data_2JOH # _entry.id 2JOH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2JOH pdb_00002joh 10.2210/pdb2joh/pdb RCSB RCSB100089 ? ? WWPDB D_1000100089 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-02-19 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2021-10-20 4 'Structure model' 1 3 2023-12-20 5 'Structure model' 1 4 2024-11-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' Other 6 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' struct_ref_seq_dif 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' pdbx_database_status 7 5 'Structure model' pdbx_entry_details 8 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_struct_ref_seq_dif.details' 5 4 'Structure model' '_pdbx_database_status.deposit_site' # _pdbx_database_status.deposit_site RCSB _pdbx_database_status.entry_id 2JOH _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2007-03-13 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Li, J.' 1 'Lin, D.' 2 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Unique structural characteristics of the rabbit prion protein.' J.Biol.Chem. 285 31682 31693 2010 JBCHA3 US 0021-9258 0071 ? 20639199 10.1074/jbc.M110.118844 1 '1H, 13C and 15N resonance assignments of rabbit prion protein (91-228).' J.Biomol.Nmr 38 181 181 2007 JBNME9 NE 0925-2738 0800 ? 17415669 10.1007/s10858-006-9115-9 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wen, Y.' 1 ? primary 'Li, J.' 2 ? primary 'Yao, W.' 3 ? primary 'Xiong, M.' 4 ? primary 'Hong, J.' 5 ? primary 'Peng, Y.' 6 ? primary 'Xiao, G.' 7 ? primary 'Lin, D.' 8 ? 1 'Li, J.' 9 ? 1 'Mei, F.H.' 10 ? 1 'Xiao, G.F.' 11 ? 1 'Guo, C.Y.' 12 ? 1 'Lin, D.H.' 13 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Major prion protein' _entity.formula_weight 17024.965 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation S173N _entity.pdbx_fragment 'residues 91-228' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PrP, PrP27-30, PrP33-35C, CD230 antigen' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MHQGGTHNQWGKPSKPKTSMKHVAGAAAAGAVVGGLGGYMLGSAMSRPLIHFGNDYEDRYYRENMYRYPNQVYYRPVDQY SNQNNFVHDCVNITVKQHTVTTTTKGENFTETDIKIMERVVEQMCITQYQQESQAAYQRALEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MHQGGTHNQWGKPSKPKTSMKHVAGAAAAGAVVGGLGGYMLGSAMSRPLIHFGNDYEDRYYRENMYRYPNQVYYRPVDQY SNQNNFVHDCVNITVKQHTVTTTTKGENFTETDIKIMERVVEQMCITQYQQESQAAYQRALEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 GLN n 1 4 GLY n 1 5 GLY n 1 6 THR n 1 7 HIS n 1 8 ASN n 1 9 GLN n 1 10 TRP n 1 11 GLY n 1 12 LYS n 1 13 PRO n 1 14 SER n 1 15 LYS n 1 16 PRO n 1 17 LYS n 1 18 THR n 1 19 SER n 1 20 MET n 1 21 LYS n 1 22 HIS n 1 23 VAL n 1 24 ALA n 1 25 GLY n 1 26 ALA n 1 27 ALA n 1 28 ALA n 1 29 ALA n 1 30 GLY n 1 31 ALA n 1 32 VAL n 1 33 VAL n 1 34 GLY n 1 35 GLY n 1 36 LEU n 1 37 GLY n 1 38 GLY n 1 39 TYR n 1 40 MET n 1 41 LEU n 1 42 GLY n 1 43 SER n 1 44 ALA n 1 45 MET n 1 46 SER n 1 47 ARG n 1 48 PRO n 1 49 LEU n 1 50 ILE n 1 51 HIS n 1 52 PHE n 1 53 GLY n 1 54 ASN n 1 55 ASP n 1 56 TYR n 1 57 GLU n 1 58 ASP n 1 59 ARG n 1 60 TYR n 1 61 TYR n 1 62 ARG n 1 63 GLU n 1 64 ASN n 1 65 MET n 1 66 TYR n 1 67 ARG n 1 68 TYR n 1 69 PRO n 1 70 ASN n 1 71 GLN n 1 72 VAL n 1 73 TYR n 1 74 TYR n 1 75 ARG n 1 76 PRO n 1 77 VAL n 1 78 ASP n 1 79 GLN n 1 80 TYR n 1 81 SER n 1 82 ASN n 1 83 GLN n 1 84 ASN n 1 85 ASN n 1 86 PHE n 1 87 VAL n 1 88 HIS n 1 89 ASP n 1 90 CYS n 1 91 VAL n 1 92 ASN n 1 93 ILE n 1 94 THR n 1 95 VAL n 1 96 LYS n 1 97 GLN n 1 98 HIS n 1 99 THR n 1 100 VAL n 1 101 THR n 1 102 THR n 1 103 THR n 1 104 THR n 1 105 LYS n 1 106 GLY n 1 107 GLU n 1 108 ASN n 1 109 PHE n 1 110 THR n 1 111 GLU n 1 112 THR n 1 113 ASP n 1 114 ILE n 1 115 LYS n 1 116 ILE n 1 117 MET n 1 118 GLU n 1 119 ARG n 1 120 VAL n 1 121 VAL n 1 122 GLU n 1 123 GLN n 1 124 MET n 1 125 CYS n 1 126 ILE n 1 127 THR n 1 128 GLN n 1 129 TYR n 1 130 GLN n 1 131 GLN n 1 132 GLU n 1 133 SER n 1 134 GLN n 1 135 ALA n 1 136 ALA n 1 137 TYR n 1 138 GLN n 1 139 ARG n 1 140 ALA n 1 141 LEU n 1 142 GLU n 1 143 HIS n 1 144 HIS n 1 145 HIS n 1 146 HIS n 1 147 HIS n 1 148 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name rabbit _entity_src_gen.gene_src_genus Oryctolagus _entity_src_gen.pdbx_gene_src_gene 'PRNP, PRP' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Oryctolagus cuniculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9986 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector 'pET-30a(+)' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 89 ? ? ? A . n A 1 2 HIS 2 90 ? ? ? A . n A 1 3 GLN 3 91 ? ? ? A . n A 1 4 GLY 4 92 ? ? ? A . n A 1 5 GLY 5 93 ? ? ? A . n A 1 6 THR 6 94 ? ? ? A . n A 1 7 HIS 7 95 ? ? ? A . n A 1 8 ASN 8 96 ? ? ? A . n A 1 9 GLN 9 97 ? ? ? A . n A 1 10 TRP 10 98 ? ? ? A . n A 1 11 GLY 11 99 ? ? ? A . n A 1 12 LYS 12 100 ? ? ? A . n A 1 13 PRO 13 101 ? ? ? A . n A 1 14 SER 14 102 ? ? ? A . n A 1 15 LYS 15 103 ? ? ? A . n A 1 16 PRO 16 104 ? ? ? A . n A 1 17 LYS 17 105 ? ? ? A . n A 1 18 THR 18 106 ? ? ? A . n A 1 19 SER 19 107 ? ? ? A . n A 1 20 MET 20 108 ? ? ? A . n A 1 21 LYS 21 109 ? ? ? A . n A 1 22 HIS 22 110 ? ? ? A . n A 1 23 VAL 23 111 ? ? ? A . n A 1 24 ALA 24 112 ? ? ? A . n A 1 25 GLY 25 113 ? ? ? A . n A 1 26 ALA 26 114 ? ? ? A . n A 1 27 ALA 27 115 ? ? ? A . n A 1 28 ALA 28 116 ? ? ? A . n A 1 29 ALA 29 117 ? ? ? A . n A 1 30 GLY 30 118 ? ? ? A . n A 1 31 ALA 31 119 ? ? ? A . n A 1 32 VAL 32 120 ? ? ? A . n A 1 33 VAL 33 121 ? ? ? A . n A 1 34 GLY 34 122 ? ? ? A . n A 1 35 GLY 35 123 ? ? ? A . n A 1 36 LEU 36 124 124 LEU LEU A . n A 1 37 GLY 37 125 125 GLY GLY A . n A 1 38 GLY 38 126 126 GLY GLY A . n A 1 39 TYR 39 127 127 TYR TYR A . n A 1 40 MET 40 128 128 MET MET A . n A 1 41 LEU 41 129 129 LEU LEU A . n A 1 42 GLY 42 130 130 GLY GLY A . n A 1 43 SER 43 131 131 SER SER A . n A 1 44 ALA 44 132 132 ALA ALA A . n A 1 45 MET 45 133 133 MET MET A . n A 1 46 SER 46 134 134 SER SER A . n A 1 47 ARG 47 135 135 ARG ARG A . n A 1 48 PRO 48 136 136 PRO PRO A . n A 1 49 LEU 49 137 137 LEU LEU A . n A 1 50 ILE 50 138 138 ILE ILE A . n A 1 51 HIS 51 139 139 HIS HIS A . n A 1 52 PHE 52 140 140 PHE PHE A . n A 1 53 GLY 53 141 141 GLY GLY A . n A 1 54 ASN 54 142 142 ASN ASN A . n A 1 55 ASP 55 143 143 ASP ASP A . n A 1 56 TYR 56 144 144 TYR TYR A . n A 1 57 GLU 57 145 145 GLU GLU A . n A 1 58 ASP 58 146 146 ASP ASP A . n A 1 59 ARG 59 147 147 ARG ARG A . n A 1 60 TYR 60 148 148 TYR TYR A . n A 1 61 TYR 61 149 149 TYR TYR A . n A 1 62 ARG 62 150 150 ARG ARG A . n A 1 63 GLU 63 151 151 GLU GLU A . n A 1 64 ASN 64 152 152 ASN ASN A . n A 1 65 MET 65 153 153 MET MET A . n A 1 66 TYR 66 154 154 TYR TYR A . n A 1 67 ARG 67 155 155 ARG ARG A . n A 1 68 TYR 68 156 156 TYR TYR A . n A 1 69 PRO 69 157 157 PRO PRO A . n A 1 70 ASN 70 158 158 ASN ASN A . n A 1 71 GLN 71 159 159 GLN GLN A . n A 1 72 VAL 72 160 160 VAL VAL A . n A 1 73 TYR 73 161 161 TYR TYR A . n A 1 74 TYR 74 162 162 TYR TYR A . n A 1 75 ARG 75 163 163 ARG ARG A . n A 1 76 PRO 76 164 164 PRO PRO A . n A 1 77 VAL 77 165 165 VAL VAL A . n A 1 78 ASP 78 166 166 ASP ASP A . n A 1 79 GLN 79 167 167 GLN GLN A . n A 1 80 TYR 80 168 168 TYR TYR A . n A 1 81 SER 81 169 169 SER SER A . n A 1 82 ASN 82 170 170 ASN ASN A . n A 1 83 GLN 83 171 171 GLN GLN A . n A 1 84 ASN 84 172 172 ASN ASN A . n A 1 85 ASN 85 173 173 ASN ASN A . n A 1 86 PHE 86 174 174 PHE PHE A . n A 1 87 VAL 87 175 175 VAL VAL A . n A 1 88 HIS 88 176 176 HIS HIS A . n A 1 89 ASP 89 177 177 ASP ASP A . n A 1 90 CYS 90 178 178 CYS CYS A . n A 1 91 VAL 91 179 179 VAL VAL A . n A 1 92 ASN 92 180 180 ASN ASN A . n A 1 93 ILE 93 181 181 ILE ILE A . n A 1 94 THR 94 182 182 THR THR A . n A 1 95 VAL 95 183 183 VAL VAL A . n A 1 96 LYS 96 184 184 LYS LYS A . n A 1 97 GLN 97 185 185 GLN GLN A . n A 1 98 HIS 98 186 186 HIS HIS A . n A 1 99 THR 99 187 187 THR THR A . n A 1 100 VAL 100 188 188 VAL VAL A . n A 1 101 THR 101 189 189 THR THR A . n A 1 102 THR 102 190 190 THR THR A . n A 1 103 THR 103 191 191 THR THR A . n A 1 104 THR 104 192 192 THR THR A . n A 1 105 LYS 105 193 193 LYS LYS A . n A 1 106 GLY 106 194 194 GLY GLY A . n A 1 107 GLU 107 195 195 GLU GLU A . n A 1 108 ASN 108 196 196 ASN ASN A . n A 1 109 PHE 109 197 197 PHE PHE A . n A 1 110 THR 110 198 198 THR THR A . n A 1 111 GLU 111 199 199 GLU GLU A . n A 1 112 THR 112 200 200 THR THR A . n A 1 113 ASP 113 201 201 ASP ASP A . n A 1 114 ILE 114 202 202 ILE ILE A . n A 1 115 LYS 115 203 203 LYS LYS A . n A 1 116 ILE 116 204 204 ILE ILE A . n A 1 117 MET 117 205 205 MET MET A . n A 1 118 GLU 118 206 206 GLU GLU A . n A 1 119 ARG 119 207 207 ARG ARG A . n A 1 120 VAL 120 208 208 VAL VAL A . n A 1 121 VAL 121 209 209 VAL VAL A . n A 1 122 GLU 122 210 210 GLU GLU A . n A 1 123 GLN 123 211 211 GLN GLN A . n A 1 124 MET 124 212 212 MET MET A . n A 1 125 CYS 125 213 213 CYS CYS A . n A 1 126 ILE 126 214 214 ILE ILE A . n A 1 127 THR 127 215 215 THR THR A . n A 1 128 GLN 128 216 216 GLN GLN A . n A 1 129 TYR 129 217 217 TYR TYR A . n A 1 130 GLN 130 218 218 GLN GLN A . n A 1 131 GLN 131 219 219 GLN GLN A . n A 1 132 GLU 132 220 220 GLU GLU A . n A 1 133 SER 133 221 221 SER SER A . n A 1 134 GLN 134 222 222 GLN GLN A . n A 1 135 ALA 135 223 223 ALA ALA A . n A 1 136 ALA 136 224 224 ALA ALA A . n A 1 137 TYR 137 225 225 TYR TYR A . n A 1 138 GLN 138 226 226 GLN GLN A . n A 1 139 ARG 139 227 227 ARG ARG A . n A 1 140 ALA 140 228 228 ALA ALA A . n A 1 141 LEU 141 229 ? ? ? A . n A 1 142 GLU 142 230 ? ? ? A . n A 1 143 HIS 143 231 ? ? ? A . n A 1 144 HIS 144 232 ? ? ? A . n A 1 145 HIS 145 233 ? ? ? A . n A 1 146 HIS 146 234 ? ? ? A . n A 1 147 HIS 147 235 ? ? ? A . n A 1 148 HIS 148 236 ? ? ? A . n # _cell.entry_id 2JOH _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2JOH _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2JOH _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 2JOH _struct.title 'NMR structure of rabbit prion protein mutation S173N' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2JOH _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' _struct_keywords.text 'prion protein, UNKNOWN FUNCTION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PRIO_RABIT _struct_ref.pdbx_db_accession Q95211 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;QGGTHNQWGKPSKPKTSMKHVAGAAAAGAVVGGLGGYMLGSAMSRPLIHFGNDYEDRYYRENMYRYPNQVYYRPVDQYSN QNSFVHDCVNITVKQHTVTTTTKGENFTETDIKIMERVVEQMCITQYQQESQAAYQRA ; _struct_ref.pdbx_align_begin 91 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2JOH _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 140 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q95211 _struct_ref_seq.db_align_beg 91 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 228 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 91 _struct_ref_seq.pdbx_auth_seq_align_end 228 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2JOH MET A 1 ? UNP Q95211 ? ? 'initiating methionine' 89 1 1 2JOH HIS A 2 ? UNP Q95211 ? ? 'expression tag' 90 2 1 2JOH ASN A 85 ? UNP Q95211 SER 173 'engineered mutation' 173 3 1 2JOH LEU A 141 ? UNP Q95211 ? ? 'expression tag' 229 4 1 2JOH GLU A 142 ? UNP Q95211 ? ? 'expression tag' 230 5 1 2JOH HIS A 143 ? UNP Q95211 ? ? 'expression tag' 231 6 1 2JOH HIS A 144 ? UNP Q95211 ? ? 'expression tag' 232 7 1 2JOH HIS A 145 ? UNP Q95211 ? ? 'expression tag' 233 8 1 2JOH HIS A 146 ? UNP Q95211 ? ? 'expression tag' 234 9 1 2JOH HIS A 147 ? UNP Q95211 ? ? 'expression tag' 235 10 1 2JOH HIS A 148 ? UNP Q95211 ? ? 'expression tag' 236 11 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 54 ? MET A 65 ? ASN A 142 MET A 153 1 ? 12 HELX_P HELX_P2 2 ASN A 82 ? HIS A 98 ? ASN A 170 HIS A 186 1 ? 17 HELX_P HELX_P3 3 THR A 110 ? ALA A 140 ? THR A 198 ALA A 228 1 ? 31 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 90 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 125 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 178 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 213 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.021 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYS _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 90 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 125 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYS _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 178 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 213 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom SG _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Disulfide bridge' # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 41 ? GLY A 42 ? LEU A 129 GLY A 130 A 2 VAL A 72 ? TYR A 73 ? VAL A 160 TYR A 161 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id GLY _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 42 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id GLY _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 130 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id VAL _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 72 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 160 # _pdbx_entry_details.entry_id 2JOH _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 H A THR 198 ? ? HB2 A ASP 201 ? ? 1.07 2 1 H A GLN 171 ? ? HD1 A TYR 217 ? ? 1.19 3 1 HB3 A GLN 167 ? ? HB3 A SER 221 ? ? 1.24 4 1 HG23 A VAL 175 ? ? HD11 A ILE 214 ? ? 1.30 5 1 HG12 A VAL 175 ? ? HB2 A CYS 213 ? ? 1.33 6 1 O A ASN 142 ? ? H A ASP 146 ? ? 1.56 7 1 O A ILE 138 ? ? H A PHE 140 ? ? 1.60 8 2 H A ARG 163 ? ? HE2 A PHE 174 ? ? 1.02 9 2 HE1 A TYR 149 ? ? HG12 A ILE 204 ? ? 1.19 10 2 HD1 A TYR 149 ? ? HD22 A ASN 152 ? ? 1.19 11 2 HB3 A GLN 167 ? ? HB3 A SER 221 ? ? 1.19 12 2 H A GLN 171 ? ? HD1 A TYR 217 ? ? 1.30 13 2 HG21 A VAL 175 ? ? HD13 A ILE 214 ? ? 1.32 14 2 HH A TYR 148 ? ? OD1 A ASP 201 ? ? 1.58 15 2 O A VAL 175 ? ? H A VAL 179 ? ? 1.59 16 3 HD1 A PHE 140 ? ? HH12 A ARG 207 ? ? 1.17 17 3 HA A ALA 224 ? ? HG2 A ARG 227 ? ? 1.35 18 4 HG11 A VAL 165 ? ? HG3 A GLU 220 ? ? 0.98 19 4 HA A ALA 224 ? ? HG2 A ARG 227 ? ? 1.14 20 4 HE3 A MET 212 ? ? HE21 A GLN 216 ? ? 1.17 21 4 HG21 A VAL 175 ? ? HD13 A ILE 214 ? ? 1.19 22 4 HG11 A VAL 179 ? ? HG13 A VAL 209 ? ? 1.31 23 4 HB3 A GLN 171 ? ? HA A TYR 217 ? ? 1.34 24 4 HD1 A TYR 149 ? ? HD22 A ASN 152 ? ? 1.34 25 4 O A ASN 142 ? ? H A ASP 146 ? ? 1.55 26 4 O A GLN 216 ? ? H A GLU 220 ? ? 1.56 27 4 O A ILE 204 ? ? H A VAL 208 ? ? 1.58 28 5 HG11 A VAL 179 ? ? HG23 A VAL 209 ? ? 1.15 29 5 HD22 A LEU 137 ? ? HE1 A TYR 149 ? ? 1.26 30 5 HG12 A VAL 175 ? ? HB2 A CYS 213 ? ? 1.28 31 5 HB3 A HIS 186 ? ? HZ A PHE 197 ? ? 1.29 32 5 HA2 A GLY 130 ? ? HE1 A TYR 162 ? ? 1.34 33 5 OD1 A ASP 146 ? ? HH A TYR 149 ? ? 1.52 34 5 O A ILE 204 ? ? H A VAL 208 ? ? 1.53 35 6 HE21 A GLN 216 ? ? HB2 A GLU 220 ? ? 1.22 36 6 HG13 A VAL 175 ? ? HB2 A CYS 213 ? ? 1.25 37 6 H A GLN 171 ? ? HD1 A TYR 217 ? ? 1.29 38 6 O A ILE 181 ? ? H A GLN 185 ? ? 1.55 39 6 OE2 A GLU 220 ? ? HE A ARG 227 ? ? 1.59 40 6 H A GLY 130 ? ? O A VAL 160 ? ? 1.59 41 7 HG13 A VAL 165 ? ? HG3 A GLU 220 ? ? 0.97 42 7 HA A ASP 143 ? ? HB2 A ASP 146 ? ? 1.33 43 7 O A ASN 142 ? ? H A ASP 146 ? ? 1.58 44 8 HB3 A HIS 186 ? ? HZ A PHE 197 ? ? 1.16 45 8 HH A TYR 149 ? ? HG23 A VAL 208 ? ? 1.30 46 8 HG23 A VAL 175 ? ? HD12 A ILE 214 ? ? 1.33 47 8 HB3 A GLN 167 ? ? HB2 A SER 221 ? ? 1.33 48 8 O A VAL 175 ? ? H A VAL 179 ? ? 1.59 49 9 HA A ALA 224 ? ? HG2 A ARG 227 ? ? 1.17 50 9 HG12 A VAL 179 ? ? HG12 A VAL 209 ? ? 1.26 51 9 HA A HIS 186 ? ? HB A THR 190 ? ? 1.27 52 9 HG21 A VAL 175 ? ? HD12 A ILE 214 ? ? 1.34 53 9 O A ILE 204 ? ? H A VAL 208 ? ? 1.59 54 10 HG13 A VAL 165 ? ? HG2 A GLU 220 ? ? 1.11 55 10 HG13 A VAL 175 ? ? HB2 A CYS 213 ? ? 1.24 56 10 HA A TYR 149 ? ? HB2 A ASN 152 ? ? 1.35 57 10 H A GLY 130 ? ? O A VAL 160 ? ? 1.59 58 10 O A LEU 129 ? ? H A SER 131 ? ? 1.59 59 10 O A VAL 165 ? ? H A GLN 167 ? ? 1.59 60 10 O A ILE 181 ? ? H A GLN 185 ? ? 1.60 61 11 HB3 A GLN 167 ? ? HB3 A SER 221 ? ? 1.01 62 11 H A ARG 163 ? ? HE2 A PHE 174 ? ? 1.18 63 11 HA2 A GLY 130 ? ? HE1 A TYR 162 ? ? 1.25 64 11 HG21 A VAL 175 ? ? HD12 A ILE 214 ? ? 1.29 65 11 HD1 A TYR 149 ? ? HD22 A ASN 152 ? ? 1.34 66 11 O A ASN 142 ? ? H A ASP 146 ? ? 1.54 67 11 OE2 A GLU 145 ? ? HZ2 A LYS 203 ? ? 1.55 68 11 O A GLU 220 ? ? H A ALA 224 ? ? 1.57 69 11 O A VAL 175 ? ? H A VAL 179 ? ? 1.58 70 11 H A GLY 130 ? ? O A VAL 160 ? ? 1.59 71 11 O A ILE 204 ? ? H A VAL 208 ? ? 1.59 72 12 HB3 A GLN 167 ? ? HB3 A SER 221 ? ? 1.01 73 12 HA A HIS 139 ? ? HE2 A TYR 149 ? ? 1.08 74 12 HD23 A LEU 124 ? ? HB A ILE 181 ? ? 1.18 75 12 HG11 A VAL 175 ? ? HB2 A CYS 213 ? ? 1.24 76 12 HG21 A VAL 175 ? ? HD11 A ILE 214 ? ? 1.31 77 12 HZ A PHE 140 ? ? HG12 A ILE 204 ? ? 1.32 78 12 HB3 A GLN 171 ? ? HA A TYR 217 ? ? 1.33 79 12 O A ILE 204 ? ? H A VAL 208 ? ? 1.54 80 13 HA A ALA 224 ? ? HG2 A ARG 227 ? ? 1.23 81 13 HG21 A VAL 175 ? ? HD11 A ILE 214 ? ? 1.26 82 13 HB3 A TYR 161 ? ? HD11 A ILE 181 ? ? 1.28 83 13 HE21 A GLN 216 ? ? HB2 A GLU 220 ? ? 1.31 84 13 HA A TYR 149 ? ? HB2 A ASN 152 ? ? 1.33 85 13 HA A VAL 160 ? ? HG1 A THR 182 ? ? 1.33 86 13 O A ILE 204 ? ? H A VAL 208 ? ? 1.58 87 13 O A VAL 175 ? ? H A VAL 179 ? ? 1.59 88 13 O A ILE 138 ? ? H A PHE 140 ? ? 1.60 89 14 HA A GLN 216 ? ? HG2 A GLN 219 ? ? 1.15 90 14 HG22 A VAL 175 ? ? HB3 A CYS 213 ? ? 1.26 91 14 HD21 A LEU 124 ? ? HB A ILE 181 ? ? 1.31 92 14 HE22 A GLN 171 ? ? HD1 A TYR 217 ? ? 1.34 93 14 O A ILE 204 ? ? H A VAL 208 ? ? 1.59 94 14 O A THR 198 ? ? H A ILE 202 ? ? 1.60 95 15 H A THR 198 ? ? HB2 A ASP 201 ? ? 1.04 96 15 HG23 A VAL 175 ? ? HB3 A CYS 213 ? ? 1.23 97 15 HG11 A VAL 179 ? ? HG22 A VAL 209 ? ? 1.24 98 15 HZ2 A LYS 193 ? ? OE1 A GLU 195 ? ? 1.55 99 15 O A VAL 175 ? ? H A VAL 179 ? ? 1.57 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 2 CE1 A TYR 156 ? ? CZ A TYR 156 ? ? 1.524 1.381 0.143 0.013 N 2 2 CZ A TYR 156 ? ? CE2 A TYR 156 ? ? 1.240 1.381 -0.141 0.013 N 3 2 CE1 A TYR 161 ? ? CZ A TYR 161 ? ? 1.278 1.381 -0.103 0.013 N 4 2 CZ A TYR 161 ? ? CE2 A TYR 161 ? ? 1.480 1.381 0.099 0.013 N 5 4 CE1 A TYR 127 ? ? CZ A TYR 127 ? ? 1.464 1.381 0.083 0.013 N 6 4 CZ A TYR 127 ? ? CE2 A TYR 127 ? ? 1.286 1.381 -0.095 0.013 N 7 15 CE1 A PHE 197 ? ? CZ A PHE 197 ? ? 1.500 1.369 0.131 0.019 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 131 ? ? -23.96 83.71 2 1 MET A 133 ? ? 42.55 -144.81 3 1 ARG A 135 ? ? 37.20 44.56 4 1 LEU A 137 ? ? 52.92 73.23 5 1 HIS A 139 ? ? 58.73 -25.86 6 1 PHE A 140 ? ? 74.85 -27.63 7 1 MET A 153 ? ? -67.43 1.46 8 1 ARG A 155 ? ? -158.01 -49.33 9 1 TYR A 156 ? ? -108.88 57.32 10 1 PRO A 157 ? ? -100.30 -164.51 11 1 GLN A 167 ? ? 68.92 -11.22 12 1 TYR A 168 ? ? 39.65 22.38 13 1 SER A 169 ? ? 49.88 14.43 14 1 ASN A 170 ? ? 177.81 76.71 15 1 VAL A 188 ? ? -143.40 -53.06 16 2 SER A 131 ? ? -25.60 82.75 17 2 MET A 133 ? ? 46.99 -102.73 18 2 SER A 134 ? ? -158.68 12.07 19 2 LEU A 137 ? ? 70.18 -53.72 20 2 ILE A 138 ? ? 56.96 2.10 21 2 HIS A 139 ? ? 65.04 -25.83 22 2 PHE A 140 ? ? 70.50 -3.52 23 2 MET A 153 ? ? -63.84 0.12 24 2 ARG A 155 ? ? -144.62 -49.12 25 2 TYR A 156 ? ? -110.89 56.02 26 2 ASP A 166 ? ? -77.40 38.29 27 2 TYR A 168 ? ? 38.70 -107.48 28 2 ASN A 170 ? ? 176.59 82.55 29 2 VAL A 188 ? ? -146.82 -46.31 30 3 SER A 131 ? ? -19.65 81.23 31 3 ALA A 132 ? ? 47.78 25.50 32 3 MET A 133 ? ? 51.94 -158.00 33 3 HIS A 139 ? ? 54.78 -5.88 34 3 PHE A 140 ? ? 67.79 -33.66 35 3 ARG A 155 ? ? -160.69 -41.03 36 3 TYR A 156 ? ? -112.99 56.48 37 3 ASN A 158 ? ? -95.83 51.80 38 3 ASP A 166 ? ? -80.49 42.96 39 3 GLN A 167 ? ? 56.73 94.16 40 3 ASN A 170 ? ? -155.10 51.31 41 3 VAL A 188 ? ? -151.82 -39.09 42 3 THR A 190 ? ? -140.07 -2.22 43 4 MET A 128 ? ? -33.33 128.80 44 4 SER A 131 ? ? -30.54 94.59 45 4 MET A 133 ? ? 44.46 -110.83 46 4 SER A 134 ? ? -149.48 23.53 47 4 ARG A 135 ? ? 33.03 46.51 48 4 HIS A 139 ? ? 59.18 -19.67 49 4 PHE A 140 ? ? 71.51 -17.81 50 4 ARG A 155 ? ? -162.31 -44.13 51 4 TYR A 156 ? ? -112.48 58.71 52 4 PRO A 157 ? ? -100.95 -165.77 53 4 ASN A 158 ? ? -99.31 32.78 54 4 GLN A 167 ? ? 167.75 74.44 55 4 ASN A 170 ? ? -147.81 30.99 56 4 VAL A 188 ? ? -144.19 -47.93 57 4 GLN A 222 ? ? -96.05 -65.60 58 5 MET A 128 ? ? -36.83 115.80 59 5 SER A 131 ? ? -23.93 82.29 60 5 MET A 133 ? ? 45.01 -149.13 61 5 PRO A 136 ? ? -24.43 -54.15 62 5 LEU A 137 ? ? 62.00 76.89 63 5 HIS A 139 ? ? 56.49 -28.01 64 5 PHE A 140 ? ? 67.42 -0.53 65 5 ARG A 155 ? ? -156.43 -44.58 66 5 TYR A 156 ? ? -110.56 58.92 67 5 PRO A 157 ? ? -101.48 -168.55 68 5 ASP A 166 ? ? -79.97 46.81 69 5 TYR A 168 ? ? 20.87 -102.46 70 5 ASN A 170 ? ? 176.44 87.35 71 5 VAL A 188 ? ? -144.02 -44.95 72 6 TYR A 127 ? ? -160.61 93.47 73 6 MET A 128 ? ? -37.83 122.56 74 6 SER A 131 ? ? -19.24 76.12 75 6 MET A 133 ? ? 48.43 -158.66 76 6 ARG A 135 ? ? 34.75 53.75 77 6 LEU A 137 ? ? 57.27 76.31 78 6 HIS A 139 ? ? 57.30 -27.81 79 6 PHE A 140 ? ? 72.22 -15.53 80 6 ARG A 155 ? ? -160.35 -42.35 81 6 TYR A 156 ? ? -112.17 56.83 82 6 ASN A 158 ? ? -98.80 57.00 83 6 ASP A 166 ? ? 96.21 -28.03 84 6 ASN A 170 ? ? -171.86 100.16 85 6 VAL A 188 ? ? -140.95 -17.28 86 6 THR A 190 ? ? -176.17 -22.34 87 6 THR A 192 ? ? 58.89 -9.49 88 6 LYS A 193 ? ? 150.30 -29.42 89 7 MET A 128 ? ? -50.01 108.02 90 7 SER A 131 ? ? -16.63 77.60 91 7 ALA A 132 ? ? 47.57 27.18 92 7 MET A 133 ? ? 48.18 -152.62 93 7 ARG A 135 ? ? 43.16 29.96 94 7 PRO A 136 ? ? -25.48 -52.75 95 7 HIS A 139 ? ? 45.25 70.61 96 7 PHE A 140 ? ? -37.85 -36.85 97 7 ARG A 155 ? ? -153.61 -44.34 98 7 TYR A 156 ? ? -114.84 59.33 99 7 PRO A 157 ? ? -103.24 -169.32 100 7 ASN A 158 ? ? -99.57 52.76 101 7 GLN A 167 ? ? 43.23 70.39 102 7 VAL A 188 ? ? -145.12 -37.54 103 7 GLN A 222 ? ? -96.20 -66.75 104 8 SER A 131 ? ? -23.92 82.14 105 8 MET A 133 ? ? 53.78 -165.08 106 8 ARG A 135 ? ? 36.13 57.08 107 8 LEU A 137 ? ? 48.05 77.94 108 8 HIS A 139 ? ? 65.76 -9.09 109 8 PHE A 140 ? ? 70.32 -7.25 110 8 MET A 153 ? ? -69.89 1.10 111 8 ARG A 155 ? ? -161.14 -49.64 112 8 TYR A 156 ? ? -108.24 61.30 113 8 ASN A 158 ? ? -100.01 47.10 114 8 ASP A 166 ? ? -84.56 43.29 115 8 GLN A 167 ? ? 52.98 97.54 116 8 ASN A 170 ? ? -154.41 36.42 117 8 VAL A 188 ? ? -145.16 -46.75 118 9 MET A 128 ? ? -35.20 111.51 119 9 SER A 131 ? ? -26.68 85.27 120 9 MET A 133 ? ? 51.66 -160.59 121 9 LEU A 137 ? ? 50.90 74.67 122 9 HIS A 139 ? ? 58.62 -26.33 123 9 PHE A 140 ? ? 73.81 -29.01 124 9 MET A 153 ? ? -65.29 1.18 125 9 ARG A 155 ? ? -154.12 -42.24 126 9 TYR A 156 ? ? -111.69 55.45 127 9 ASN A 158 ? ? -99.44 46.69 128 9 GLN A 167 ? ? 163.12 62.70 129 9 ASN A 170 ? ? -148.90 23.40 130 9 HIS A 176 ? ? -39.04 -37.90 131 9 VAL A 188 ? ? -150.87 -42.20 132 9 GLN A 222 ? ? -96.53 -65.61 133 10 SER A 131 ? ? 24.30 42.23 134 10 MET A 133 ? ? 54.39 -165.75 135 10 LEU A 137 ? ? 46.15 78.77 136 10 HIS A 139 ? ? 58.14 -29.13 137 10 PHE A 140 ? ? 71.51 -23.11 138 10 MET A 153 ? ? -67.37 0.56 139 10 ARG A 155 ? ? -154.99 -49.38 140 10 TYR A 156 ? ? -109.66 62.16 141 10 PRO A 157 ? ? -101.73 -168.42 142 10 ASN A 158 ? ? -108.71 66.51 143 10 GLN A 167 ? ? 37.84 60.74 144 10 THR A 187 ? ? -154.33 33.22 145 10 VAL A 188 ? ? -151.25 -39.61 146 11 SER A 131 ? ? -3.09 69.02 147 11 ALA A 132 ? ? 43.88 27.71 148 11 MET A 133 ? ? 50.22 -153.65 149 11 ARG A 135 ? ? 46.40 74.83 150 11 LEU A 137 ? ? 37.70 55.62 151 11 HIS A 139 ? ? -8.29 -36.11 152 11 PHE A 140 ? ? 80.97 -13.81 153 11 MET A 153 ? ? -67.24 1.83 154 11 ARG A 155 ? ? -154.82 -42.65 155 11 TYR A 156 ? ? -111.08 57.14 156 11 ASN A 158 ? ? -97.23 52.08 157 11 ASP A 166 ? ? -75.95 36.48 158 11 TYR A 168 ? ? 36.69 -109.98 159 11 ASN A 170 ? ? -170.36 91.72 160 11 VAL A 188 ? ? -145.49 -45.40 161 11 THR A 191 ? ? -67.78 2.78 162 12 TYR A 127 ? ? 71.34 94.14 163 12 MET A 128 ? ? -35.87 112.55 164 12 SER A 131 ? ? -25.48 83.40 165 12 MET A 133 ? ? 47.99 -153.39 166 12 ARG A 135 ? ? 53.62 71.01 167 12 HIS A 139 ? ? -44.62 -7.44 168 12 PHE A 140 ? ? 74.65 -21.98 169 12 ARG A 155 ? ? -159.63 -42.56 170 12 TYR A 156 ? ? -113.81 59.30 171 12 PRO A 157 ? ? -102.59 -163.96 172 12 ASP A 166 ? ? -77.59 44.86 173 12 GLN A 167 ? ? 63.28 -8.92 174 12 ASN A 170 ? ? -161.70 40.12 175 12 VAL A 188 ? ? -145.47 -42.34 176 13 SER A 131 ? ? -23.08 83.06 177 13 MET A 133 ? ? 46.78 -126.16 178 13 LEU A 137 ? ? 51.71 81.46 179 13 HIS A 139 ? ? 58.31 -34.27 180 13 PHE A 140 ? ? 68.96 -0.45 181 13 MET A 153 ? ? -68.93 0.71 182 13 ARG A 155 ? ? -155.07 -45.58 183 13 TYR A 156 ? ? -109.31 57.57 184 13 ASN A 158 ? ? -97.48 35.75 185 13 GLN A 167 ? ? 139.74 -7.99 186 13 TYR A 168 ? ? 54.97 2.99 187 13 SER A 169 ? ? 59.07 3.40 188 13 ASN A 170 ? ? -159.29 43.49 189 13 VAL A 188 ? ? -144.47 -31.42 190 13 THR A 190 ? ? -166.58 -77.15 191 13 THR A 191 ? ? 55.13 0.32 192 13 THR A 192 ? ? 66.27 -9.19 193 13 LYS A 193 ? ? 160.78 -32.00 194 14 SER A 131 ? ? -9.04 75.67 195 14 ALA A 132 ? ? 47.27 24.04 196 14 MET A 133 ? ? 50.88 -163.56 197 14 ARG A 135 ? ? 35.96 42.93 198 14 PRO A 136 ? ? -28.53 -52.57 199 14 LEU A 137 ? ? 56.77 70.23 200 14 HIS A 139 ? ? 59.20 -25.40 201 14 PHE A 140 ? ? 72.86 -21.95 202 14 MET A 153 ? ? -59.99 -1.24 203 14 ARG A 155 ? ? -142.70 -56.72 204 14 TYR A 156 ? ? -105.18 63.36 205 14 ASN A 158 ? ? -102.15 55.32 206 14 GLN A 167 ? ? 38.55 61.50 207 14 SER A 169 ? ? 71.50 -0.06 208 14 VAL A 188 ? ? -150.61 -34.13 209 14 THR A 190 ? ? 147.48 97.91 210 14 THR A 192 ? ? 65.49 -8.52 211 14 LYS A 193 ? ? 166.06 -37.02 212 14 GLN A 222 ? ? -96.46 -66.79 213 15 SER A 131 ? ? -19.67 81.47 214 15 MET A 133 ? ? 41.40 -106.61 215 15 SER A 134 ? ? -164.58 21.39 216 15 ARG A 135 ? ? 28.44 54.67 217 15 LEU A 137 ? ? 51.19 75.31 218 15 HIS A 139 ? ? 72.32 -26.90 219 15 PHE A 140 ? ? 78.21 -22.99 220 15 ARG A 155 ? ? -157.04 -49.04 221 15 TYR A 156 ? ? -108.03 59.18 222 15 ASP A 166 ? ? -81.16 37.16 223 15 SER A 169 ? ? 170.77 -34.88 224 15 VAL A 188 ? ? -146.69 -45.25 225 15 THR A 191 ? ? -67.28 0.14 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 TYR A 156 ? ? PRO A 157 ? ? -133.72 2 2 TYR A 156 ? ? PRO A 157 ? ? -130.66 3 3 TYR A 156 ? ? PRO A 157 ? ? -126.56 4 4 TYR A 156 ? ? PRO A 157 ? ? -131.09 5 5 TYR A 156 ? ? PRO A 157 ? ? -131.27 6 6 TYR A 156 ? ? PRO A 157 ? ? -128.37 7 7 TYR A 156 ? ? PRO A 157 ? ? -130.86 8 8 TYR A 156 ? ? PRO A 157 ? ? -134.64 9 9 TYR A 156 ? ? PRO A 157 ? ? -129.16 10 10 TYR A 156 ? ? PRO A 157 ? ? -134.34 11 11 TYR A 156 ? ? PRO A 157 ? ? -131.37 12 12 TYR A 156 ? ? PRO A 157 ? ? -129.46 13 13 TYR A 156 ? ? PRO A 157 ? ? -133.36 14 14 TYR A 156 ? ? PRO A 157 ? ? -132.18 15 14 THR A 189 ? ? THR A 190 ? ? -149.78 16 15 TYR A 156 ? ? PRO A 157 ? ? -135.75 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 2 TYR A 156 ? ? 0.065 'SIDE CHAIN' 2 11 TYR A 127 ? ? 0.061 'SIDE CHAIN' 3 14 TYR A 154 ? ? 0.050 'SIDE CHAIN' # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 15 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2JOH _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2JOH _pdbx_nmr_representative.selection_criteria 'closest to the average' # _pdbx_nmr_sample_details.contents '0.8 mM protein, 20 mM sodium acetate, 100% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '100% D2O' # _pdbx_nmr_exptl_sample.component 'sodium acetate' _pdbx_nmr_exptl_sample.concentration 20 _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling ? _pdbx_nmr_exptl_sample.solution_id 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 4.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298.13 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D CBCA(CO)NH' 1 2 1 '3D HNCACB' # _pdbx_nmr_refine.details ? _pdbx_nmr_refine.entry_id 2JOH _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal ;Linge, O'Donoghue and Nilges ; 'structure solution' ARIA ? 1 Goddard 'chemical shift assignment' Sparky ? 2 ;Linge, O'Donoghue and Nilges ; refinement ARIA ? 3 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 89 ? A MET 1 2 1 Y 1 A HIS 90 ? A HIS 2 3 1 Y 1 A GLN 91 ? A GLN 3 4 1 Y 1 A GLY 92 ? A GLY 4 5 1 Y 1 A GLY 93 ? A GLY 5 6 1 Y 1 A THR 94 ? A THR 6 7 1 Y 1 A HIS 95 ? A HIS 7 8 1 Y 1 A ASN 96 ? A ASN 8 9 1 Y 1 A GLN 97 ? A GLN 9 10 1 Y 1 A TRP 98 ? A TRP 10 11 1 Y 1 A GLY 99 ? A GLY 11 12 1 Y 1 A LYS 100 ? A LYS 12 13 1 Y 1 A PRO 101 ? A PRO 13 14 1 Y 1 A SER 102 ? A SER 14 15 1 Y 1 A LYS 103 ? A LYS 15 16 1 Y 1 A PRO 104 ? A PRO 16 17 1 Y 1 A LYS 105 ? A LYS 17 18 1 Y 1 A THR 106 ? A THR 18 19 1 Y 1 A SER 107 ? A SER 19 20 1 Y 1 A MET 108 ? A MET 20 21 1 Y 1 A LYS 109 ? A LYS 21 22 1 Y 1 A HIS 110 ? A HIS 22 23 1 Y 1 A VAL 111 ? A VAL 23 24 1 Y 1 A ALA 112 ? A ALA 24 25 1 Y 1 A GLY 113 ? A GLY 25 26 1 Y 1 A ALA 114 ? A ALA 26 27 1 Y 1 A ALA 115 ? A ALA 27 28 1 Y 1 A ALA 116 ? A ALA 28 29 1 Y 1 A ALA 117 ? A ALA 29 30 1 Y 1 A GLY 118 ? A GLY 30 31 1 Y 1 A ALA 119 ? A ALA 31 32 1 Y 1 A VAL 120 ? A VAL 32 33 1 Y 1 A VAL 121 ? A VAL 33 34 1 Y 1 A GLY 122 ? A GLY 34 35 1 Y 1 A GLY 123 ? A GLY 35 36 1 Y 1 A LEU 229 ? A LEU 141 37 1 Y 1 A GLU 230 ? A GLU 142 38 1 Y 1 A HIS 231 ? A HIS 143 39 1 Y 1 A HIS 232 ? A HIS 144 40 1 Y 1 A HIS 233 ? A HIS 145 41 1 Y 1 A HIS 234 ? A HIS 146 42 1 Y 1 A HIS 235 ? A HIS 147 43 1 Y 1 A HIS 236 ? A HIS 148 44 2 Y 1 A MET 89 ? A MET 1 45 2 Y 1 A HIS 90 ? A HIS 2 46 2 Y 1 A GLN 91 ? A GLN 3 47 2 Y 1 A GLY 92 ? A GLY 4 48 2 Y 1 A GLY 93 ? A GLY 5 49 2 Y 1 A THR 94 ? A THR 6 50 2 Y 1 A HIS 95 ? A HIS 7 51 2 Y 1 A ASN 96 ? A ASN 8 52 2 Y 1 A GLN 97 ? A GLN 9 53 2 Y 1 A TRP 98 ? A TRP 10 54 2 Y 1 A GLY 99 ? A GLY 11 55 2 Y 1 A LYS 100 ? A LYS 12 56 2 Y 1 A PRO 101 ? A PRO 13 57 2 Y 1 A SER 102 ? A SER 14 58 2 Y 1 A LYS 103 ? A LYS 15 59 2 Y 1 A PRO 104 ? A PRO 16 60 2 Y 1 A LYS 105 ? A LYS 17 61 2 Y 1 A THR 106 ? A THR 18 62 2 Y 1 A SER 107 ? A SER 19 63 2 Y 1 A MET 108 ? A MET 20 64 2 Y 1 A LYS 109 ? A LYS 21 65 2 Y 1 A HIS 110 ? A HIS 22 66 2 Y 1 A VAL 111 ? A VAL 23 67 2 Y 1 A ALA 112 ? A ALA 24 68 2 Y 1 A GLY 113 ? A GLY 25 69 2 Y 1 A ALA 114 ? A ALA 26 70 2 Y 1 A ALA 115 ? A ALA 27 71 2 Y 1 A ALA 116 ? A ALA 28 72 2 Y 1 A ALA 117 ? A ALA 29 73 2 Y 1 A GLY 118 ? A GLY 30 74 2 Y 1 A ALA 119 ? A ALA 31 75 2 Y 1 A VAL 120 ? A VAL 32 76 2 Y 1 A VAL 121 ? A VAL 33 77 2 Y 1 A GLY 122 ? A GLY 34 78 2 Y 1 A GLY 123 ? A GLY 35 79 2 Y 1 A LEU 229 ? A LEU 141 80 2 Y 1 A GLU 230 ? A GLU 142 81 2 Y 1 A HIS 231 ? A HIS 143 82 2 Y 1 A HIS 232 ? A HIS 144 83 2 Y 1 A HIS 233 ? A HIS 145 84 2 Y 1 A HIS 234 ? A HIS 146 85 2 Y 1 A HIS 235 ? A HIS 147 86 2 Y 1 A HIS 236 ? A HIS 148 87 3 Y 1 A MET 89 ? A MET 1 88 3 Y 1 A HIS 90 ? A HIS 2 89 3 Y 1 A GLN 91 ? A GLN 3 90 3 Y 1 A GLY 92 ? A GLY 4 91 3 Y 1 A GLY 93 ? A GLY 5 92 3 Y 1 A THR 94 ? A THR 6 93 3 Y 1 A HIS 95 ? A HIS 7 94 3 Y 1 A ASN 96 ? A ASN 8 95 3 Y 1 A GLN 97 ? A GLN 9 96 3 Y 1 A TRP 98 ? A TRP 10 97 3 Y 1 A GLY 99 ? A GLY 11 98 3 Y 1 A LYS 100 ? A LYS 12 99 3 Y 1 A PRO 101 ? A PRO 13 100 3 Y 1 A SER 102 ? A SER 14 101 3 Y 1 A LYS 103 ? A LYS 15 102 3 Y 1 A PRO 104 ? A PRO 16 103 3 Y 1 A LYS 105 ? A LYS 17 104 3 Y 1 A THR 106 ? A THR 18 105 3 Y 1 A SER 107 ? A SER 19 106 3 Y 1 A MET 108 ? A MET 20 107 3 Y 1 A LYS 109 ? A LYS 21 108 3 Y 1 A HIS 110 ? A HIS 22 109 3 Y 1 A VAL 111 ? A VAL 23 110 3 Y 1 A ALA 112 ? A ALA 24 111 3 Y 1 A GLY 113 ? A GLY 25 112 3 Y 1 A ALA 114 ? A ALA 26 113 3 Y 1 A ALA 115 ? A ALA 27 114 3 Y 1 A ALA 116 ? A ALA 28 115 3 Y 1 A ALA 117 ? A ALA 29 116 3 Y 1 A GLY 118 ? A GLY 30 117 3 Y 1 A ALA 119 ? A ALA 31 118 3 Y 1 A VAL 120 ? A VAL 32 119 3 Y 1 A VAL 121 ? A VAL 33 120 3 Y 1 A GLY 122 ? A GLY 34 121 3 Y 1 A GLY 123 ? A GLY 35 122 3 Y 1 A LEU 229 ? A LEU 141 123 3 Y 1 A GLU 230 ? A GLU 142 124 3 Y 1 A HIS 231 ? A HIS 143 125 3 Y 1 A HIS 232 ? A HIS 144 126 3 Y 1 A HIS 233 ? A HIS 145 127 3 Y 1 A HIS 234 ? A HIS 146 128 3 Y 1 A HIS 235 ? A HIS 147 129 3 Y 1 A HIS 236 ? A HIS 148 130 4 Y 1 A MET 89 ? A MET 1 131 4 Y 1 A HIS 90 ? A HIS 2 132 4 Y 1 A GLN 91 ? A GLN 3 133 4 Y 1 A GLY 92 ? A GLY 4 134 4 Y 1 A GLY 93 ? A GLY 5 135 4 Y 1 A THR 94 ? A THR 6 136 4 Y 1 A HIS 95 ? A HIS 7 137 4 Y 1 A ASN 96 ? A ASN 8 138 4 Y 1 A GLN 97 ? A GLN 9 139 4 Y 1 A TRP 98 ? A TRP 10 140 4 Y 1 A GLY 99 ? A GLY 11 141 4 Y 1 A LYS 100 ? A LYS 12 142 4 Y 1 A PRO 101 ? A PRO 13 143 4 Y 1 A SER 102 ? A SER 14 144 4 Y 1 A LYS 103 ? A LYS 15 145 4 Y 1 A PRO 104 ? A PRO 16 146 4 Y 1 A LYS 105 ? A LYS 17 147 4 Y 1 A THR 106 ? A THR 18 148 4 Y 1 A SER 107 ? A SER 19 149 4 Y 1 A MET 108 ? A MET 20 150 4 Y 1 A LYS 109 ? A LYS 21 151 4 Y 1 A HIS 110 ? A HIS 22 152 4 Y 1 A VAL 111 ? A VAL 23 153 4 Y 1 A ALA 112 ? A ALA 24 154 4 Y 1 A GLY 113 ? A GLY 25 155 4 Y 1 A ALA 114 ? A ALA 26 156 4 Y 1 A ALA 115 ? A ALA 27 157 4 Y 1 A ALA 116 ? A ALA 28 158 4 Y 1 A ALA 117 ? A ALA 29 159 4 Y 1 A GLY 118 ? A GLY 30 160 4 Y 1 A ALA 119 ? A ALA 31 161 4 Y 1 A VAL 120 ? A VAL 32 162 4 Y 1 A VAL 121 ? A VAL 33 163 4 Y 1 A GLY 122 ? A GLY 34 164 4 Y 1 A GLY 123 ? A GLY 35 165 4 Y 1 A LEU 229 ? A LEU 141 166 4 Y 1 A GLU 230 ? A GLU 142 167 4 Y 1 A HIS 231 ? A HIS 143 168 4 Y 1 A HIS 232 ? A HIS 144 169 4 Y 1 A HIS 233 ? A HIS 145 170 4 Y 1 A HIS 234 ? A HIS 146 171 4 Y 1 A HIS 235 ? A HIS 147 172 4 Y 1 A HIS 236 ? A HIS 148 173 5 Y 1 A MET 89 ? A MET 1 174 5 Y 1 A HIS 90 ? A HIS 2 175 5 Y 1 A GLN 91 ? A GLN 3 176 5 Y 1 A GLY 92 ? A GLY 4 177 5 Y 1 A GLY 93 ? A GLY 5 178 5 Y 1 A THR 94 ? A THR 6 179 5 Y 1 A HIS 95 ? A HIS 7 180 5 Y 1 A ASN 96 ? A ASN 8 181 5 Y 1 A GLN 97 ? A GLN 9 182 5 Y 1 A TRP 98 ? A TRP 10 183 5 Y 1 A GLY 99 ? A GLY 11 184 5 Y 1 A LYS 100 ? A LYS 12 185 5 Y 1 A PRO 101 ? A PRO 13 186 5 Y 1 A SER 102 ? A SER 14 187 5 Y 1 A LYS 103 ? A LYS 15 188 5 Y 1 A PRO 104 ? A PRO 16 189 5 Y 1 A LYS 105 ? A LYS 17 190 5 Y 1 A THR 106 ? A THR 18 191 5 Y 1 A SER 107 ? A SER 19 192 5 Y 1 A MET 108 ? A MET 20 193 5 Y 1 A LYS 109 ? A LYS 21 194 5 Y 1 A HIS 110 ? A HIS 22 195 5 Y 1 A VAL 111 ? A VAL 23 196 5 Y 1 A ALA 112 ? A ALA 24 197 5 Y 1 A GLY 113 ? A GLY 25 198 5 Y 1 A ALA 114 ? A ALA 26 199 5 Y 1 A ALA 115 ? A ALA 27 200 5 Y 1 A ALA 116 ? A ALA 28 201 5 Y 1 A ALA 117 ? A ALA 29 202 5 Y 1 A GLY 118 ? A GLY 30 203 5 Y 1 A ALA 119 ? A ALA 31 204 5 Y 1 A VAL 120 ? A VAL 32 205 5 Y 1 A VAL 121 ? A VAL 33 206 5 Y 1 A GLY 122 ? A GLY 34 207 5 Y 1 A GLY 123 ? A GLY 35 208 5 Y 1 A LEU 229 ? A LEU 141 209 5 Y 1 A GLU 230 ? A GLU 142 210 5 Y 1 A HIS 231 ? A HIS 143 211 5 Y 1 A HIS 232 ? A HIS 144 212 5 Y 1 A HIS 233 ? A HIS 145 213 5 Y 1 A HIS 234 ? A HIS 146 214 5 Y 1 A HIS 235 ? A HIS 147 215 5 Y 1 A HIS 236 ? A HIS 148 216 6 Y 1 A MET 89 ? A MET 1 217 6 Y 1 A HIS 90 ? A HIS 2 218 6 Y 1 A GLN 91 ? A GLN 3 219 6 Y 1 A GLY 92 ? A GLY 4 220 6 Y 1 A GLY 93 ? A GLY 5 221 6 Y 1 A THR 94 ? A THR 6 222 6 Y 1 A HIS 95 ? A HIS 7 223 6 Y 1 A ASN 96 ? A ASN 8 224 6 Y 1 A GLN 97 ? A GLN 9 225 6 Y 1 A TRP 98 ? A TRP 10 226 6 Y 1 A GLY 99 ? A GLY 11 227 6 Y 1 A LYS 100 ? A LYS 12 228 6 Y 1 A PRO 101 ? A PRO 13 229 6 Y 1 A SER 102 ? A SER 14 230 6 Y 1 A LYS 103 ? A LYS 15 231 6 Y 1 A PRO 104 ? A PRO 16 232 6 Y 1 A LYS 105 ? A LYS 17 233 6 Y 1 A THR 106 ? A THR 18 234 6 Y 1 A SER 107 ? A SER 19 235 6 Y 1 A MET 108 ? A MET 20 236 6 Y 1 A LYS 109 ? A LYS 21 237 6 Y 1 A HIS 110 ? A HIS 22 238 6 Y 1 A VAL 111 ? A VAL 23 239 6 Y 1 A ALA 112 ? A ALA 24 240 6 Y 1 A GLY 113 ? A GLY 25 241 6 Y 1 A ALA 114 ? A ALA 26 242 6 Y 1 A ALA 115 ? A ALA 27 243 6 Y 1 A ALA 116 ? A ALA 28 244 6 Y 1 A ALA 117 ? A ALA 29 245 6 Y 1 A GLY 118 ? A GLY 30 246 6 Y 1 A ALA 119 ? A ALA 31 247 6 Y 1 A VAL 120 ? A VAL 32 248 6 Y 1 A VAL 121 ? A VAL 33 249 6 Y 1 A GLY 122 ? A GLY 34 250 6 Y 1 A GLY 123 ? A GLY 35 251 6 Y 1 A LEU 229 ? A LEU 141 252 6 Y 1 A GLU 230 ? A GLU 142 253 6 Y 1 A HIS 231 ? A HIS 143 254 6 Y 1 A HIS 232 ? A HIS 144 255 6 Y 1 A HIS 233 ? A HIS 145 256 6 Y 1 A HIS 234 ? A HIS 146 257 6 Y 1 A HIS 235 ? A HIS 147 258 6 Y 1 A HIS 236 ? A HIS 148 259 7 Y 1 A MET 89 ? A MET 1 260 7 Y 1 A HIS 90 ? A HIS 2 261 7 Y 1 A GLN 91 ? A GLN 3 262 7 Y 1 A GLY 92 ? A GLY 4 263 7 Y 1 A GLY 93 ? A GLY 5 264 7 Y 1 A THR 94 ? A THR 6 265 7 Y 1 A HIS 95 ? A HIS 7 266 7 Y 1 A ASN 96 ? A ASN 8 267 7 Y 1 A GLN 97 ? A GLN 9 268 7 Y 1 A TRP 98 ? A TRP 10 269 7 Y 1 A GLY 99 ? A GLY 11 270 7 Y 1 A LYS 100 ? A LYS 12 271 7 Y 1 A PRO 101 ? A PRO 13 272 7 Y 1 A SER 102 ? A SER 14 273 7 Y 1 A LYS 103 ? A LYS 15 274 7 Y 1 A PRO 104 ? A PRO 16 275 7 Y 1 A LYS 105 ? A LYS 17 276 7 Y 1 A THR 106 ? A THR 18 277 7 Y 1 A SER 107 ? A SER 19 278 7 Y 1 A MET 108 ? A MET 20 279 7 Y 1 A LYS 109 ? A LYS 21 280 7 Y 1 A HIS 110 ? A HIS 22 281 7 Y 1 A VAL 111 ? A VAL 23 282 7 Y 1 A ALA 112 ? A ALA 24 283 7 Y 1 A GLY 113 ? A GLY 25 284 7 Y 1 A ALA 114 ? A ALA 26 285 7 Y 1 A ALA 115 ? A ALA 27 286 7 Y 1 A ALA 116 ? A ALA 28 287 7 Y 1 A ALA 117 ? A ALA 29 288 7 Y 1 A GLY 118 ? A GLY 30 289 7 Y 1 A ALA 119 ? A ALA 31 290 7 Y 1 A VAL 120 ? A VAL 32 291 7 Y 1 A VAL 121 ? A VAL 33 292 7 Y 1 A GLY 122 ? A GLY 34 293 7 Y 1 A GLY 123 ? A GLY 35 294 7 Y 1 A LEU 229 ? A LEU 141 295 7 Y 1 A GLU 230 ? A GLU 142 296 7 Y 1 A HIS 231 ? A HIS 143 297 7 Y 1 A HIS 232 ? A HIS 144 298 7 Y 1 A HIS 233 ? A HIS 145 299 7 Y 1 A HIS 234 ? A HIS 146 300 7 Y 1 A HIS 235 ? A HIS 147 301 7 Y 1 A HIS 236 ? A HIS 148 302 8 Y 1 A MET 89 ? A MET 1 303 8 Y 1 A HIS 90 ? A HIS 2 304 8 Y 1 A GLN 91 ? A GLN 3 305 8 Y 1 A GLY 92 ? A GLY 4 306 8 Y 1 A GLY 93 ? A GLY 5 307 8 Y 1 A THR 94 ? A THR 6 308 8 Y 1 A HIS 95 ? A HIS 7 309 8 Y 1 A ASN 96 ? A ASN 8 310 8 Y 1 A GLN 97 ? A GLN 9 311 8 Y 1 A TRP 98 ? A TRP 10 312 8 Y 1 A GLY 99 ? A GLY 11 313 8 Y 1 A LYS 100 ? A LYS 12 314 8 Y 1 A PRO 101 ? A PRO 13 315 8 Y 1 A SER 102 ? A SER 14 316 8 Y 1 A LYS 103 ? A LYS 15 317 8 Y 1 A PRO 104 ? A PRO 16 318 8 Y 1 A LYS 105 ? A LYS 17 319 8 Y 1 A THR 106 ? A THR 18 320 8 Y 1 A SER 107 ? A SER 19 321 8 Y 1 A MET 108 ? A MET 20 322 8 Y 1 A LYS 109 ? A LYS 21 323 8 Y 1 A HIS 110 ? A HIS 22 324 8 Y 1 A VAL 111 ? A VAL 23 325 8 Y 1 A ALA 112 ? A ALA 24 326 8 Y 1 A GLY 113 ? A GLY 25 327 8 Y 1 A ALA 114 ? A ALA 26 328 8 Y 1 A ALA 115 ? A ALA 27 329 8 Y 1 A ALA 116 ? A ALA 28 330 8 Y 1 A ALA 117 ? A ALA 29 331 8 Y 1 A GLY 118 ? A GLY 30 332 8 Y 1 A ALA 119 ? A ALA 31 333 8 Y 1 A VAL 120 ? A VAL 32 334 8 Y 1 A VAL 121 ? A VAL 33 335 8 Y 1 A GLY 122 ? A GLY 34 336 8 Y 1 A GLY 123 ? A GLY 35 337 8 Y 1 A LEU 229 ? A LEU 141 338 8 Y 1 A GLU 230 ? A GLU 142 339 8 Y 1 A HIS 231 ? A HIS 143 340 8 Y 1 A HIS 232 ? A HIS 144 341 8 Y 1 A HIS 233 ? A HIS 145 342 8 Y 1 A HIS 234 ? A HIS 146 343 8 Y 1 A HIS 235 ? A HIS 147 344 8 Y 1 A HIS 236 ? A HIS 148 345 9 Y 1 A MET 89 ? A MET 1 346 9 Y 1 A HIS 90 ? A HIS 2 347 9 Y 1 A GLN 91 ? A GLN 3 348 9 Y 1 A GLY 92 ? A GLY 4 349 9 Y 1 A GLY 93 ? A GLY 5 350 9 Y 1 A THR 94 ? A THR 6 351 9 Y 1 A HIS 95 ? A HIS 7 352 9 Y 1 A ASN 96 ? A ASN 8 353 9 Y 1 A GLN 97 ? A GLN 9 354 9 Y 1 A TRP 98 ? A TRP 10 355 9 Y 1 A GLY 99 ? A GLY 11 356 9 Y 1 A LYS 100 ? A LYS 12 357 9 Y 1 A PRO 101 ? A PRO 13 358 9 Y 1 A SER 102 ? A SER 14 359 9 Y 1 A LYS 103 ? A LYS 15 360 9 Y 1 A PRO 104 ? A PRO 16 361 9 Y 1 A LYS 105 ? A LYS 17 362 9 Y 1 A THR 106 ? A THR 18 363 9 Y 1 A SER 107 ? A SER 19 364 9 Y 1 A MET 108 ? A MET 20 365 9 Y 1 A LYS 109 ? A LYS 21 366 9 Y 1 A HIS 110 ? A HIS 22 367 9 Y 1 A VAL 111 ? A VAL 23 368 9 Y 1 A ALA 112 ? A ALA 24 369 9 Y 1 A GLY 113 ? A GLY 25 370 9 Y 1 A ALA 114 ? A ALA 26 371 9 Y 1 A ALA 115 ? A ALA 27 372 9 Y 1 A ALA 116 ? A ALA 28 373 9 Y 1 A ALA 117 ? A ALA 29 374 9 Y 1 A GLY 118 ? A GLY 30 375 9 Y 1 A ALA 119 ? A ALA 31 376 9 Y 1 A VAL 120 ? A VAL 32 377 9 Y 1 A VAL 121 ? A VAL 33 378 9 Y 1 A GLY 122 ? A GLY 34 379 9 Y 1 A GLY 123 ? A GLY 35 380 9 Y 1 A LEU 229 ? A LEU 141 381 9 Y 1 A GLU 230 ? A GLU 142 382 9 Y 1 A HIS 231 ? A HIS 143 383 9 Y 1 A HIS 232 ? A HIS 144 384 9 Y 1 A HIS 233 ? A HIS 145 385 9 Y 1 A HIS 234 ? A HIS 146 386 9 Y 1 A HIS 235 ? A HIS 147 387 9 Y 1 A HIS 236 ? A HIS 148 388 10 Y 1 A MET 89 ? A MET 1 389 10 Y 1 A HIS 90 ? A HIS 2 390 10 Y 1 A GLN 91 ? A GLN 3 391 10 Y 1 A GLY 92 ? A GLY 4 392 10 Y 1 A GLY 93 ? A GLY 5 393 10 Y 1 A THR 94 ? A THR 6 394 10 Y 1 A HIS 95 ? A HIS 7 395 10 Y 1 A ASN 96 ? A ASN 8 396 10 Y 1 A GLN 97 ? A GLN 9 397 10 Y 1 A TRP 98 ? A TRP 10 398 10 Y 1 A GLY 99 ? A GLY 11 399 10 Y 1 A LYS 100 ? A LYS 12 400 10 Y 1 A PRO 101 ? A PRO 13 401 10 Y 1 A SER 102 ? A SER 14 402 10 Y 1 A LYS 103 ? A LYS 15 403 10 Y 1 A PRO 104 ? A PRO 16 404 10 Y 1 A LYS 105 ? A LYS 17 405 10 Y 1 A THR 106 ? A THR 18 406 10 Y 1 A SER 107 ? A SER 19 407 10 Y 1 A MET 108 ? A MET 20 408 10 Y 1 A LYS 109 ? A LYS 21 409 10 Y 1 A HIS 110 ? A HIS 22 410 10 Y 1 A VAL 111 ? A VAL 23 411 10 Y 1 A ALA 112 ? A ALA 24 412 10 Y 1 A GLY 113 ? A GLY 25 413 10 Y 1 A ALA 114 ? A ALA 26 414 10 Y 1 A ALA 115 ? A ALA 27 415 10 Y 1 A ALA 116 ? A ALA 28 416 10 Y 1 A ALA 117 ? A ALA 29 417 10 Y 1 A GLY 118 ? A GLY 30 418 10 Y 1 A ALA 119 ? A ALA 31 419 10 Y 1 A VAL 120 ? A VAL 32 420 10 Y 1 A VAL 121 ? A VAL 33 421 10 Y 1 A GLY 122 ? A GLY 34 422 10 Y 1 A GLY 123 ? A GLY 35 423 10 Y 1 A LEU 229 ? A LEU 141 424 10 Y 1 A GLU 230 ? A GLU 142 425 10 Y 1 A HIS 231 ? A HIS 143 426 10 Y 1 A HIS 232 ? A HIS 144 427 10 Y 1 A HIS 233 ? A HIS 145 428 10 Y 1 A HIS 234 ? A HIS 146 429 10 Y 1 A HIS 235 ? A HIS 147 430 10 Y 1 A HIS 236 ? A HIS 148 431 11 Y 1 A MET 89 ? A MET 1 432 11 Y 1 A HIS 90 ? A HIS 2 433 11 Y 1 A GLN 91 ? A GLN 3 434 11 Y 1 A GLY 92 ? A GLY 4 435 11 Y 1 A GLY 93 ? A GLY 5 436 11 Y 1 A THR 94 ? A THR 6 437 11 Y 1 A HIS 95 ? A HIS 7 438 11 Y 1 A ASN 96 ? A ASN 8 439 11 Y 1 A GLN 97 ? A GLN 9 440 11 Y 1 A TRP 98 ? A TRP 10 441 11 Y 1 A GLY 99 ? A GLY 11 442 11 Y 1 A LYS 100 ? A LYS 12 443 11 Y 1 A PRO 101 ? A PRO 13 444 11 Y 1 A SER 102 ? A SER 14 445 11 Y 1 A LYS 103 ? A LYS 15 446 11 Y 1 A PRO 104 ? A PRO 16 447 11 Y 1 A LYS 105 ? A LYS 17 448 11 Y 1 A THR 106 ? A THR 18 449 11 Y 1 A SER 107 ? A SER 19 450 11 Y 1 A MET 108 ? A MET 20 451 11 Y 1 A LYS 109 ? A LYS 21 452 11 Y 1 A HIS 110 ? A HIS 22 453 11 Y 1 A VAL 111 ? A VAL 23 454 11 Y 1 A ALA 112 ? A ALA 24 455 11 Y 1 A GLY 113 ? A GLY 25 456 11 Y 1 A ALA 114 ? A ALA 26 457 11 Y 1 A ALA 115 ? A ALA 27 458 11 Y 1 A ALA 116 ? A ALA 28 459 11 Y 1 A ALA 117 ? A ALA 29 460 11 Y 1 A GLY 118 ? A GLY 30 461 11 Y 1 A ALA 119 ? A ALA 31 462 11 Y 1 A VAL 120 ? A VAL 32 463 11 Y 1 A VAL 121 ? A VAL 33 464 11 Y 1 A GLY 122 ? A GLY 34 465 11 Y 1 A GLY 123 ? A GLY 35 466 11 Y 1 A LEU 229 ? A LEU 141 467 11 Y 1 A GLU 230 ? A GLU 142 468 11 Y 1 A HIS 231 ? A HIS 143 469 11 Y 1 A HIS 232 ? A HIS 144 470 11 Y 1 A HIS 233 ? A HIS 145 471 11 Y 1 A HIS 234 ? A HIS 146 472 11 Y 1 A HIS 235 ? A HIS 147 473 11 Y 1 A HIS 236 ? A HIS 148 474 12 Y 1 A MET 89 ? A MET 1 475 12 Y 1 A HIS 90 ? A HIS 2 476 12 Y 1 A GLN 91 ? A GLN 3 477 12 Y 1 A GLY 92 ? A GLY 4 478 12 Y 1 A GLY 93 ? A GLY 5 479 12 Y 1 A THR 94 ? A THR 6 480 12 Y 1 A HIS 95 ? A HIS 7 481 12 Y 1 A ASN 96 ? A ASN 8 482 12 Y 1 A GLN 97 ? A GLN 9 483 12 Y 1 A TRP 98 ? A TRP 10 484 12 Y 1 A GLY 99 ? A GLY 11 485 12 Y 1 A LYS 100 ? A LYS 12 486 12 Y 1 A PRO 101 ? A PRO 13 487 12 Y 1 A SER 102 ? A SER 14 488 12 Y 1 A LYS 103 ? A LYS 15 489 12 Y 1 A PRO 104 ? A PRO 16 490 12 Y 1 A LYS 105 ? A LYS 17 491 12 Y 1 A THR 106 ? A THR 18 492 12 Y 1 A SER 107 ? A SER 19 493 12 Y 1 A MET 108 ? A MET 20 494 12 Y 1 A LYS 109 ? A LYS 21 495 12 Y 1 A HIS 110 ? A HIS 22 496 12 Y 1 A VAL 111 ? A VAL 23 497 12 Y 1 A ALA 112 ? A ALA 24 498 12 Y 1 A GLY 113 ? A GLY 25 499 12 Y 1 A ALA 114 ? A ALA 26 500 12 Y 1 A ALA 115 ? A ALA 27 501 12 Y 1 A ALA 116 ? A ALA 28 502 12 Y 1 A ALA 117 ? A ALA 29 503 12 Y 1 A GLY 118 ? A GLY 30 504 12 Y 1 A ALA 119 ? A ALA 31 505 12 Y 1 A VAL 120 ? A VAL 32 506 12 Y 1 A VAL 121 ? A VAL 33 507 12 Y 1 A GLY 122 ? A GLY 34 508 12 Y 1 A GLY 123 ? A GLY 35 509 12 Y 1 A LEU 229 ? A LEU 141 510 12 Y 1 A GLU 230 ? A GLU 142 511 12 Y 1 A HIS 231 ? A HIS 143 512 12 Y 1 A HIS 232 ? A HIS 144 513 12 Y 1 A HIS 233 ? A HIS 145 514 12 Y 1 A HIS 234 ? A HIS 146 515 12 Y 1 A HIS 235 ? A HIS 147 516 12 Y 1 A HIS 236 ? A HIS 148 517 13 Y 1 A MET 89 ? A MET 1 518 13 Y 1 A HIS 90 ? A HIS 2 519 13 Y 1 A GLN 91 ? A GLN 3 520 13 Y 1 A GLY 92 ? A GLY 4 521 13 Y 1 A GLY 93 ? A GLY 5 522 13 Y 1 A THR 94 ? A THR 6 523 13 Y 1 A HIS 95 ? A HIS 7 524 13 Y 1 A ASN 96 ? A ASN 8 525 13 Y 1 A GLN 97 ? A GLN 9 526 13 Y 1 A TRP 98 ? A TRP 10 527 13 Y 1 A GLY 99 ? A GLY 11 528 13 Y 1 A LYS 100 ? A LYS 12 529 13 Y 1 A PRO 101 ? A PRO 13 530 13 Y 1 A SER 102 ? A SER 14 531 13 Y 1 A LYS 103 ? A LYS 15 532 13 Y 1 A PRO 104 ? A PRO 16 533 13 Y 1 A LYS 105 ? A LYS 17 534 13 Y 1 A THR 106 ? A THR 18 535 13 Y 1 A SER 107 ? A SER 19 536 13 Y 1 A MET 108 ? A MET 20 537 13 Y 1 A LYS 109 ? A LYS 21 538 13 Y 1 A HIS 110 ? A HIS 22 539 13 Y 1 A VAL 111 ? A VAL 23 540 13 Y 1 A ALA 112 ? A ALA 24 541 13 Y 1 A GLY 113 ? A GLY 25 542 13 Y 1 A ALA 114 ? A ALA 26 543 13 Y 1 A ALA 115 ? A ALA 27 544 13 Y 1 A ALA 116 ? A ALA 28 545 13 Y 1 A ALA 117 ? A ALA 29 546 13 Y 1 A GLY 118 ? A GLY 30 547 13 Y 1 A ALA 119 ? A ALA 31 548 13 Y 1 A VAL 120 ? A VAL 32 549 13 Y 1 A VAL 121 ? A VAL 33 550 13 Y 1 A GLY 122 ? A GLY 34 551 13 Y 1 A GLY 123 ? A GLY 35 552 13 Y 1 A LEU 229 ? A LEU 141 553 13 Y 1 A GLU 230 ? A GLU 142 554 13 Y 1 A HIS 231 ? A HIS 143 555 13 Y 1 A HIS 232 ? A HIS 144 556 13 Y 1 A HIS 233 ? A HIS 145 557 13 Y 1 A HIS 234 ? A HIS 146 558 13 Y 1 A HIS 235 ? A HIS 147 559 13 Y 1 A HIS 236 ? A HIS 148 560 14 Y 1 A MET 89 ? A MET 1 561 14 Y 1 A HIS 90 ? A HIS 2 562 14 Y 1 A GLN 91 ? A GLN 3 563 14 Y 1 A GLY 92 ? A GLY 4 564 14 Y 1 A GLY 93 ? A GLY 5 565 14 Y 1 A THR 94 ? A THR 6 566 14 Y 1 A HIS 95 ? A HIS 7 567 14 Y 1 A ASN 96 ? A ASN 8 568 14 Y 1 A GLN 97 ? A GLN 9 569 14 Y 1 A TRP 98 ? A TRP 10 570 14 Y 1 A GLY 99 ? A GLY 11 571 14 Y 1 A LYS 100 ? A LYS 12 572 14 Y 1 A PRO 101 ? A PRO 13 573 14 Y 1 A SER 102 ? A SER 14 574 14 Y 1 A LYS 103 ? A LYS 15 575 14 Y 1 A PRO 104 ? A PRO 16 576 14 Y 1 A LYS 105 ? A LYS 17 577 14 Y 1 A THR 106 ? A THR 18 578 14 Y 1 A SER 107 ? A SER 19 579 14 Y 1 A MET 108 ? A MET 20 580 14 Y 1 A LYS 109 ? A LYS 21 581 14 Y 1 A HIS 110 ? A HIS 22 582 14 Y 1 A VAL 111 ? A VAL 23 583 14 Y 1 A ALA 112 ? A ALA 24 584 14 Y 1 A GLY 113 ? A GLY 25 585 14 Y 1 A ALA 114 ? A ALA 26 586 14 Y 1 A ALA 115 ? A ALA 27 587 14 Y 1 A ALA 116 ? A ALA 28 588 14 Y 1 A ALA 117 ? A ALA 29 589 14 Y 1 A GLY 118 ? A GLY 30 590 14 Y 1 A ALA 119 ? A ALA 31 591 14 Y 1 A VAL 120 ? A VAL 32 592 14 Y 1 A VAL 121 ? A VAL 33 593 14 Y 1 A GLY 122 ? A GLY 34 594 14 Y 1 A GLY 123 ? A GLY 35 595 14 Y 1 A LEU 229 ? A LEU 141 596 14 Y 1 A GLU 230 ? A GLU 142 597 14 Y 1 A HIS 231 ? A HIS 143 598 14 Y 1 A HIS 232 ? A HIS 144 599 14 Y 1 A HIS 233 ? A HIS 145 600 14 Y 1 A HIS 234 ? A HIS 146 601 14 Y 1 A HIS 235 ? A HIS 147 602 14 Y 1 A HIS 236 ? A HIS 148 603 15 Y 1 A MET 89 ? A MET 1 604 15 Y 1 A HIS 90 ? A HIS 2 605 15 Y 1 A GLN 91 ? A GLN 3 606 15 Y 1 A GLY 92 ? A GLY 4 607 15 Y 1 A GLY 93 ? A GLY 5 608 15 Y 1 A THR 94 ? A THR 6 609 15 Y 1 A HIS 95 ? A HIS 7 610 15 Y 1 A ASN 96 ? A ASN 8 611 15 Y 1 A GLN 97 ? A GLN 9 612 15 Y 1 A TRP 98 ? A TRP 10 613 15 Y 1 A GLY 99 ? A GLY 11 614 15 Y 1 A LYS 100 ? A LYS 12 615 15 Y 1 A PRO 101 ? A PRO 13 616 15 Y 1 A SER 102 ? A SER 14 617 15 Y 1 A LYS 103 ? A LYS 15 618 15 Y 1 A PRO 104 ? A PRO 16 619 15 Y 1 A LYS 105 ? A LYS 17 620 15 Y 1 A THR 106 ? A THR 18 621 15 Y 1 A SER 107 ? A SER 19 622 15 Y 1 A MET 108 ? A MET 20 623 15 Y 1 A LYS 109 ? A LYS 21 624 15 Y 1 A HIS 110 ? A HIS 22 625 15 Y 1 A VAL 111 ? A VAL 23 626 15 Y 1 A ALA 112 ? A ALA 24 627 15 Y 1 A GLY 113 ? A GLY 25 628 15 Y 1 A ALA 114 ? A ALA 26 629 15 Y 1 A ALA 115 ? A ALA 27 630 15 Y 1 A ALA 116 ? A ALA 28 631 15 Y 1 A ALA 117 ? A ALA 29 632 15 Y 1 A GLY 118 ? A GLY 30 633 15 Y 1 A ALA 119 ? A ALA 31 634 15 Y 1 A VAL 120 ? A VAL 32 635 15 Y 1 A VAL 121 ? A VAL 33 636 15 Y 1 A GLY 122 ? A GLY 34 637 15 Y 1 A GLY 123 ? A GLY 35 638 15 Y 1 A LEU 229 ? A LEU 141 639 15 Y 1 A GLU 230 ? A GLU 142 640 15 Y 1 A HIS 231 ? A HIS 143 641 15 Y 1 A HIS 232 ? A HIS 144 642 15 Y 1 A HIS 233 ? A HIS 145 643 15 Y 1 A HIS 234 ? A HIS 146 644 15 Y 1 A HIS 235 ? A HIS 147 645 15 Y 1 A HIS 236 ? A HIS 148 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Varian INOVA' # _atom_sites.entry_id 2JOH _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_