data_2JNY
# 
_entry.id   2JNY 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.392 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2JNY         pdb_00002jny 10.2210/pdb2jny/pdb 
RCSB  RCSB100070   ?            ?                   
WWPDB D_1000100070 ?            ?                   
BMRB  15133        ?            10.13018/BMR15133   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-04-24 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2020-02-05 
5 'Structure model' 1 4 2023-06-14 
6 'Structure model' 1 5 2023-12-20 
7 'Structure model' 1 6 2024-05-08 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Version format compliance' 
2  3 'Structure model' 'Version format compliance' 
3  4 'Structure model' 'Database references'       
4  4 'Structure model' 'Derived calculations'      
5  4 'Structure model' 'Experimental preparation'  
6  4 'Structure model' Other                       
7  5 'Structure model' 'Database references'       
8  5 'Structure model' Other                       
9  6 'Structure model' 'Data collection'           
10 6 'Structure model' Other                       
11 7 'Structure model' 'Database references'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' database_2              
2  4 'Structure model' pdbx_database_status    
3  4 'Structure model' pdbx_nmr_sample_details 
4  4 'Structure model' pdbx_struct_assembly    
5  4 'Structure model' pdbx_struct_oper_list   
6  4 'Structure model' struct_ref_seq_dif      
7  5 'Structure model' database_2              
8  5 'Structure model' pdbx_database_status    
9  6 'Structure model' chem_comp_atom          
10 6 'Structure model' chem_comp_bond          
11 6 'Structure model' pdbx_database_status    
12 7 'Structure model' database_2              
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_pdbx_database_status.status_code_cs'       
2 4 'Structure model' '_pdbx_nmr_sample_details.contents'          
3 4 'Structure model' '_struct_ref_seq_dif.details'                
4 5 'Structure model' '_database_2.pdbx_DOI'                       
5 5 'Structure model' '_database_2.pdbx_database_accession'        
6 5 'Structure model' '_pdbx_database_status.status_code_nmr_data' 
7 6 'Structure model' '_pdbx_database_status.deposit_site'         
8 7 'Structure model' '_database_2.pdbx_DOI'                       
# 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.entry_id                        2JNY 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2007-02-14 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            REL 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
BMRB     15133 . unspecified 
TargetDB CgR1  . unspecified 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wu, Y.'                                          1  
'Liu, G.'                                         2  
'Zhang, Q.'                                       3  
'Chen, C.'                                        4  
'Nwosu, C.'                                       5  
'Cunningham, K.'                                  6  
'Ma, L.'                                          7  
'Xiao, R.'                                        8  
'Liu, J.'                                         9  
'Baran, M.'                                       10 
'Swapna, G.'                                      11 
'Acton, T.'                                       12 
'Rost, B.'                                        13 
'Montelione, G.'                                  14 
'Szyperski, T.'                                   15 
'Northeast Structural Genomics Consortium (NESG)' 16 
# 
_citation.id                        primary 
_citation.title                     
'Solution NMR structure of protein Uncharacterized BCR, Northeast Structural Genomics Consortium target CgR1' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Wu, Y.'         1  ? 
primary 'Liu, G.'        2  ? 
primary 'Zhang, Q.'      3  ? 
primary 'Chen, C.'       4  ? 
primary 'Nwosu, C.'      5  ? 
primary 'Cunningham, K.' 6  ? 
primary 'Ma, L.'         7  ? 
primary 'Xiao, R.'       8  ? 
primary 'Liu, J.'        9  ? 
primary 'Baran, M.'      10 ? 
primary 'Swapna, G.'     11 ? 
primary 'Rost, B.'       12 ? 
primary 'Montelione, G.' 13 ? 
primary 'Szyperski, T.'  14 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Uncharacterized BCR' 
_entity.formula_weight             7812.828 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Hypothetical protein' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       MSLDPQLLEVLACPKDKGPLRYLESEQLLVNERLNLAYRIDDGIPVLLIDEATEWTPNNLEHHHHHH 
_entity_poly.pdbx_seq_one_letter_code_can   MSLDPQLLEVLACPKDKGPLRYLESEQLLVNERLNLAYRIDDGIPVLLIDEATEWTPNNLEHHHHHH 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         CgR1 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  SER n 
1 3  LEU n 
1 4  ASP n 
1 5  PRO n 
1 6  GLN n 
1 7  LEU n 
1 8  LEU n 
1 9  GLU n 
1 10 VAL n 
1 11 LEU n 
1 12 ALA n 
1 13 CYS n 
1 14 PRO n 
1 15 LYS n 
1 16 ASP n 
1 17 LYS n 
1 18 GLY n 
1 19 PRO n 
1 20 LEU n 
1 21 ARG n 
1 22 TYR n 
1 23 LEU n 
1 24 GLU n 
1 25 SER n 
1 26 GLU n 
1 27 GLN n 
1 28 LEU n 
1 29 LEU n 
1 30 VAL n 
1 31 ASN n 
1 32 GLU n 
1 33 ARG n 
1 34 LEU n 
1 35 ASN n 
1 36 LEU n 
1 37 ALA n 
1 38 TYR n 
1 39 ARG n 
1 40 ILE n 
1 41 ASP n 
1 42 ASP n 
1 43 GLY n 
1 44 ILE n 
1 45 PRO n 
1 46 VAL n 
1 47 LEU n 
1 48 LEU n 
1 49 ILE n 
1 50 ASP n 
1 51 GLU n 
1 52 ALA n 
1 53 THR n 
1 54 GLU n 
1 55 TRP n 
1 56 THR n 
1 57 PRO n 
1 58 ASN n 
1 59 ASN n 
1 60 LEU n 
1 61 GLU n 
1 62 HIS n 
1 63 HIS n 
1 64 HIS n 
1 65 HIS n 
1 66 HIS n 
1 67 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Corynebacterium 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Corynebacterium glutamicum' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1718 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          vector 
_entity_src_gen.pdbx_host_org_vector               pET21 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  MET 1  1  1  MET MET A . n 
A 1 2  SER 2  2  2  SER SER A . n 
A 1 3  LEU 3  3  3  LEU LEU A . n 
A 1 4  ASP 4  4  4  ASP ASP A . n 
A 1 5  PRO 5  5  5  PRO PRO A . n 
A 1 6  GLN 6  6  6  GLN GLN A . n 
A 1 7  LEU 7  7  7  LEU LEU A . n 
A 1 8  LEU 8  8  8  LEU LEU A . n 
A 1 9  GLU 9  9  9  GLU GLU A . n 
A 1 10 VAL 10 10 10 VAL VAL A . n 
A 1 11 LEU 11 11 11 LEU LEU A . n 
A 1 12 ALA 12 12 12 ALA ALA A . n 
A 1 13 CYS 13 13 13 CYS CYS A . n 
A 1 14 PRO 14 14 14 PRO PRO A . n 
A 1 15 LYS 15 15 15 LYS LYS A . n 
A 1 16 ASP 16 16 16 ASP ASP A . n 
A 1 17 LYS 17 17 17 LYS LYS A . n 
A 1 18 GLY 18 18 18 GLY GLY A . n 
A 1 19 PRO 19 19 19 PRO PRO A . n 
A 1 20 LEU 20 20 20 LEU LEU A . n 
A 1 21 ARG 21 21 21 ARG ARG A . n 
A 1 22 TYR 22 22 22 TYR TYR A . n 
A 1 23 LEU 23 23 23 LEU LEU A . n 
A 1 24 GLU 24 24 24 GLU GLU A . n 
A 1 25 SER 25 25 25 SER SER A . n 
A 1 26 GLU 26 26 26 GLU GLU A . n 
A 1 27 GLN 27 27 27 GLN GLN A . n 
A 1 28 LEU 28 28 28 LEU LEU A . n 
A 1 29 LEU 29 29 29 LEU LEU A . n 
A 1 30 VAL 30 30 30 VAL VAL A . n 
A 1 31 ASN 31 31 31 ASN ASN A . n 
A 1 32 GLU 32 32 32 GLU GLU A . n 
A 1 33 ARG 33 33 33 ARG ARG A . n 
A 1 34 LEU 34 34 34 LEU LEU A . n 
A 1 35 ASN 35 35 35 ASN ASN A . n 
A 1 36 LEU 36 36 36 LEU LEU A . n 
A 1 37 ALA 37 37 37 ALA ALA A . n 
A 1 38 TYR 38 38 38 TYR TYR A . n 
A 1 39 ARG 39 39 39 ARG ARG A . n 
A 1 40 ILE 40 40 40 ILE ILE A . n 
A 1 41 ASP 41 41 41 ASP ASP A . n 
A 1 42 ASP 42 42 42 ASP ASP A . n 
A 1 43 GLY 43 43 43 GLY GLY A . n 
A 1 44 ILE 44 44 44 ILE ILE A . n 
A 1 45 PRO 45 45 45 PRO PRO A . n 
A 1 46 VAL 46 46 46 VAL VAL A . n 
A 1 47 LEU 47 47 47 LEU LEU A . n 
A 1 48 LEU 48 48 48 LEU LEU A . n 
A 1 49 ILE 49 49 49 ILE ILE A . n 
A 1 50 ASP 50 50 50 ASP ASP A . n 
A 1 51 GLU 51 51 51 GLU GLU A . n 
A 1 52 ALA 52 52 52 ALA ALA A . n 
A 1 53 THR 53 53 53 THR THR A . n 
A 1 54 GLU 54 54 54 GLU GLU A . n 
A 1 55 TRP 55 55 55 TRP TRP A . n 
A 1 56 THR 56 56 56 THR THR A . n 
A 1 57 PRO 57 57 57 PRO PRO A . n 
A 1 58 ASN 58 58 58 ASN ASN A . n 
A 1 59 ASN 59 59 59 ASN ASN A . n 
A 1 60 LEU 60 60 60 LEU LEU A . n 
A 1 61 GLU 61 61 61 GLU GLU A . n 
A 1 62 HIS 62 62 ?  ?   ?   A . n 
A 1 63 HIS 63 63 ?  ?   ?   A . n 
A 1 64 HIS 64 64 ?  ?   ?   A . n 
A 1 65 HIS 65 65 ?  ?   ?   A . n 
A 1 66 HIS 66 66 ?  ?   ?   A . n 
A 1 67 HIS 67 67 ?  ?   ?   A . n 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2JNY 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  2JNY 
_struct.title                     
'Solution NMR structure of protein Uncharacterized BCR, Northeast Structural Genomics Consortium target CgR1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2JNY 
_struct_keywords.pdbx_keywords   'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' 
_struct_keywords.text            
'cgr1, NESG, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q8NQM9_CORGL 
_struct_ref.pdbx_db_accession          Q8NQM9 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   MSLDPQLLEVLACPKDKGPLRYLESEQLLVNERLNLAYRIDDGIPVLLIDEATEWTPNN 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2JNY 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 59 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q8NQM9 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  59 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       59 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2JNY LEU A 60 ? UNP Q8NQM9 ? ? 'cloning artifact' 60 1 
1 2JNY GLU A 61 ? UNP Q8NQM9 ? ? 'cloning artifact' 61 2 
1 2JNY HIS A 62 ? UNP Q8NQM9 ? ? 'expression tag'   62 3 
1 2JNY HIS A 63 ? UNP Q8NQM9 ? ? 'expression tag'   63 4 
1 2JNY HIS A 64 ? UNP Q8NQM9 ? ? 'expression tag'   64 5 
1 2JNY HIS A 65 ? UNP Q8NQM9 ? ? 'expression tag'   65 6 
1 2JNY HIS A 66 ? UNP Q8NQM9 ? ? 'expression tag'   66 7 
1 2JNY HIS A 67 ? UNP Q8NQM9 ? ? 'expression tag'   67 8 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   ? 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       ASP 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        4 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       LEU 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        8 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        ASP 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         4 
_struct_conf.end_auth_comp_id        LEU 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         8 
_struct_conf.pdbx_PDB_helix_class    5 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 21 ? LEU A 23 ? ARG A 21 LEU A 23 
A 2 LEU A 28 ? ASN A 31 ? LEU A 28 ASN A 31 
A 3 LEU A 36 ? ASP A 41 ? LEU A 36 ASP A 41 
A 4 ILE A 44 ? PRO A 45 ? ILE A 44 PRO A 45 
B 1 ARG A 21 ? LEU A 23 ? ARG A 21 LEU A 23 
B 2 LEU A 28 ? ASN A 31 ? LEU A 28 ASN A 31 
B 3 LEU A 36 ? ASP A 41 ? LEU A 36 ASP A 41 
B 4 THR A 53 ? GLU A 54 ? THR A 53 GLU A 54 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG A 21 ? N ARG A 21 O VAL A 30 ? O VAL A 30 
A 2 3 N LEU A 29 ? N LEU A 29 O TYR A 38 ? O TYR A 38 
A 3 4 N ASP A 41 ? N ASP A 41 O ILE A 44 ? O ILE A 44 
B 1 2 N ARG A 21 ? N ARG A 21 O VAL A 30 ? O VAL A 30 
B 2 3 N LEU A 29 ? N LEU A 29 O TYR A 38 ? O TYR A 38 
B 3 4 N ALA A 37 ? N ALA A 37 O THR A 53 ? O THR A 53 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    5 
_pdbx_validate_close_contact.auth_atom_id_1   HG 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   CYS 
_pdbx_validate_close_contact.auth_seq_id_1    13 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   HE2 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   TYR 
_pdbx_validate_close_contact.auth_seq_id_2    38 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             1.21 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1  SER A 2  ? ? 64.94   -169.87 
2   1  LEU A 3  ? ? 63.85   -175.57 
3   1  LEU A 8  ? ? -120.49 -65.05  
4   1  GLU A 9  ? ? 63.67   -167.56 
5   1  PRO A 57 ? ? -91.43  -159.46 
6   2  LEU A 3  ? ? 66.54   108.94  
7   2  GLU A 9  ? ? 62.44   -172.36 
8   2  LYS A 15 ? ? -86.18  -75.75  
9   2  GLN A 27 ? ? 54.49   72.79   
10  2  ASP A 42 ? ? 59.77   16.23   
11  2  THR A 56 ? ? -36.89  128.57  
12  2  ASN A 59 ? ? 51.23   165.64  
13  3  GLU A 9  ? ? 56.13   -164.10 
14  4  SER A 2  ? ? 178.26  164.20  
15  4  GLU A 9  ? ? 66.68   -172.76 
16  4  THR A 56 ? ? 71.14   107.37  
17  5  PRO A 5  ? ? -57.04  13.07   
18  5  VAL A 10 ? ? -68.96  93.71   
19  5  LYS A 15 ? ? -135.99 -64.65  
20  5  THR A 56 ? ? 61.65   83.64   
21  6  GLU A 9  ? ? 60.22   -164.96 
22  6  LYS A 15 ? ? -120.71 -69.35  
23  6  GLN A 27 ? ? 53.57   72.61   
24  6  LEU A 47 ? ? -101.13 75.66   
25  6  THR A 56 ? ? 67.34   92.82   
26  7  ASP A 42 ? ? 44.75   73.83   
27  7  LEU A 47 ? ? -95.73  40.54   
28  7  THR A 56 ? ? 56.99   87.96   
29  7  PRO A 57 ? ? -66.17  89.67   
30  8  LEU A 3  ? ? 59.67   -166.95 
31  8  LYS A 15 ? ? -104.53 -72.62  
32  8  GLN A 27 ? ? 59.32   72.72   
33  8  ASP A 42 ? ? 50.28   73.93   
34  8  ASN A 58 ? ? 63.89   96.94   
35  9  SER A 2  ? ? 75.04   138.76  
36  9  GLU A 9  ? ? 61.49   -164.61 
37  9  PRO A 14 ? ? -66.57  11.15   
38  9  LYS A 15 ? ? -94.94  -79.59  
39  9  ASP A 16 ? ? -141.24 55.66   
40  9  LEU A 47 ? ? -96.62  39.26   
41  9  THR A 56 ? ? 64.84   95.69   
42  10 SER A 2  ? ? 63.42   -179.80 
43  10 GLU A 9  ? ? 58.41   -165.63 
44  10 LYS A 15 ? ? -83.97  -83.58  
45  10 LYS A 17 ? ? 60.54   73.33   
46  10 GLN A 27 ? ? 56.24   71.77   
47  10 THR A 56 ? ? 61.74   87.82   
48  10 ASN A 59 ? ? -81.24  48.35   
49  11 GLU A 9  ? ? 66.44   173.14  
50  11 LYS A 15 ? ? -92.43  -66.86  
51  11 PRO A 57 ? ? -66.04  57.31   
52  11 ASN A 58 ? ? 63.28   -162.85 
53  12 SER A 2  ? ? 68.82   -164.46 
54  12 LEU A 3  ? ? 65.95   -173.83 
55  12 LEU A 8  ? ? -112.77 -77.97  
56  12 GLU A 9  ? ? 61.18   -164.45 
57  12 LYS A 15 ? ? -79.92  -71.53  
58  12 LEU A 47 ? ? -92.71  35.40   
59  13 LEU A 3  ? ? 51.36   83.70   
60  13 PRO A 5  ? ? -67.97  3.94    
61  13 PRO A 14 ? ? -76.19  45.65   
62  13 LYS A 15 ? ? -156.85 -73.52  
63  13 LEU A 47 ? ? -102.64 75.00   
64  13 LEU A 60 ? ? 66.42   112.77  
65  14 LEU A 8  ? ? -126.55 -57.20  
66  14 GLU A 9  ? ? 64.45   -172.89 
67  14 PRO A 14 ? ? -69.84  35.72   
68  14 LYS A 15 ? ? -120.11 -66.22  
69  14 GLN A 27 ? ? 52.70   71.89   
70  14 PRO A 57 ? ? -62.50  77.91   
71  14 LEU A 60 ? ? -90.59  38.19   
72  15 GLU A 9  ? ? 64.30   -164.82 
73  15 ASP A 42 ? ? 46.48   72.81   
74  16 LEU A 3  ? ? 69.08   114.63  
75  16 GLU A 9  ? ? 62.54   -164.73 
76  16 LYS A 15 ? ? -92.44  -69.77  
77  16 GLN A 27 ? ? 61.06   75.49   
78  16 ASN A 35 ? ? 64.83   67.22   
79  16 ASP A 42 ? ? 58.81   16.63   
80  17 GLU A 9  ? ? 62.59   -164.92 
81  17 GLN A 27 ? ? 56.61   74.15   
82  17 ASN A 59 ? ? 52.42   94.52   
83  18 LEU A 3  ? ? 64.83   -175.08 
84  18 PRO A 5  ? ? -65.67  2.67    
85  18 GLU A 9  ? ? 60.47   -164.87 
86  18 PRO A 14 ? ? -69.71  9.64    
87  18 ASP A 16 ? ? -151.98 12.78   
88  18 ASP A 42 ? ? 51.73   72.53   
89  19 SER A 2  ? ? 58.29   -176.32 
90  19 LEU A 3  ? ? 59.07   -169.18 
91  19 GLU A 9  ? ? 61.80   -175.60 
92  19 ASP A 42 ? ? 47.89   71.61   
93  19 THR A 56 ? ? 61.20   85.47   
94  20 SER A 2  ? ? 60.36   -170.48 
95  20 LEU A 8  ? ? -138.68 -54.71  
96  20 GLU A 9  ? ? 66.08   177.45  
97  20 LYS A 15 ? ? -103.64 -70.84  
98  20 SER A 25 ? ? -49.44  -70.15  
99  20 LEU A 47 ? ? -91.01  43.24   
100 20 THR A 56 ? ? 72.56   88.19   
# 
_pdbx_SG_project.full_name_of_center   'Northeast Structural Genomics Consortium' 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.initial_of_center     NESG 
_pdbx_SG_project.project_name          'PSI, Protein Structure Initiative' 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'target function' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2JNY 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2JNY 
_pdbx_nmr_representative.selection_criteria   'lowest target function' 
# 
_pdbx_nmr_sample_details.contents         
;1.0 mM [U-100% 13C; U-100% 15N] Uncharacterized BCR - label 1, 1.0 mM [U-5% 13C; U-100% 15N] Uncharacterized BCR - label 2, 90% H2O/10% D2O
;
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_exptl_sample.component 
_pdbx_nmr_exptl_sample.concentration 
_pdbx_nmr_exptl_sample.concentration_units 
_pdbx_nmr_exptl_sample.isotopic_labeling 
_pdbx_nmr_exptl_sample.solution_id 
'Uncharacterized BCR - label 1' 1.0 mM '[U-100% 13C; U-100% 15N]' 1 
'Uncharacterized BCR - label 2' 1.0 mM '[U-5% 13C; U-100% 15N]'   1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      0.1 
_pdbx_nmr_exptl_sample_conditions.pH                  6.5 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         25 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1 1 'SIMULTANEOUS HETERONUCLEAR RESOLVED [1H,1H]-NOESY' 
1 2 1 'GFT (4,3)D HNNCABCA'                               
1 3 1 'GFT (4,3)D CABCA(CO)NHN'                           
1 4 1 'GFT (4,3)D HABCAB(CO)NHN'                          
1 5 1 'GFT (4,3)D HCCH'                                   
# 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.entry_id           2JNY 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.software_ordinal   1 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Guntert, Mumenthaler and Wuthrich'                             'structure solution'        CYANA         2.1 1 
'Bartels et al.'                                                'peak picking'              XEASY         ?   2 
'Brunger, Adams, Clore, Gros, Nilges and Read'                  refinement                  CNS           1.0 3 
'Zimmerman, Moseley, Kulikowski, Montelione'                    'chemical shift assignment' AutoAssign    ?   4 
'Huang, Swapana, Rajan, Ke, Xia, Shukla, Inouye and Montelione' 'structure solution'        AutoStructure ?   5 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1  Y 1 A HIS 62 ? A HIS 62 
2   1  Y 1 A HIS 63 ? A HIS 63 
3   1  Y 1 A HIS 64 ? A HIS 64 
4   1  Y 1 A HIS 65 ? A HIS 65 
5   1  Y 1 A HIS 66 ? A HIS 66 
6   1  Y 1 A HIS 67 ? A HIS 67 
7   2  Y 1 A HIS 62 ? A HIS 62 
8   2  Y 1 A HIS 63 ? A HIS 63 
9   2  Y 1 A HIS 64 ? A HIS 64 
10  2  Y 1 A HIS 65 ? A HIS 65 
11  2  Y 1 A HIS 66 ? A HIS 66 
12  2  Y 1 A HIS 67 ? A HIS 67 
13  3  Y 1 A HIS 62 ? A HIS 62 
14  3  Y 1 A HIS 63 ? A HIS 63 
15  3  Y 1 A HIS 64 ? A HIS 64 
16  3  Y 1 A HIS 65 ? A HIS 65 
17  3  Y 1 A HIS 66 ? A HIS 66 
18  3  Y 1 A HIS 67 ? A HIS 67 
19  4  Y 1 A HIS 62 ? A HIS 62 
20  4  Y 1 A HIS 63 ? A HIS 63 
21  4  Y 1 A HIS 64 ? A HIS 64 
22  4  Y 1 A HIS 65 ? A HIS 65 
23  4  Y 1 A HIS 66 ? A HIS 66 
24  4  Y 1 A HIS 67 ? A HIS 67 
25  5  Y 1 A HIS 62 ? A HIS 62 
26  5  Y 1 A HIS 63 ? A HIS 63 
27  5  Y 1 A HIS 64 ? A HIS 64 
28  5  Y 1 A HIS 65 ? A HIS 65 
29  5  Y 1 A HIS 66 ? A HIS 66 
30  5  Y 1 A HIS 67 ? A HIS 67 
31  6  Y 1 A HIS 62 ? A HIS 62 
32  6  Y 1 A HIS 63 ? A HIS 63 
33  6  Y 1 A HIS 64 ? A HIS 64 
34  6  Y 1 A HIS 65 ? A HIS 65 
35  6  Y 1 A HIS 66 ? A HIS 66 
36  6  Y 1 A HIS 67 ? A HIS 67 
37  7  Y 1 A HIS 62 ? A HIS 62 
38  7  Y 1 A HIS 63 ? A HIS 63 
39  7  Y 1 A HIS 64 ? A HIS 64 
40  7  Y 1 A HIS 65 ? A HIS 65 
41  7  Y 1 A HIS 66 ? A HIS 66 
42  7  Y 1 A HIS 67 ? A HIS 67 
43  8  Y 1 A HIS 62 ? A HIS 62 
44  8  Y 1 A HIS 63 ? A HIS 63 
45  8  Y 1 A HIS 64 ? A HIS 64 
46  8  Y 1 A HIS 65 ? A HIS 65 
47  8  Y 1 A HIS 66 ? A HIS 66 
48  8  Y 1 A HIS 67 ? A HIS 67 
49  9  Y 1 A HIS 62 ? A HIS 62 
50  9  Y 1 A HIS 63 ? A HIS 63 
51  9  Y 1 A HIS 64 ? A HIS 64 
52  9  Y 1 A HIS 65 ? A HIS 65 
53  9  Y 1 A HIS 66 ? A HIS 66 
54  9  Y 1 A HIS 67 ? A HIS 67 
55  10 Y 1 A HIS 62 ? A HIS 62 
56  10 Y 1 A HIS 63 ? A HIS 63 
57  10 Y 1 A HIS 64 ? A HIS 64 
58  10 Y 1 A HIS 65 ? A HIS 65 
59  10 Y 1 A HIS 66 ? A HIS 66 
60  10 Y 1 A HIS 67 ? A HIS 67 
61  11 Y 1 A HIS 62 ? A HIS 62 
62  11 Y 1 A HIS 63 ? A HIS 63 
63  11 Y 1 A HIS 64 ? A HIS 64 
64  11 Y 1 A HIS 65 ? A HIS 65 
65  11 Y 1 A HIS 66 ? A HIS 66 
66  11 Y 1 A HIS 67 ? A HIS 67 
67  12 Y 1 A HIS 62 ? A HIS 62 
68  12 Y 1 A HIS 63 ? A HIS 63 
69  12 Y 1 A HIS 64 ? A HIS 64 
70  12 Y 1 A HIS 65 ? A HIS 65 
71  12 Y 1 A HIS 66 ? A HIS 66 
72  12 Y 1 A HIS 67 ? A HIS 67 
73  13 Y 1 A HIS 62 ? A HIS 62 
74  13 Y 1 A HIS 63 ? A HIS 63 
75  13 Y 1 A HIS 64 ? A HIS 64 
76  13 Y 1 A HIS 65 ? A HIS 65 
77  13 Y 1 A HIS 66 ? A HIS 66 
78  13 Y 1 A HIS 67 ? A HIS 67 
79  14 Y 1 A HIS 62 ? A HIS 62 
80  14 Y 1 A HIS 63 ? A HIS 63 
81  14 Y 1 A HIS 64 ? A HIS 64 
82  14 Y 1 A HIS 65 ? A HIS 65 
83  14 Y 1 A HIS 66 ? A HIS 66 
84  14 Y 1 A HIS 67 ? A HIS 67 
85  15 Y 1 A HIS 62 ? A HIS 62 
86  15 Y 1 A HIS 63 ? A HIS 63 
87  15 Y 1 A HIS 64 ? A HIS 64 
88  15 Y 1 A HIS 65 ? A HIS 65 
89  15 Y 1 A HIS 66 ? A HIS 66 
90  15 Y 1 A HIS 67 ? A HIS 67 
91  16 Y 1 A HIS 62 ? A HIS 62 
92  16 Y 1 A HIS 63 ? A HIS 63 
93  16 Y 1 A HIS 64 ? A HIS 64 
94  16 Y 1 A HIS 65 ? A HIS 65 
95  16 Y 1 A HIS 66 ? A HIS 66 
96  16 Y 1 A HIS 67 ? A HIS 67 
97  17 Y 1 A HIS 62 ? A HIS 62 
98  17 Y 1 A HIS 63 ? A HIS 63 
99  17 Y 1 A HIS 64 ? A HIS 64 
100 17 Y 1 A HIS 65 ? A HIS 65 
101 17 Y 1 A HIS 66 ? A HIS 66 
102 17 Y 1 A HIS 67 ? A HIS 67 
103 18 Y 1 A HIS 62 ? A HIS 62 
104 18 Y 1 A HIS 63 ? A HIS 63 
105 18 Y 1 A HIS 64 ? A HIS 64 
106 18 Y 1 A HIS 65 ? A HIS 65 
107 18 Y 1 A HIS 66 ? A HIS 66 
108 18 Y 1 A HIS 67 ? A HIS 67 
109 19 Y 1 A HIS 62 ? A HIS 62 
110 19 Y 1 A HIS 63 ? A HIS 63 
111 19 Y 1 A HIS 64 ? A HIS 64 
112 19 Y 1 A HIS 65 ? A HIS 65 
113 19 Y 1 A HIS 66 ? A HIS 66 
114 19 Y 1 A HIS 67 ? A HIS 67 
115 20 Y 1 A HIS 62 ? A HIS 62 
116 20 Y 1 A HIS 63 ? A HIS 63 
117 20 Y 1 A HIS 64 ? A HIS 64 
118 20 Y 1 A HIS 65 ? A HIS 65 
119 20 Y 1 A HIS 66 ? A HIS 66 
120 20 Y 1 A HIS 67 ? A HIS 67 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASN N    N N N 41  
ASN CA   C N S 42  
ASN C    C N N 43  
ASN O    O N N 44  
ASN CB   C N N 45  
ASN CG   C N N 46  
ASN OD1  O N N 47  
ASN ND2  N N N 48  
ASN OXT  O N N 49  
ASN H    H N N 50  
ASN H2   H N N 51  
ASN HA   H N N 52  
ASN HB2  H N N 53  
ASN HB3  H N N 54  
ASN HD21 H N N 55  
ASN HD22 H N N 56  
ASN HXT  H N N 57  
ASP N    N N N 58  
ASP CA   C N S 59  
ASP C    C N N 60  
ASP O    O N N 61  
ASP CB   C N N 62  
ASP CG   C N N 63  
ASP OD1  O N N 64  
ASP OD2  O N N 65  
ASP OXT  O N N 66  
ASP H    H N N 67  
ASP H2   H N N 68  
ASP HA   H N N 69  
ASP HB2  H N N 70  
ASP HB3  H N N 71  
ASP HD2  H N N 72  
ASP HXT  H N N 73  
CYS N    N N N 74  
CYS CA   C N R 75  
CYS C    C N N 76  
CYS O    O N N 77  
CYS CB   C N N 78  
CYS SG   S N N 79  
CYS OXT  O N N 80  
CYS H    H N N 81  
CYS H2   H N N 82  
CYS HA   H N N 83  
CYS HB2  H N N 84  
CYS HB3  H N N 85  
CYS HG   H N N 86  
CYS HXT  H N N 87  
GLN N    N N N 88  
GLN CA   C N S 89  
GLN C    C N N 90  
GLN O    O N N 91  
GLN CB   C N N 92  
GLN CG   C N N 93  
GLN CD   C N N 94  
GLN OE1  O N N 95  
GLN NE2  N N N 96  
GLN OXT  O N N 97  
GLN H    H N N 98  
GLN H2   H N N 99  
GLN HA   H N N 100 
GLN HB2  H N N 101 
GLN HB3  H N N 102 
GLN HG2  H N N 103 
GLN HG3  H N N 104 
GLN HE21 H N N 105 
GLN HE22 H N N 106 
GLN HXT  H N N 107 
GLU N    N N N 108 
GLU CA   C N S 109 
GLU C    C N N 110 
GLU O    O N N 111 
GLU CB   C N N 112 
GLU CG   C N N 113 
GLU CD   C N N 114 
GLU OE1  O N N 115 
GLU OE2  O N N 116 
GLU OXT  O N N 117 
GLU H    H N N 118 
GLU H2   H N N 119 
GLU HA   H N N 120 
GLU HB2  H N N 121 
GLU HB3  H N N 122 
GLU HG2  H N N 123 
GLU HG3  H N N 124 
GLU HE2  H N N 125 
GLU HXT  H N N 126 
GLY N    N N N 127 
GLY CA   C N N 128 
GLY C    C N N 129 
GLY O    O N N 130 
GLY OXT  O N N 131 
GLY H    H N N 132 
GLY H2   H N N 133 
GLY HA2  H N N 134 
GLY HA3  H N N 135 
GLY HXT  H N N 136 
HIS N    N N N 137 
HIS CA   C N S 138 
HIS C    C N N 139 
HIS O    O N N 140 
HIS CB   C N N 141 
HIS CG   C Y N 142 
HIS ND1  N Y N 143 
HIS CD2  C Y N 144 
HIS CE1  C Y N 145 
HIS NE2  N Y N 146 
HIS OXT  O N N 147 
HIS H    H N N 148 
HIS H2   H N N 149 
HIS HA   H N N 150 
HIS HB2  H N N 151 
HIS HB3  H N N 152 
HIS HD1  H N N 153 
HIS HD2  H N N 154 
HIS HE1  H N N 155 
HIS HE2  H N N 156 
HIS HXT  H N N 157 
ILE N    N N N 158 
ILE CA   C N S 159 
ILE C    C N N 160 
ILE O    O N N 161 
ILE CB   C N S 162 
ILE CG1  C N N 163 
ILE CG2  C N N 164 
ILE CD1  C N N 165 
ILE OXT  O N N 166 
ILE H    H N N 167 
ILE H2   H N N 168 
ILE HA   H N N 169 
ILE HB   H N N 170 
ILE HG12 H N N 171 
ILE HG13 H N N 172 
ILE HG21 H N N 173 
ILE HG22 H N N 174 
ILE HG23 H N N 175 
ILE HD11 H N N 176 
ILE HD12 H N N 177 
ILE HD13 H N N 178 
ILE HXT  H N N 179 
LEU N    N N N 180 
LEU CA   C N S 181 
LEU C    C N N 182 
LEU O    O N N 183 
LEU CB   C N N 184 
LEU CG   C N N 185 
LEU CD1  C N N 186 
LEU CD2  C N N 187 
LEU OXT  O N N 188 
LEU H    H N N 189 
LEU H2   H N N 190 
LEU HA   H N N 191 
LEU HB2  H N N 192 
LEU HB3  H N N 193 
LEU HG   H N N 194 
LEU HD11 H N N 195 
LEU HD12 H N N 196 
LEU HD13 H N N 197 
LEU HD21 H N N 198 
LEU HD22 H N N 199 
LEU HD23 H N N 200 
LEU HXT  H N N 201 
LYS N    N N N 202 
LYS CA   C N S 203 
LYS C    C N N 204 
LYS O    O N N 205 
LYS CB   C N N 206 
LYS CG   C N N 207 
LYS CD   C N N 208 
LYS CE   C N N 209 
LYS NZ   N N N 210 
LYS OXT  O N N 211 
LYS H    H N N 212 
LYS H2   H N N 213 
LYS HA   H N N 214 
LYS HB2  H N N 215 
LYS HB3  H N N 216 
LYS HG2  H N N 217 
LYS HG3  H N N 218 
LYS HD2  H N N 219 
LYS HD3  H N N 220 
LYS HE2  H N N 221 
LYS HE3  H N N 222 
LYS HZ1  H N N 223 
LYS HZ2  H N N 224 
LYS HZ3  H N N 225 
LYS HXT  H N N 226 
MET N    N N N 227 
MET CA   C N S 228 
MET C    C N N 229 
MET O    O N N 230 
MET CB   C N N 231 
MET CG   C N N 232 
MET SD   S N N 233 
MET CE   C N N 234 
MET OXT  O N N 235 
MET H    H N N 236 
MET H2   H N N 237 
MET HA   H N N 238 
MET HB2  H N N 239 
MET HB3  H N N 240 
MET HG2  H N N 241 
MET HG3  H N N 242 
MET HE1  H N N 243 
MET HE2  H N N 244 
MET HE3  H N N 245 
MET HXT  H N N 246 
PRO N    N N N 247 
PRO CA   C N S 248 
PRO C    C N N 249 
PRO O    O N N 250 
PRO CB   C N N 251 
PRO CG   C N N 252 
PRO CD   C N N 253 
PRO OXT  O N N 254 
PRO H    H N N 255 
PRO HA   H N N 256 
PRO HB2  H N N 257 
PRO HB3  H N N 258 
PRO HG2  H N N 259 
PRO HG3  H N N 260 
PRO HD2  H N N 261 
PRO HD3  H N N 262 
PRO HXT  H N N 263 
SER N    N N N 264 
SER CA   C N S 265 
SER C    C N N 266 
SER O    O N N 267 
SER CB   C N N 268 
SER OG   O N N 269 
SER OXT  O N N 270 
SER H    H N N 271 
SER H2   H N N 272 
SER HA   H N N 273 
SER HB2  H N N 274 
SER HB3  H N N 275 
SER HG   H N N 276 
SER HXT  H N N 277 
THR N    N N N 278 
THR CA   C N S 279 
THR C    C N N 280 
THR O    O N N 281 
THR CB   C N R 282 
THR OG1  O N N 283 
THR CG2  C N N 284 
THR OXT  O N N 285 
THR H    H N N 286 
THR H2   H N N 287 
THR HA   H N N 288 
THR HB   H N N 289 
THR HG1  H N N 290 
THR HG21 H N N 291 
THR HG22 H N N 292 
THR HG23 H N N 293 
THR HXT  H N N 294 
TRP N    N N N 295 
TRP CA   C N S 296 
TRP C    C N N 297 
TRP O    O N N 298 
TRP CB   C N N 299 
TRP CG   C Y N 300 
TRP CD1  C Y N 301 
TRP CD2  C Y N 302 
TRP NE1  N Y N 303 
TRP CE2  C Y N 304 
TRP CE3  C Y N 305 
TRP CZ2  C Y N 306 
TRP CZ3  C Y N 307 
TRP CH2  C Y N 308 
TRP OXT  O N N 309 
TRP H    H N N 310 
TRP H2   H N N 311 
TRP HA   H N N 312 
TRP HB2  H N N 313 
TRP HB3  H N N 314 
TRP HD1  H N N 315 
TRP HE1  H N N 316 
TRP HE3  H N N 317 
TRP HZ2  H N N 318 
TRP HZ3  H N N 319 
TRP HH2  H N N 320 
TRP HXT  H N N 321 
TYR N    N N N 322 
TYR CA   C N S 323 
TYR C    C N N 324 
TYR O    O N N 325 
TYR CB   C N N 326 
TYR CG   C Y N 327 
TYR CD1  C Y N 328 
TYR CD2  C Y N 329 
TYR CE1  C Y N 330 
TYR CE2  C Y N 331 
TYR CZ   C Y N 332 
TYR OH   O N N 333 
TYR OXT  O N N 334 
TYR H    H N N 335 
TYR H2   H N N 336 
TYR HA   H N N 337 
TYR HB2  H N N 338 
TYR HB3  H N N 339 
TYR HD1  H N N 340 
TYR HD2  H N N 341 
TYR HE1  H N N 342 
TYR HE2  H N N 343 
TYR HH   H N N 344 
TYR HXT  H N N 345 
VAL N    N N N 346 
VAL CA   C N S 347 
VAL C    C N N 348 
VAL O    O N N 349 
VAL CB   C N N 350 
VAL CG1  C N N 351 
VAL CG2  C N N 352 
VAL OXT  O N N 353 
VAL H    H N N 354 
VAL H2   H N N 355 
VAL HA   H N N 356 
VAL HB   H N N 357 
VAL HG11 H N N 358 
VAL HG12 H N N 359 
VAL HG13 H N N 360 
VAL HG21 H N N 361 
VAL HG22 H N N 362 
VAL HG23 H N N 363 
VAL HXT  H N N 364 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
GLN N   CA   sing N N 83  
GLN N   H    sing N N 84  
GLN N   H2   sing N N 85  
GLN CA  C    sing N N 86  
GLN CA  CB   sing N N 87  
GLN CA  HA   sing N N 88  
GLN C   O    doub N N 89  
GLN C   OXT  sing N N 90  
GLN CB  CG   sing N N 91  
GLN CB  HB2  sing N N 92  
GLN CB  HB3  sing N N 93  
GLN CG  CD   sing N N 94  
GLN CG  HG2  sing N N 95  
GLN CG  HG3  sing N N 96  
GLN CD  OE1  doub N N 97  
GLN CD  NE2  sing N N 98  
GLN NE2 HE21 sing N N 99  
GLN NE2 HE22 sing N N 100 
GLN OXT HXT  sing N N 101 
GLU N   CA   sing N N 102 
GLU N   H    sing N N 103 
GLU N   H2   sing N N 104 
GLU CA  C    sing N N 105 
GLU CA  CB   sing N N 106 
GLU CA  HA   sing N N 107 
GLU C   O    doub N N 108 
GLU C   OXT  sing N N 109 
GLU CB  CG   sing N N 110 
GLU CB  HB2  sing N N 111 
GLU CB  HB3  sing N N 112 
GLU CG  CD   sing N N 113 
GLU CG  HG2  sing N N 114 
GLU CG  HG3  sing N N 115 
GLU CD  OE1  doub N N 116 
GLU CD  OE2  sing N N 117 
GLU OE2 HE2  sing N N 118 
GLU OXT HXT  sing N N 119 
GLY N   CA   sing N N 120 
GLY N   H    sing N N 121 
GLY N   H2   sing N N 122 
GLY CA  C    sing N N 123 
GLY CA  HA2  sing N N 124 
GLY CA  HA3  sing N N 125 
GLY C   O    doub N N 126 
GLY C   OXT  sing N N 127 
GLY OXT HXT  sing N N 128 
HIS N   CA   sing N N 129 
HIS N   H    sing N N 130 
HIS N   H2   sing N N 131 
HIS CA  C    sing N N 132 
HIS CA  CB   sing N N 133 
HIS CA  HA   sing N N 134 
HIS C   O    doub N N 135 
HIS C   OXT  sing N N 136 
HIS CB  CG   sing N N 137 
HIS CB  HB2  sing N N 138 
HIS CB  HB3  sing N N 139 
HIS CG  ND1  sing Y N 140 
HIS CG  CD2  doub Y N 141 
HIS ND1 CE1  doub Y N 142 
HIS ND1 HD1  sing N N 143 
HIS CD2 NE2  sing Y N 144 
HIS CD2 HD2  sing N N 145 
HIS CE1 NE2  sing Y N 146 
HIS CE1 HE1  sing N N 147 
HIS NE2 HE2  sing N N 148 
HIS OXT HXT  sing N N 149 
ILE N   CA   sing N N 150 
ILE N   H    sing N N 151 
ILE N   H2   sing N N 152 
ILE CA  C    sing N N 153 
ILE CA  CB   sing N N 154 
ILE CA  HA   sing N N 155 
ILE C   O    doub N N 156 
ILE C   OXT  sing N N 157 
ILE CB  CG1  sing N N 158 
ILE CB  CG2  sing N N 159 
ILE CB  HB   sing N N 160 
ILE CG1 CD1  sing N N 161 
ILE CG1 HG12 sing N N 162 
ILE CG1 HG13 sing N N 163 
ILE CG2 HG21 sing N N 164 
ILE CG2 HG22 sing N N 165 
ILE CG2 HG23 sing N N 166 
ILE CD1 HD11 sing N N 167 
ILE CD1 HD12 sing N N 168 
ILE CD1 HD13 sing N N 169 
ILE OXT HXT  sing N N 170 
LEU N   CA   sing N N 171 
LEU N   H    sing N N 172 
LEU N   H2   sing N N 173 
LEU CA  C    sing N N 174 
LEU CA  CB   sing N N 175 
LEU CA  HA   sing N N 176 
LEU C   O    doub N N 177 
LEU C   OXT  sing N N 178 
LEU CB  CG   sing N N 179 
LEU CB  HB2  sing N N 180 
LEU CB  HB3  sing N N 181 
LEU CG  CD1  sing N N 182 
LEU CG  CD2  sing N N 183 
LEU CG  HG   sing N N 184 
LEU CD1 HD11 sing N N 185 
LEU CD1 HD12 sing N N 186 
LEU CD1 HD13 sing N N 187 
LEU CD2 HD21 sing N N 188 
LEU CD2 HD22 sing N N 189 
LEU CD2 HD23 sing N N 190 
LEU OXT HXT  sing N N 191 
LYS N   CA   sing N N 192 
LYS N   H    sing N N 193 
LYS N   H2   sing N N 194 
LYS CA  C    sing N N 195 
LYS CA  CB   sing N N 196 
LYS CA  HA   sing N N 197 
LYS C   O    doub N N 198 
LYS C   OXT  sing N N 199 
LYS CB  CG   sing N N 200 
LYS CB  HB2  sing N N 201 
LYS CB  HB3  sing N N 202 
LYS CG  CD   sing N N 203 
LYS CG  HG2  sing N N 204 
LYS CG  HG3  sing N N 205 
LYS CD  CE   sing N N 206 
LYS CD  HD2  sing N N 207 
LYS CD  HD3  sing N N 208 
LYS CE  NZ   sing N N 209 
LYS CE  HE2  sing N N 210 
LYS CE  HE3  sing N N 211 
LYS NZ  HZ1  sing N N 212 
LYS NZ  HZ2  sing N N 213 
LYS NZ  HZ3  sing N N 214 
LYS OXT HXT  sing N N 215 
MET N   CA   sing N N 216 
MET N   H    sing N N 217 
MET N   H2   sing N N 218 
MET CA  C    sing N N 219 
MET CA  CB   sing N N 220 
MET CA  HA   sing N N 221 
MET C   O    doub N N 222 
MET C   OXT  sing N N 223 
MET CB  CG   sing N N 224 
MET CB  HB2  sing N N 225 
MET CB  HB3  sing N N 226 
MET CG  SD   sing N N 227 
MET CG  HG2  sing N N 228 
MET CG  HG3  sing N N 229 
MET SD  CE   sing N N 230 
MET CE  HE1  sing N N 231 
MET CE  HE2  sing N N 232 
MET CE  HE3  sing N N 233 
MET OXT HXT  sing N N 234 
PRO N   CA   sing N N 235 
PRO N   CD   sing N N 236 
PRO N   H    sing N N 237 
PRO CA  C    sing N N 238 
PRO CA  CB   sing N N 239 
PRO CA  HA   sing N N 240 
PRO C   O    doub N N 241 
PRO C   OXT  sing N N 242 
PRO CB  CG   sing N N 243 
PRO CB  HB2  sing N N 244 
PRO CB  HB3  sing N N 245 
PRO CG  CD   sing N N 246 
PRO CG  HG2  sing N N 247 
PRO CG  HG3  sing N N 248 
PRO CD  HD2  sing N N 249 
PRO CD  HD3  sing N N 250 
PRO OXT HXT  sing N N 251 
SER N   CA   sing N N 252 
SER N   H    sing N N 253 
SER N   H2   sing N N 254 
SER CA  C    sing N N 255 
SER CA  CB   sing N N 256 
SER CA  HA   sing N N 257 
SER C   O    doub N N 258 
SER C   OXT  sing N N 259 
SER CB  OG   sing N N 260 
SER CB  HB2  sing N N 261 
SER CB  HB3  sing N N 262 
SER OG  HG   sing N N 263 
SER OXT HXT  sing N N 264 
THR N   CA   sing N N 265 
THR N   H    sing N N 266 
THR N   H2   sing N N 267 
THR CA  C    sing N N 268 
THR CA  CB   sing N N 269 
THR CA  HA   sing N N 270 
THR C   O    doub N N 271 
THR C   OXT  sing N N 272 
THR CB  OG1  sing N N 273 
THR CB  CG2  sing N N 274 
THR CB  HB   sing N N 275 
THR OG1 HG1  sing N N 276 
THR CG2 HG21 sing N N 277 
THR CG2 HG22 sing N N 278 
THR CG2 HG23 sing N N 279 
THR OXT HXT  sing N N 280 
TRP N   CA   sing N N 281 
TRP N   H    sing N N 282 
TRP N   H2   sing N N 283 
TRP CA  C    sing N N 284 
TRP CA  CB   sing N N 285 
TRP CA  HA   sing N N 286 
TRP C   O    doub N N 287 
TRP C   OXT  sing N N 288 
TRP CB  CG   sing N N 289 
TRP CB  HB2  sing N N 290 
TRP CB  HB3  sing N N 291 
TRP CG  CD1  doub Y N 292 
TRP CG  CD2  sing Y N 293 
TRP CD1 NE1  sing Y N 294 
TRP CD1 HD1  sing N N 295 
TRP CD2 CE2  doub Y N 296 
TRP CD2 CE3  sing Y N 297 
TRP NE1 CE2  sing Y N 298 
TRP NE1 HE1  sing N N 299 
TRP CE2 CZ2  sing Y N 300 
TRP CE3 CZ3  doub Y N 301 
TRP CE3 HE3  sing N N 302 
TRP CZ2 CH2  doub Y N 303 
TRP CZ2 HZ2  sing N N 304 
TRP CZ3 CH2  sing Y N 305 
TRP CZ3 HZ3  sing N N 306 
TRP CH2 HH2  sing N N 307 
TRP OXT HXT  sing N N 308 
TYR N   CA   sing N N 309 
TYR N   H    sing N N 310 
TYR N   H2   sing N N 311 
TYR CA  C    sing N N 312 
TYR CA  CB   sing N N 313 
TYR CA  HA   sing N N 314 
TYR C   O    doub N N 315 
TYR C   OXT  sing N N 316 
TYR CB  CG   sing N N 317 
TYR CB  HB2  sing N N 318 
TYR CB  HB3  sing N N 319 
TYR CG  CD1  doub Y N 320 
TYR CG  CD2  sing Y N 321 
TYR CD1 CE1  sing Y N 322 
TYR CD1 HD1  sing N N 323 
TYR CD2 CE2  doub Y N 324 
TYR CD2 HD2  sing N N 325 
TYR CE1 CZ   doub Y N 326 
TYR CE1 HE1  sing N N 327 
TYR CE2 CZ   sing Y N 328 
TYR CE2 HE2  sing N N 329 
TYR CZ  OH   sing N N 330 
TYR OH  HH   sing N N 331 
TYR OXT HXT  sing N N 332 
VAL N   CA   sing N N 333 
VAL N   H    sing N N 334 
VAL N   H2   sing N N 335 
VAL CA  C    sing N N 336 
VAL CA  CB   sing N N 337 
VAL CA  HA   sing N N 338 
VAL C   O    doub N N 339 
VAL C   OXT  sing N N 340 
VAL CB  CG1  sing N N 341 
VAL CB  CG2  sing N N 342 
VAL CB  HB   sing N N 343 
VAL CG1 HG11 sing N N 344 
VAL CG1 HG12 sing N N 345 
VAL CG1 HG13 sing N N 346 
VAL CG2 HG21 sing N N 347 
VAL CG2 HG22 sing N N 348 
VAL CG2 HG23 sing N N 349 
VAL OXT HXT  sing N N 350 
# 
_pdbx_nmr_spectrometer.field_strength    750 
_pdbx_nmr_spectrometer.manufacturer      Varian 
_pdbx_nmr_spectrometer.model             INOVA 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              'Varian INOVA' 
# 
_atom_sites.entry_id                    2JNY 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_