_link.entity_branch_list_num_1 2 _pdbx_entity_branch_link.comp_id_1 GAL _pdbx_entity_branch_link.atom_id_1 C1 _pdbx_entity_branch_link.leaving_atom_id_1 O1 _pdbx_entity_branch_link.entity_branch_list_num_2 1 _pdbx_entity_branch_link.comp_id_2 BGC _pdbx_entity_branch_link.atom_id_2 O4 _pdbx_entity_branch_link.leaving_atom_id_2 HO4 _pdbx_entity_branch_link.value_order sing _pdbx_entity_branch_link.details ? # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 2 BGC 1 n 2 GAL 2 n # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 ;CYTIDINE-5'-MONOPHOSPHATE-3-FLUORO-N-ACETYL-NEURAMINIC ACID ; CSF 4 water HOH #