data_2JOQ # _entry.id 2JOQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2JOQ pdb_00002joq 10.2210/pdb2joq/pdb RCSB RCSB100098 ? ? WWPDB D_1000100098 ? ? BMRB 15190 ? 10.13018/BMR15190 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-04-03 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2012-01-18 5 'Structure model' 1 4 2020-02-05 6 'Structure model' 1 5 2023-06-14 7 'Structure model' 1 6 2023-12-20 8 'Structure model' 1 7 2024-05-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 5 'Structure model' 'Data collection' 5 5 'Structure model' 'Database references' 6 5 'Structure model' Other 7 6 'Structure model' 'Database references' 8 6 'Structure model' Other 9 7 'Structure model' 'Data collection' 10 7 'Structure model' Other 11 8 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 5 'Structure model' database_2 2 5 'Structure model' pdbx_database_status 3 5 'Structure model' pdbx_nmr_software 4 5 'Structure model' pdbx_nmr_spectrometer 5 5 'Structure model' struct_ref_seq_dif 6 6 'Structure model' database_2 7 6 'Structure model' pdbx_database_status 8 7 'Structure model' chem_comp_atom 9 7 'Structure model' chem_comp_bond 10 7 'Structure model' pdbx_database_status 11 8 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 5 'Structure model' '_pdbx_database_status.status_code_cs' 2 5 'Structure model' '_pdbx_nmr_software.name' 3 5 'Structure model' '_pdbx_nmr_spectrometer.model' 4 5 'Structure model' '_struct_ref_seq_dif.details' 5 6 'Structure model' '_database_2.pdbx_DOI' 6 6 'Structure model' '_database_2.pdbx_database_accession' 7 6 'Structure model' '_pdbx_database_status.status_code_nmr_data' 8 7 'Structure model' '_pdbx_database_status.deposit_site' 9 8 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site RCSB _pdbx_database_status.entry_id 2JOQ _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2007-03-19 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.content_type PT2 TargetDB . unspecified 15190 BMRB . unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Gutmanas, A.' 1 'Lemak, A.' 2 'Yee, A.' 3 'Karra, M.' 4 'Srisailam, S.' 5 'Semesi, A.' 6 'Arrowsmith, C.H.' 7 'Northeast Structural Genomics Consortium (NESG)' 8 'Ontario Centre for Structural Proteomics (OCSP)' 9 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Solution Structure of Protein HP0495 from H. pylori' 'To be Published' ? ? ? ? ? ? ? 0353 ? ? ? 1 'A novel strategy for NMR resonance assignment and protein structure determination.' J.Biomol.Nmr 49 27 38 2011 JBNME9 NE 0925-2738 0800 ? 21161328 10.1007/s10858-010-9458-0 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gutmanas, A.' 1 ? primary 'Lemak, A.' 2 ? primary 'Yee, A.' 3 ? primary 'Karra, M.' 4 ? primary 'Srisailam, S.' 5 ? primary 'Semesi, A.' 6 ? primary 'Arrowsmith, C.H.' 7 ? 1 'Lemak, A.' 8 ? 1 'Gutmanas, A.' 9 ? 1 'Chitayat, S.' 10 ? 1 'Karra, M.' 11 ? 1 'Fares, C.' 12 ? 1 'Sunnerhagen, M.' 13 ? 1 'Arrowsmith, C.H.' 14 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Hypothetical protein HP_0495' _entity.formula_weight 10673.146 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;QGHMPSDSKKPTIIYPCLWDYRVIMTTKDTSTLKELLETYQRPFKLEFKNTSKNAKFYSFNVSMEVSNESERNEIFQKIS QLDKVVQTLGS ; _entity_poly.pdbx_seq_one_letter_code_can ;QGHMPSDSKKPTIIYPCLWDYRVIMTTKDTSTLKELLETYQRPFKLEFKNTSKNAKFYSFNVSMEVSNESERNEIFQKIS QLDKVVQTLGS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier PT2 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLN n 1 2 GLY n 1 3 HIS n 1 4 MET n 1 5 PRO n 1 6 SER n 1 7 ASP n 1 8 SER n 1 9 LYS n 1 10 LYS n 1 11 PRO n 1 12 THR n 1 13 ILE n 1 14 ILE n 1 15 TYR n 1 16 PRO n 1 17 CYS n 1 18 LEU n 1 19 TRP n 1 20 ASP n 1 21 TYR n 1 22 ARG n 1 23 VAL n 1 24 ILE n 1 25 MET n 1 26 THR n 1 27 THR n 1 28 LYS n 1 29 ASP n 1 30 THR n 1 31 SER n 1 32 THR n 1 33 LEU n 1 34 LYS n 1 35 GLU n 1 36 LEU n 1 37 LEU n 1 38 GLU n 1 39 THR n 1 40 TYR n 1 41 GLN n 1 42 ARG n 1 43 PRO n 1 44 PHE n 1 45 LYS n 1 46 LEU n 1 47 GLU n 1 48 PHE n 1 49 LYS n 1 50 ASN n 1 51 THR n 1 52 SER n 1 53 LYS n 1 54 ASN n 1 55 ALA n 1 56 LYS n 1 57 PHE n 1 58 TYR n 1 59 SER n 1 60 PHE n 1 61 ASN n 1 62 VAL n 1 63 SER n 1 64 MET n 1 65 GLU n 1 66 VAL n 1 67 SER n 1 68 ASN n 1 69 GLU n 1 70 SER n 1 71 GLU n 1 72 ARG n 1 73 ASN n 1 74 GLU n 1 75 ILE n 1 76 PHE n 1 77 GLN n 1 78 LYS n 1 79 ILE n 1 80 SER n 1 81 GLN n 1 82 LEU n 1 83 ASP n 1 84 LYS n 1 85 VAL n 1 86 VAL n 1 87 GLN n 1 88 THR n 1 89 LEU n 1 90 GLY n 1 91 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Helicobacter _entity_src_gen.pdbx_gene_src_gene HP0495 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Helicobacter pylori' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 210 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 DE3 (gold)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector p11 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLN 1 1 1 GLN GLN A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 MET 4 4 4 MET MET A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 TYR 15 15 15 TYR TYR A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 CYS 17 17 17 CYS CYS A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 TRP 19 19 19 TRP TRP A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 MET 25 25 25 MET MET A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 PHE 44 44 44 PHE PHE A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 PHE 48 48 48 PHE PHE A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 PHE 57 57 57 PHE PHE A . n A 1 58 TYR 58 58 58 TYR TYR A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 PHE 60 60 60 PHE PHE A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 MET 64 64 64 MET MET A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 ASN 73 73 73 ASN ASN A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 PHE 76 76 76 PHE PHE A . n A 1 77 GLN 77 77 77 GLN GLN A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 GLN 81 81 81 GLN GLN A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 GLN 87 87 87 GLN GLN A . n A 1 88 THR 88 88 88 THR THR A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 SER 91 91 91 SER SER A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2JOQ _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 2JOQ _struct.title ;Solution Structure of Protein HP0495 from H. pylori; Northeast structural genomics consortium target PT2; Ontario Centre for Structural Proteomics target HP0488 ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2JOQ _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;HP0495, structural genomics, non-uniform sampling, ABACUS, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, Ontario Centre for Structural Proteomics, OCSP, UNKNOWN FUNCTION ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Y495_HELPY _struct_ref.pdbx_db_accession O25237 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MPSDSKKPTIIYPCLWDYRVIMTTKDTSTLKELLETYQRPFKLEFKNTSKNAKFYSFNVSMEVSNESERNEIFQKISQLD KVVQTL ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2JOQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 89 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O25237 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 86 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 89 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2JOQ GLN A 1 ? UNP O25237 ? ? 'cloning artifact' 1 1 1 2JOQ GLY A 2 ? UNP O25237 ? ? 'cloning artifact' 2 2 1 2JOQ HIS A 3 ? UNP O25237 ? ? 'cloning artifact' 3 3 1 2JOQ GLY A 90 ? UNP O25237 ? ? 'cloning artifact' 90 4 1 2JOQ SER A 91 ? UNP O25237 ? ? 'cloning artifact' 91 5 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 31 ? THR A 39 ? SER A 31 THR A 39 1 ? 9 HELX_P HELX_P2 2 ASN A 68 ? SER A 80 ? ASN A 68 SER A 80 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 TYR 15 A . ? TYR 15 A PRO 16 A ? PRO 16 A 1 -0.87 2 TYR 15 A . ? TYR 15 A PRO 16 A ? PRO 16 A 2 -1.48 3 TYR 15 A . ? TYR 15 A PRO 16 A ? PRO 16 A 3 0.53 4 TYR 15 A . ? TYR 15 A PRO 16 A ? PRO 16 A 4 -0.31 5 TYR 15 A . ? TYR 15 A PRO 16 A ? PRO 16 A 5 0.95 6 TYR 15 A . ? TYR 15 A PRO 16 A ? PRO 16 A 6 -0.82 7 TYR 15 A . ? TYR 15 A PRO 16 A ? PRO 16 A 7 1.66 8 TYR 15 A . ? TYR 15 A PRO 16 A ? PRO 16 A 8 -1.45 9 TYR 15 A . ? TYR 15 A PRO 16 A ? PRO 16 A 9 4.29 10 TYR 15 A . ? TYR 15 A PRO 16 A ? PRO 16 A 10 0.99 11 TYR 15 A . ? TYR 15 A PRO 16 A ? PRO 16 A 11 0.18 12 TYR 15 A . ? TYR 15 A PRO 16 A ? PRO 16 A 12 1.03 13 TYR 15 A . ? TYR 15 A PRO 16 A ? PRO 16 A 13 1.11 14 TYR 15 A . ? TYR 15 A PRO 16 A ? PRO 16 A 14 1.52 15 TYR 15 A . ? TYR 15 A PRO 16 A ? PRO 16 A 15 -0.91 16 TYR 15 A . ? TYR 15 A PRO 16 A ? PRO 16 A 16 -1.01 17 TYR 15 A . ? TYR 15 A PRO 16 A ? PRO 16 A 17 -1.44 18 TYR 15 A . ? TYR 15 A PRO 16 A ? PRO 16 A 18 -0.80 19 TYR 15 A . ? TYR 15 A PRO 16 A ? PRO 16 A 19 0.71 20 TYR 15 A . ? TYR 15 A PRO 16 A ? PRO 16 A 20 -3.93 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 44 ? THR A 51 ? PHE A 44 THR A 51 A 2 TYR A 58 ? VAL A 66 ? TYR A 58 VAL A 66 A 3 CYS A 17 ? MET A 25 ? CYS A 17 MET A 25 A 4 VAL A 85 ? LEU A 89 ? VAL A 85 LEU A 89 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ASN A 50 ? N ASN A 50 O SER A 59 ? O SER A 59 A 2 3 O VAL A 62 ? O VAL A 62 N TYR A 21 ? N TYR A 21 A 3 4 N ILE A 24 ? N ILE A 24 O VAL A 86 ? O VAL A 86 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 5 ? ? -62.10 -178.50 2 1 ASP A 83 ? ? 77.33 -36.64 3 2 THR A 26 ? ? -86.72 42.23 4 2 SER A 31 ? ? -130.58 -62.73 5 2 LYS A 49 ? ? -69.30 -81.82 6 2 ALA A 55 ? ? 59.85 19.95 7 2 ASN A 68 ? ? -170.95 -178.46 8 2 ASP A 83 ? ? 72.95 -33.20 9 3 PRO A 5 ? ? -52.50 99.01 10 3 SER A 31 ? ? -146.47 -53.59 11 3 ASP A 83 ? ? 73.42 -40.09 12 4 SER A 31 ? ? -137.65 -63.52 13 4 LYS A 49 ? ? -76.85 -80.11 14 4 ASP A 83 ? ? 71.93 -38.90 15 5 PRO A 5 ? ? -69.53 93.55 16 5 LYS A 10 ? ? 74.36 127.21 17 5 SER A 31 ? ? -124.76 -66.73 18 5 GLN A 41 ? ? 65.32 -3.27 19 5 ASP A 83 ? ? 74.38 -27.48 20 6 SER A 31 ? ? -126.39 -63.96 21 6 LYS A 49 ? ? -75.33 -70.94 22 6 ASP A 83 ? ? 72.37 -39.45 23 7 SER A 31 ? ? -130.51 -66.64 24 7 ASP A 83 ? ? 73.16 -37.00 25 8 LYS A 10 ? ? 68.96 127.04 26 8 SER A 31 ? ? -123.39 -64.87 27 8 ALA A 55 ? ? 74.25 -38.32 28 8 ASP A 83 ? ? 74.24 -34.62 29 9 SER A 31 ? ? -137.72 -59.75 30 9 LYS A 49 ? ? -82.95 -71.19 31 9 ASP A 83 ? ? 72.57 -32.13 32 10 LYS A 10 ? ? 68.11 142.90 33 10 SER A 31 ? ? -145.17 -70.62 34 10 LYS A 49 ? ? -81.87 -77.45 35 10 SER A 52 ? ? -64.42 87.94 36 10 LYS A 53 ? ? 35.08 -71.23 37 10 ASP A 83 ? ? 73.24 -40.64 38 11 SER A 8 ? ? -84.57 47.58 39 11 LYS A 49 ? ? -90.61 -73.88 40 11 SER A 52 ? ? -59.29 170.11 41 11 ASP A 83 ? ? 73.31 -42.93 42 12 LYS A 10 ? ? 70.77 151.60 43 12 THR A 26 ? ? -88.37 33.97 44 12 SER A 31 ? ? -111.94 -77.49 45 12 ALA A 55 ? ? 58.23 17.51 46 12 ASP A 83 ? ? 73.18 -37.65 47 13 THR A 26 ? ? -94.91 32.10 48 13 SER A 31 ? ? -125.89 -64.08 49 13 SER A 52 ? ? -69.27 86.26 50 13 LYS A 53 ? ? 47.00 -82.36 51 13 ASP A 83 ? ? 74.39 -36.95 52 14 PRO A 5 ? ? -65.81 95.31 53 14 LYS A 9 ? ? 66.57 95.56 54 14 SER A 31 ? ? -104.33 -60.80 55 14 ASP A 83 ? ? 73.02 -34.59 56 15 SER A 6 ? ? -57.30 94.02 57 15 ASN A 68 ? ? -164.53 -167.22 58 15 ASP A 83 ? ? 75.82 -32.87 59 16 PRO A 5 ? ? -52.81 96.41 60 16 LYS A 10 ? ? 68.15 150.29 61 16 SER A 31 ? ? -128.25 -64.38 62 16 LYS A 49 ? ? -105.05 -73.17 63 16 ASP A 83 ? ? 73.36 -47.49 64 17 SER A 8 ? ? -141.90 -25.74 65 17 LYS A 10 ? ? 66.35 78.14 66 17 SER A 31 ? ? -124.77 -62.65 67 17 SER A 52 ? ? -58.28 -179.61 68 17 ASP A 83 ? ? 71.92 -42.32 69 18 PRO A 5 ? ? -48.91 100.51 70 18 LYS A 9 ? ? -59.82 102.75 71 18 SER A 31 ? ? -122.93 -73.60 72 18 LYS A 53 ? ? 47.26 -80.16 73 18 ASP A 83 ? ? 72.55 -31.18 74 19 LYS A 9 ? ? -114.35 -167.80 75 19 LYS A 10 ? ? 73.62 137.25 76 19 SER A 31 ? ? -133.02 -53.37 77 19 ASP A 83 ? ? 71.92 -35.18 78 20 PRO A 5 ? ? -61.31 -179.64 79 20 SER A 6 ? ? -63.90 84.81 80 20 LYS A 10 ? ? 58.15 77.08 81 20 SER A 31 ? ? -138.34 -54.35 82 20 ASP A 83 ? ? 73.71 -37.18 # loop_ _pdbx_SG_project.full_name_of_center _pdbx_SG_project.id _pdbx_SG_project.initial_of_center _pdbx_SG_project.project_name 'Northeast Structural Genomics Consortium' 1 NESG 'PSI, Protein Structure Initiative' 'Ontario Centre for Structural Proteomics' 2 OCSP ? # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2JOQ _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2JOQ _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '0.5 mM [U-13C; U-15N] HP0495, 10 mM TRIS, 300 mM sodium chloride, 1 mM benzamidine, 10 mM DTT, 0.01 % sodium azide, 95% H2O/5% D2O' 1 '95% H2O/5% D2O' '0.5 mM [U-13C; U-15N] HP0495, 10 mM TRIS, 300 mM sodium chloride, 1 mM benzamidine, 10 mM DTT, 0.01 % sodium azide, 100% D2O' 2 '100% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id HP0495 0.5 mM '[U-13C; U-15N]' 1 TRIS 10 mM ? 1 'sodium chloride' 300 mM ? 1 benzamidine 1 mM ? 1 DTT 10 mM ? 1 'sodium azide' 0.01 % ? 1 HP0495 0.5 mM '[U-13C; U-15N]' 2 TRIS 10 mM ? 2 'sodium chloride' 300 mM ? 2 benzamidine 1 mM ? 2 DTT 10 mM ? 2 'sodium azide' 0.01 % ? 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 300 _pdbx_nmr_exptl_sample_conditions.pH 7 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D HNCO sparse' 1 5 1 '3D HNCA sparse' 1 6 1 '3D H(CCCO)NH-TOCSY sparse' 1 7 1 '3D (H)C(CCO)NH-TOCSY' 1 8 1 '4D HBHACBCA(CO)NH PR' 1 9 1 '4D HC(CCO)NH-TOCSY PR' 1 10 1 '3D 1H-15N NOESY sparse' 1 11 1 '3D 1H-13C NOESY aliphatic' 1 12 2 '3D H(C)CH-TOCSY sparse' 1 13 2 '3D (H)CCH-TOCSY sparse' 1 14 1 '3D 1H-13C NOESY aromatic' 1 15 2 '3D 1H-13C NOESY sparse' 1 16 2 '3D H(C)CH-TOCSY aromatic, sparse' 1 17 2 '3D (H)CCH-TOCSY aromatic' 1 18 2 '2D CT 1H-13C HSQC' 1 19 2 '2D CT 1H-13C HSQC aromatic' # _pdbx_nmr_details.entry_id 2JOQ _pdbx_nmr_details.text ;Both 4D experiments were collected as 2D projection planes and processed with PR experiments marked "sparse" were collected with non-uniform sampling and processed with MDD ; # _pdbx_nmr_refine.details 'water refinement with CNS' _pdbx_nmr_refine.entry_id 2JOQ _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS 1.1 1 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 2 Goddard 'peak picking' Sparky ? 3 'Cornilescu, Delaglio and Bax' 'dihedral angle constraints prediction' TALOS ? 4 'A. Lemak, A. Grishaev, M. Llinas, CH Arrowsmith' 'chemical shift and noe assignment' ABACUS ? 5 'A. Gutmanas, CH Arrowsmith, I Ibraghimov, V Yu Orekhov' 'processing of non-uniformly sampled data' MDD/MDDgui ? 6 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 7 'M Karra, CH Arrowsmith' 'processing of projection-reconstruction spectra' PR ? 8 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Bruker AVANCE 1 'Bruker Avance' 600 Bruker AVANCE 2 'Bruker Avance' 800 Bruker AVANCE 3 'Bruker Avance' 500 Varian INOVA 4 'Varian INOVA' # _atom_sites.entry_id 2JOQ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_