data_2JR7 # _entry.id 2JR7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2JR7 pdb_00002jr7 10.2210/pdb2jr7/pdb RCSB RCSB100187 ? ? WWPDB D_1000100187 ? ? BMRB 15377 ? 10.13018/BMR15377 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-03-25 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-19 4 'Structure model' 1 3 2021-10-20 5 'Structure model' 1 4 2023-06-14 6 'Structure model' 1 5 2023-12-20 7 'Structure model' 1 6 2024-05-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' Other 6 4 'Structure model' 'Database references' 7 4 'Structure model' 'Derived calculations' 8 5 'Structure model' Other 9 6 'Structure model' 'Data collection' 10 6 'Structure model' Other 11 7 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_ref_seq_dif 7 4 'Structure model' database_2 8 4 'Structure model' struct_ref_seq_dif 9 4 'Structure model' struct_site 10 5 'Structure model' pdbx_database_status 11 6 'Structure model' chem_comp_atom 12 6 'Structure model' chem_comp_bond 13 6 'Structure model' pdbx_database_status 14 7 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_software.name' 3 3 'Structure model' '_struct_ref_seq_dif.details' 4 4 'Structure model' '_database_2.pdbx_DOI' 5 4 'Structure model' '_database_2.pdbx_database_accession' 6 4 'Structure model' '_struct_ref_seq_dif.details' 7 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 8 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 9 4 'Structure model' '_struct_site.pdbx_auth_seq_id' 10 5 'Structure model' '_pdbx_database_status.status_code_nmr_data' 11 6 'Structure model' '_pdbx_database_status.deposit_site' 12 7 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site RCSB _pdbx_database_status.entry_id 2JR7 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2007-06-21 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.db_name BMRB _pdbx_database_related.db_id 15377 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wu, F.' 1 'Wu, J.' 2 'Shi, Y.' 3 # _citation.id primary _citation.title 'Solution structure of human DESR1, a CSL zinc-binding protein' _citation.journal_abbrev Proteins _citation.journal_volume 71 _citation.page_first 514 _citation.page_last 518 _citation.year 2008 _citation.journal_id_ASTM PSFGEY _citation.country US _citation.journal_id_ISSN 0887-3585 _citation.journal_id_CSD 0867 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18214955 _citation.pdbx_database_id_DOI 10.1002/prot.21915 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wu, F.' 1 ? primary 'Zhang, J.' 2 ? primary 'Sun, J.' 3 ? primary 'Huang, H.' 4 ? primary 'Ji, P.' 5 ? primary 'Chu, W.' 6 ? primary 'Yu, M.' 7 ? primary 'Yang, F.' 8 ? primary 'Wu, Z.' 9 ? primary 'Wu, J.' 10 ? primary 'Shi, Y.' 11 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'DPH3 homolog' 10198.138 1 ? C66S ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'CSL-type zinc finger-containing protein 2, DelGEF- interacting protein 1, DelGIP1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAVFHDEVEIEDFQYDEDSETYFYPCPCGDNFSITKEDLENGEDVATCPSCSLIIKVIYDKDQFVSGETVPAPSANKELV KLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MAVFHDEVEIEDFQYDEDSETYFYPCPCGDNFSITKEDLENGEDVATCPSCSLIIKVIYDKDQFVSGETVPAPSANKELV KLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 VAL n 1 4 PHE n 1 5 HIS n 1 6 ASP n 1 7 GLU n 1 8 VAL n 1 9 GLU n 1 10 ILE n 1 11 GLU n 1 12 ASP n 1 13 PHE n 1 14 GLN n 1 15 TYR n 1 16 ASP n 1 17 GLU n 1 18 ASP n 1 19 SER n 1 20 GLU n 1 21 THR n 1 22 TYR n 1 23 PHE n 1 24 TYR n 1 25 PRO n 1 26 CYS n 1 27 PRO n 1 28 CYS n 1 29 GLY n 1 30 ASP n 1 31 ASN n 1 32 PHE n 1 33 SER n 1 34 ILE n 1 35 THR n 1 36 LYS n 1 37 GLU n 1 38 ASP n 1 39 LEU n 1 40 GLU n 1 41 ASN n 1 42 GLY n 1 43 GLU n 1 44 ASP n 1 45 VAL n 1 46 ALA n 1 47 THR n 1 48 CYS n 1 49 PRO n 1 50 SER n 1 51 CYS n 1 52 SER n 1 53 LEU n 1 54 ILE n 1 55 ILE n 1 56 LYS n 1 57 VAL n 1 58 ILE n 1 59 TYR n 1 60 ASP n 1 61 LYS n 1 62 ASP n 1 63 GLN n 1 64 PHE n 1 65 VAL n 1 66 SER n 1 67 GLY n 1 68 GLU n 1 69 THR n 1 70 VAL n 1 71 PRO n 1 72 ALA n 1 73 PRO n 1 74 SER n 1 75 ALA n 1 76 ASN n 1 77 LYS n 1 78 GLU n 1 79 LEU n 1 80 VAL n 1 81 LYS n 1 82 LEU n 1 83 GLU n 1 84 HIS n 1 85 HIS n 1 86 HIS n 1 87 HIS n 1 88 HIS n 1 89 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'DPH3, DESR1, ZCSL2' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)GOLD' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector 'pET22b (+)' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 HIS 5 5 5 HIS HIS A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 PHE 13 13 13 PHE PHE A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 TYR 15 15 15 TYR TYR A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 PRO 27 27 27 PRO PRO A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 CYS 48 48 48 CYS CYS A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 CYS 51 51 51 CYS CYS A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 TYR 59 59 59 TYR TYR A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 PRO 71 71 71 PRO PRO A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 ASN 76 76 76 ASN ASN A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 HIS 84 84 84 HIS HIS A . n A 1 85 HIS 85 85 ? ? ? A . n A 1 86 HIS 86 86 ? ? ? A . n A 1 87 HIS 87 87 ? ? ? A . n A 1 88 HIS 88 88 ? ? ? A . n A 1 89 HIS 89 89 ? ? ? A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 85 _pdbx_nonpoly_scheme.auth_seq_num 85 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2JR7 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2JR7 _struct.title 'Solution structure of human DESR1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2JR7 _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text 'DESR1, CSL zinc finger, METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DPH3_HUMAN _struct_ref.pdbx_db_accession Q96FX2 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MAVFHDEVEIEDFQYDEDSETYFYPCPCGDNFSITKEDLENGEDVATCPSCSLIIKVIYDKDQFVCGETVPAPSANKELV K ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2JR7 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 81 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q96FX2 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 81 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 81 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2JR7 SER A 66 ? UNP Q96FX2 CYS 66 'engineered mutation' 66 1 1 2JR7 LEU A 82 ? UNP Q96FX2 ? ? 'expression tag' 82 2 1 2JR7 GLU A 83 ? UNP Q96FX2 ? ? 'expression tag' 83 3 1 2JR7 HIS A 84 ? UNP Q96FX2 ? ? 'expression tag' 84 4 1 2JR7 HIS A 85 ? UNP Q96FX2 ? ? 'expression tag' 85 5 1 2JR7 HIS A 86 ? UNP Q96FX2 ? ? 'expression tag' 86 6 1 2JR7 HIS A 87 ? UNP Q96FX2 ? ? 'expression tag' 87 7 1 2JR7 HIS A 88 ? UNP Q96FX2 ? ? 'expression tag' 88 8 1 2JR7 HIS A 89 ? UNP Q96FX2 ? ? 'expression tag' 89 9 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 36 ? GLY A 42 ? LYS A 36 GLY A 42 1 ? 7 HELX_P HELX_P2 2 ASP A 60 ? VAL A 65 ? ASP A 60 VAL A 65 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 26 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 26 A ZN 85 1_555 ? ? ? ? ? ? ? 2.418 ? ? metalc2 metalc ? ? A CYS 28 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 28 A ZN 85 1_555 ? ? ? ? ? ? ? 2.398 ? ? metalc3 metalc ? ? A CYS 48 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 48 A ZN 85 1_555 ? ? ? ? ? ? ? 2.399 ? ? metalc4 metalc ? ? A CYS 51 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 51 A ZN 85 1_555 ? ? ? ? ? ? ? 2.421 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 26 ? A CYS 26 ? 1_555 ZN ? B ZN . ? A ZN 85 ? 1_555 SG ? A CYS 28 ? A CYS 28 ? 1_555 109.0 ? 2 SG ? A CYS 26 ? A CYS 26 ? 1_555 ZN ? B ZN . ? A ZN 85 ? 1_555 SG ? A CYS 48 ? A CYS 48 ? 1_555 110.0 ? 3 SG ? A CYS 28 ? A CYS 28 ? 1_555 ZN ? B ZN . ? A ZN 85 ? 1_555 SG ? A CYS 48 ? A CYS 48 ? 1_555 110.8 ? 4 SG ? A CYS 26 ? A CYS 26 ? 1_555 ZN ? B ZN . ? A ZN 85 ? 1_555 SG ? A CYS 51 ? A CYS 51 ? 1_555 108.8 ? 5 SG ? A CYS 28 ? A CYS 28 ? 1_555 ZN ? B ZN . ? A ZN 85 ? 1_555 SG ? A CYS 51 ? A CYS 51 ? 1_555 109.1 ? 6 SG ? A CYS 48 ? A CYS 48 ? 1_555 ZN ? B ZN . ? A ZN 85 ? 1_555 SG ? A CYS 51 ? A CYS 51 ? 1_555 109.1 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 7 ? GLU A 9 ? GLU A 7 GLU A 9 A 2 ILE A 54 ? ILE A 58 ? ILE A 54 ILE A 58 A 3 VAL A 45 ? THR A 47 ? VAL A 45 THR A 47 B 1 GLN A 14 ? TYR A 15 ? GLN A 14 TYR A 15 B 2 THR A 21 ? PRO A 25 ? THR A 21 PRO A 25 B 3 ASN A 31 ? THR A 35 ? ASN A 31 THR A 35 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 8 ? N VAL A 8 O LYS A 56 ? O LYS A 56 A 2 3 O ILE A 55 ? O ILE A 55 N ALA A 46 ? N ALA A 46 B 1 2 N GLN A 14 ? N GLN A 14 O PHE A 23 ? O PHE A 23 B 2 3 N TYR A 22 ? N TYR A 22 O ILE A 34 ? O ILE A 34 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 85 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 85' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 26 ? CYS A 26 . ? 1_555 ? 2 AC1 4 CYS A 28 ? CYS A 28 . ? 1_555 ? 3 AC1 4 CYS A 48 ? CYS A 48 . ? 1_555 ? 4 AC1 4 CYS A 51 ? CYS A 51 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 2 ? ? -132.30 -50.26 2 1 PHE A 4 ? ? 60.23 175.54 3 1 HIS A 5 ? ? -91.01 -63.51 4 1 ASP A 6 ? ? -170.51 137.28 5 1 SER A 19 ? ? -149.11 32.75 6 1 GLU A 20 ? ? 50.25 73.49 7 1 GLU A 43 ? ? -67.85 79.22 8 1 ASP A 44 ? ? -96.34 39.39 9 1 SER A 50 ? ? -109.84 -68.03 10 1 PRO A 71 ? ? -59.90 174.83 11 1 ALA A 75 ? ? 62.35 -179.72 12 1 LYS A 81 ? ? -141.86 35.11 13 2 ALA A 2 ? ? -127.52 -58.60 14 2 SER A 19 ? ? -142.87 27.73 15 2 ASP A 44 ? ? -89.66 35.83 16 2 GLU A 68 ? ? -99.81 31.81 17 2 VAL A 70 ? ? 67.55 141.88 18 2 ALA A 75 ? ? 67.58 160.27 19 2 LEU A 79 ? ? -150.79 34.70 20 2 LYS A 81 ? ? 59.73 85.44 21 3 SER A 19 ? ? -148.83 28.23 22 3 GLU A 20 ? ? 53.74 82.28 23 3 ASP A 44 ? ? -97.33 41.92 24 3 SER A 50 ? ? -83.02 -75.39 25 3 PRO A 73 ? ? -58.94 172.38 26 3 LEU A 79 ? ? -172.85 128.57 27 4 ALA A 2 ? ? -131.47 -70.43 28 4 VAL A 3 ? ? -146.51 26.36 29 4 SER A 19 ? ? -151.44 32.39 30 4 GLU A 20 ? ? 51.65 70.49 31 4 ASN A 31 ? ? 73.37 131.50 32 4 GLU A 43 ? ? -68.02 80.22 33 4 ASP A 44 ? ? -95.05 38.72 34 4 PRO A 49 ? ? -84.60 36.62 35 4 SER A 50 ? ? -155.51 -64.11 36 4 SER A 66 ? ? -141.36 28.36 37 4 PRO A 71 ? ? -57.85 172.30 38 4 ALA A 75 ? ? 66.59 100.72 39 4 ASN A 76 ? ? -95.00 38.71 40 4 LEU A 79 ? ? -154.84 63.67 41 4 LYS A 81 ? ? 60.71 92.54 42 5 ASP A 30 ? ? -79.35 -167.25 43 5 ASP A 44 ? ? -97.66 41.78 44 5 LEU A 79 ? ? -163.35 40.59 45 5 LYS A 81 ? ? -145.70 25.79 46 5 LEU A 82 ? ? 69.00 152.36 47 6 ALA A 2 ? ? -168.96 -66.00 48 6 PHE A 4 ? ? 60.35 -179.95 49 6 HIS A 5 ? ? -97.28 -61.63 50 6 ASP A 44 ? ? -97.44 41.79 51 6 ALA A 72 ? ? 72.25 158.10 52 6 SER A 74 ? ? -147.63 -59.28 53 6 ASN A 76 ? ? -145.49 37.29 54 6 GLU A 78 ? ? -69.01 94.07 55 6 LEU A 79 ? ? -122.67 -146.86 56 6 LYS A 81 ? ? 61.06 79.02 57 6 GLU A 83 ? ? 73.21 -64.69 58 7 HIS A 5 ? ? -94.52 -65.75 59 7 SER A 19 ? ? -143.10 28.45 60 7 ASP A 30 ? ? -77.30 -168.21 61 7 GLU A 43 ? ? -68.80 80.76 62 7 ASP A 44 ? ? -98.49 41.90 63 7 SER A 50 ? ? -83.21 -73.85 64 7 PHE A 64 ? ? -72.40 -72.20 65 7 PRO A 71 ? ? -56.11 86.93 66 7 ALA A 72 ? ? -174.71 148.20 67 7 SER A 74 ? ? -163.99 -54.95 68 7 LEU A 79 ? ? -150.17 31.14 69 7 LYS A 81 ? ? -170.85 101.75 70 8 ALA A 2 ? ? -126.86 -72.21 71 8 VAL A 3 ? ? -151.54 76.43 72 8 HIS A 5 ? ? -92.81 -64.43 73 8 SER A 19 ? ? -152.93 34.77 74 8 GLU A 20 ? ? 52.11 77.03 75 8 GLU A 43 ? ? -69.74 80.47 76 8 ASP A 44 ? ? -96.71 40.14 77 8 SER A 50 ? ? -109.58 -65.51 78 8 LYS A 77 ? ? -166.96 74.50 79 9 SER A 19 ? ? -148.93 28.95 80 9 GLU A 43 ? ? -68.22 80.60 81 9 ASP A 44 ? ? -96.70 38.88 82 9 SER A 50 ? ? -81.11 -73.76 83 9 SER A 66 ? ? 61.06 74.90 84 9 ALA A 72 ? ? 72.85 153.17 85 9 ALA A 75 ? ? -156.00 37.28 86 9 LEU A 82 ? ? 70.28 150.31 87 9 GLU A 83 ? ? -158.61 -62.26 88 10 SER A 19 ? ? -145.27 29.91 89 10 GLU A 20 ? ? 51.96 70.30 90 10 ASP A 30 ? ? -78.56 -169.59 91 10 GLU A 43 ? ? -67.61 81.13 92 10 ASP A 44 ? ? -95.64 39.43 93 10 PRO A 49 ? ? -80.34 45.95 94 10 SER A 50 ? ? -157.77 -67.93 95 10 SER A 66 ? ? -164.58 79.13 96 10 PRO A 71 ? ? -59.14 175.81 97 10 PRO A 73 ? ? -68.89 98.21 98 10 GLU A 78 ? ? -140.85 37.94 99 10 GLU A 83 ? ? -132.31 -52.02 100 11 SER A 19 ? ? -152.00 33.61 101 11 GLU A 20 ? ? 52.53 74.32 102 11 CYS A 28 ? ? -157.16 -47.57 103 11 ASP A 44 ? ? -96.60 39.95 104 11 SER A 50 ? ? -164.64 -56.83 105 11 SER A 52 ? ? 71.95 41.87 106 11 SER A 66 ? ? -168.47 43.83 107 11 PRO A 73 ? ? -56.16 88.00 108 11 SER A 74 ? ? 63.38 100.48 109 11 ASN A 76 ? ? 64.93 -179.33 110 12 ALA A 2 ? ? -134.09 -66.67 111 12 SER A 19 ? ? -146.51 25.47 112 12 ASN A 31 ? ? 73.89 122.01 113 12 GLU A 43 ? ? -67.63 81.80 114 12 ASP A 44 ? ? -96.64 38.65 115 12 SER A 50 ? ? -120.36 -68.75 116 12 SER A 66 ? ? -95.47 42.66 117 12 LEU A 79 ? ? -175.91 130.11 118 13 SER A 19 ? ? -146.65 30.84 119 13 GLU A 20 ? ? 52.32 71.75 120 13 ASP A 30 ? ? -77.59 -163.25 121 13 GLU A 43 ? ? -68.05 79.17 122 13 ASP A 44 ? ? -95.02 39.37 123 13 SER A 50 ? ? -102.81 -65.92 124 13 GLU A 68 ? ? -105.73 78.56 125 13 ALA A 72 ? ? 71.38 159.33 126 13 LYS A 77 ? ? -160.37 113.25 127 13 LEU A 79 ? ? -173.44 129.17 128 14 PHE A 4 ? ? 59.45 178.67 129 14 HIS A 5 ? ? -96.77 -62.54 130 14 GLU A 43 ? ? -69.46 80.19 131 14 ASP A 44 ? ? -95.37 40.32 132 14 SER A 50 ? ? -106.69 -65.28 133 14 SER A 66 ? ? -157.34 84.44 134 14 PRO A 71 ? ? -56.86 171.61 135 14 ALA A 75 ? ? 71.83 -70.40 136 14 LEU A 79 ? ? -151.54 33.03 137 14 LYS A 81 ? ? -108.51 73.36 138 15 GLU A 43 ? ? -68.68 79.20 139 15 ASP A 44 ? ? -94.07 39.47 140 15 SER A 50 ? ? -104.01 -67.03 141 15 SER A 66 ? ? -108.77 40.90 142 15 GLU A 68 ? ? -116.02 79.62 143 15 PRO A 71 ? ? -61.03 -178.00 144 15 SER A 74 ? ? 65.69 -73.15 145 15 LYS A 77 ? ? -174.43 121.27 146 15 LEU A 82 ? ? 65.25 106.48 147 16 SER A 19 ? ? -143.93 28.06 148 16 ASP A 44 ? ? -91.95 35.88 149 16 PRO A 49 ? ? -82.48 40.77 150 16 SER A 50 ? ? -150.61 -59.09 151 16 SER A 66 ? ? -172.25 93.36 152 16 GLU A 68 ? ? -97.16 31.89 153 16 ALA A 72 ? ? 74.52 157.99 154 16 LYS A 77 ? ? 66.55 104.76 155 16 LEU A 79 ? ? -154.48 44.19 156 16 LYS A 81 ? ? 64.77 78.28 157 16 GLU A 83 ? ? 62.65 168.08 158 17 ALA A 2 ? ? -168.76 93.95 159 17 SER A 19 ? ? -147.62 29.93 160 17 GLU A 43 ? ? -68.09 80.63 161 17 ASP A 44 ? ? -96.54 40.09 162 17 SER A 66 ? ? -154.00 39.68 163 17 GLU A 68 ? ? -99.20 37.63 164 17 LYS A 77 ? ? -171.56 147.22 165 17 LEU A 79 ? ? -173.18 128.93 166 18 VAL A 3 ? ? 60.50 82.29 167 18 SER A 19 ? ? -151.09 28.24 168 18 ASP A 44 ? ? -92.18 36.82 169 18 SER A 50 ? ? -82.45 -74.34 170 18 PHE A 64 ? ? -72.39 -72.93 171 18 PRO A 71 ? ? -58.16 176.71 172 18 SER A 74 ? ? -163.00 39.64 173 18 ALA A 75 ? ? -132.12 -72.71 174 18 ASN A 76 ? ? 62.23 104.47 175 19 PHE A 4 ? ? 62.40 174.31 176 19 SER A 19 ? ? -142.33 28.44 177 19 GLU A 20 ? ? 50.48 70.37 178 19 GLU A 43 ? ? -66.43 80.24 179 19 ASP A 44 ? ? -96.66 39.94 180 19 SER A 50 ? ? -83.41 -75.11 181 19 SER A 52 ? ? 70.35 41.24 182 19 GLU A 68 ? ? -99.80 33.25 183 19 PRO A 71 ? ? -57.87 175.50 184 19 LYS A 81 ? ? 62.53 88.51 185 20 ALA A 2 ? ? -67.80 -171.58 186 20 PHE A 4 ? ? 57.42 -176.05 187 20 GLU A 43 ? ? -68.59 81.41 188 20 ASP A 44 ? ? -97.24 41.29 189 20 SER A 50 ? ? -99.43 -71.84 190 20 SER A 74 ? ? -164.77 108.13 191 20 GLU A 78 ? ? 63.84 66.26 192 20 LEU A 79 ? ? -164.25 33.96 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2JR7 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2JR7 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1.5 mM [U-99% 13C; U-99% 15N] protein, 20 mM TRIS, 50 mM sodium chloride, 14 mM beta-mercaptoethanol, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '1.5 mM [U-99% 13C; U-99% 15N] protein, 20 mM TRIS, 50 mM sodium chloride, 14 mM beta-mercaptoethanol, 99.99% D2O' 2 '99.99% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id entity_1 1.5 mM '[U-99% 13C; U-99% 15N]' 1 TRIS 20 mM ? 1 'sodium chloride' 50 mM ? 1 beta-mercaptoethanol 14 mM ? 1 entity_1 1.5 mM '[U-99% 13C; U-99% 15N]' 2 TRIS 20 mM ? 2 'sodium chloride' 50 mM ? 2 beta-mercaptoethanol 14 mM ? 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature 295 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D 1H-15N NOESY' 1 2 2 '3D 1H-13C NOESY' # _pdbx_nmr_refine.entry_id 2JR7 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS 1.1 1 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 2.2 2 Goddard 'data analysis' Sparky 3 3 'David S. Wishart' 'data analysis' CSI 1.0 4 'Koradi, Billeter and Wuthrich' 'data analysis' MOLMOL 2K.2 5 'Cornilescu, Delaglio and Bax' 'data analysis' TALOS ? 6 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS 1.1 7 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 85 ? A HIS 85 2 1 Y 1 A HIS 86 ? A HIS 86 3 1 Y 1 A HIS 87 ? A HIS 87 4 1 Y 1 A HIS 88 ? A HIS 88 5 1 Y 1 A HIS 89 ? A HIS 89 6 2 Y 1 A HIS 85 ? A HIS 85 7 2 Y 1 A HIS 86 ? A HIS 86 8 2 Y 1 A HIS 87 ? A HIS 87 9 2 Y 1 A HIS 88 ? A HIS 88 10 2 Y 1 A HIS 89 ? A HIS 89 11 3 Y 1 A HIS 85 ? A HIS 85 12 3 Y 1 A HIS 86 ? A HIS 86 13 3 Y 1 A HIS 87 ? A HIS 87 14 3 Y 1 A HIS 88 ? A HIS 88 15 3 Y 1 A HIS 89 ? A HIS 89 16 4 Y 1 A HIS 85 ? A HIS 85 17 4 Y 1 A HIS 86 ? A HIS 86 18 4 Y 1 A HIS 87 ? A HIS 87 19 4 Y 1 A HIS 88 ? A HIS 88 20 4 Y 1 A HIS 89 ? A HIS 89 21 5 Y 1 A HIS 85 ? A HIS 85 22 5 Y 1 A HIS 86 ? A HIS 86 23 5 Y 1 A HIS 87 ? A HIS 87 24 5 Y 1 A HIS 88 ? A HIS 88 25 5 Y 1 A HIS 89 ? A HIS 89 26 6 Y 1 A HIS 85 ? A HIS 85 27 6 Y 1 A HIS 86 ? A HIS 86 28 6 Y 1 A HIS 87 ? A HIS 87 29 6 Y 1 A HIS 88 ? A HIS 88 30 6 Y 1 A HIS 89 ? A HIS 89 31 7 Y 1 A HIS 85 ? A HIS 85 32 7 Y 1 A HIS 86 ? A HIS 86 33 7 Y 1 A HIS 87 ? A HIS 87 34 7 Y 1 A HIS 88 ? A HIS 88 35 7 Y 1 A HIS 89 ? A HIS 89 36 8 Y 1 A HIS 85 ? A HIS 85 37 8 Y 1 A HIS 86 ? A HIS 86 38 8 Y 1 A HIS 87 ? A HIS 87 39 8 Y 1 A HIS 88 ? A HIS 88 40 8 Y 1 A HIS 89 ? A HIS 89 41 9 Y 1 A HIS 85 ? A HIS 85 42 9 Y 1 A HIS 86 ? A HIS 86 43 9 Y 1 A HIS 87 ? A HIS 87 44 9 Y 1 A HIS 88 ? A HIS 88 45 9 Y 1 A HIS 89 ? A HIS 89 46 10 Y 1 A HIS 85 ? A HIS 85 47 10 Y 1 A HIS 86 ? A HIS 86 48 10 Y 1 A HIS 87 ? A HIS 87 49 10 Y 1 A HIS 88 ? A HIS 88 50 10 Y 1 A HIS 89 ? A HIS 89 51 11 Y 1 A HIS 85 ? A HIS 85 52 11 Y 1 A HIS 86 ? A HIS 86 53 11 Y 1 A HIS 87 ? A HIS 87 54 11 Y 1 A HIS 88 ? A HIS 88 55 11 Y 1 A HIS 89 ? A HIS 89 56 12 Y 1 A HIS 85 ? A HIS 85 57 12 Y 1 A HIS 86 ? A HIS 86 58 12 Y 1 A HIS 87 ? A HIS 87 59 12 Y 1 A HIS 88 ? A HIS 88 60 12 Y 1 A HIS 89 ? A HIS 89 61 13 Y 1 A HIS 85 ? A HIS 85 62 13 Y 1 A HIS 86 ? A HIS 86 63 13 Y 1 A HIS 87 ? A HIS 87 64 13 Y 1 A HIS 88 ? A HIS 88 65 13 Y 1 A HIS 89 ? A HIS 89 66 14 Y 1 A HIS 85 ? A HIS 85 67 14 Y 1 A HIS 86 ? A HIS 86 68 14 Y 1 A HIS 87 ? A HIS 87 69 14 Y 1 A HIS 88 ? A HIS 88 70 14 Y 1 A HIS 89 ? A HIS 89 71 15 Y 1 A HIS 85 ? A HIS 85 72 15 Y 1 A HIS 86 ? A HIS 86 73 15 Y 1 A HIS 87 ? A HIS 87 74 15 Y 1 A HIS 88 ? A HIS 88 75 15 Y 1 A HIS 89 ? A HIS 89 76 16 Y 1 A HIS 85 ? A HIS 85 77 16 Y 1 A HIS 86 ? A HIS 86 78 16 Y 1 A HIS 87 ? A HIS 87 79 16 Y 1 A HIS 88 ? A HIS 88 80 16 Y 1 A HIS 89 ? A HIS 89 81 17 Y 1 A HIS 85 ? A HIS 85 82 17 Y 1 A HIS 86 ? A HIS 86 83 17 Y 1 A HIS 87 ? A HIS 87 84 17 Y 1 A HIS 88 ? A HIS 88 85 17 Y 1 A HIS 89 ? A HIS 89 86 18 Y 1 A HIS 85 ? A HIS 85 87 18 Y 1 A HIS 86 ? A HIS 86 88 18 Y 1 A HIS 87 ? A HIS 87 89 18 Y 1 A HIS 88 ? A HIS 88 90 18 Y 1 A HIS 89 ? A HIS 89 91 19 Y 1 A HIS 85 ? A HIS 85 92 19 Y 1 A HIS 86 ? A HIS 86 93 19 Y 1 A HIS 87 ? A HIS 87 94 19 Y 1 A HIS 88 ? A HIS 88 95 19 Y 1 A HIS 89 ? A HIS 89 96 20 Y 1 A HIS 85 ? A HIS 85 97 20 Y 1 A HIS 86 ? A HIS 86 98 20 Y 1 A HIS 87 ? A HIS 87 99 20 Y 1 A HIS 88 ? A HIS 88 100 20 Y 1 A HIS 89 ? A HIS 89 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 CYS N N N N 47 CYS CA C N R 48 CYS C C N N 49 CYS O O N N 50 CYS CB C N N 51 CYS SG S N N 52 CYS OXT O N N 53 CYS H H N N 54 CYS H2 H N N 55 CYS HA H N N 56 CYS HB2 H N N 57 CYS HB3 H N N 58 CYS HG H N N 59 CYS HXT H N N 60 GLN N N N N 61 GLN CA C N S 62 GLN C C N N 63 GLN O O N N 64 GLN CB C N N 65 GLN CG C N N 66 GLN CD C N N 67 GLN OE1 O N N 68 GLN NE2 N N N 69 GLN OXT O N N 70 GLN H H N N 71 GLN H2 H N N 72 GLN HA H N N 73 GLN HB2 H N N 74 GLN HB3 H N N 75 GLN HG2 H N N 76 GLN HG3 H N N 77 GLN HE21 H N N 78 GLN HE22 H N N 79 GLN HXT H N N 80 GLU N N N N 81 GLU CA C N S 82 GLU C C N N 83 GLU O O N N 84 GLU CB C N N 85 GLU CG C N N 86 GLU CD C N N 87 GLU OE1 O N N 88 GLU OE2 O N N 89 GLU OXT O N N 90 GLU H H N N 91 GLU H2 H N N 92 GLU HA H N N 93 GLU HB2 H N N 94 GLU HB3 H N N 95 GLU HG2 H N N 96 GLU HG3 H N N 97 GLU HE2 H N N 98 GLU HXT H N N 99 GLY N N N N 100 GLY CA C N N 101 GLY C C N N 102 GLY O O N N 103 GLY OXT O N N 104 GLY H H N N 105 GLY H2 H N N 106 GLY HA2 H N N 107 GLY HA3 H N N 108 GLY HXT H N N 109 HIS N N N N 110 HIS CA C N S 111 HIS C C N N 112 HIS O O N N 113 HIS CB C N N 114 HIS CG C Y N 115 HIS ND1 N Y N 116 HIS CD2 C Y N 117 HIS CE1 C Y N 118 HIS NE2 N Y N 119 HIS OXT O N N 120 HIS H H N N 121 HIS H2 H N N 122 HIS HA H N N 123 HIS HB2 H N N 124 HIS HB3 H N N 125 HIS HD1 H N N 126 HIS HD2 H N N 127 HIS HE1 H N N 128 HIS HE2 H N N 129 HIS HXT H N N 130 ILE N N N N 131 ILE CA C N S 132 ILE C C N N 133 ILE O O N N 134 ILE CB C N S 135 ILE CG1 C N N 136 ILE CG2 C N N 137 ILE CD1 C N N 138 ILE OXT O N N 139 ILE H H N N 140 ILE H2 H N N 141 ILE HA H N N 142 ILE HB H N N 143 ILE HG12 H N N 144 ILE HG13 H N N 145 ILE HG21 H N N 146 ILE HG22 H N N 147 ILE HG23 H N N 148 ILE HD11 H N N 149 ILE HD12 H N N 150 ILE HD13 H N N 151 ILE HXT H N N 152 LEU N N N N 153 LEU CA C N S 154 LEU C C N N 155 LEU O O N N 156 LEU CB C N N 157 LEU CG C N N 158 LEU CD1 C N N 159 LEU CD2 C N N 160 LEU OXT O N N 161 LEU H H N N 162 LEU H2 H N N 163 LEU HA H N N 164 LEU HB2 H N N 165 LEU HB3 H N N 166 LEU HG H N N 167 LEU HD11 H N N 168 LEU HD12 H N N 169 LEU HD13 H N N 170 LEU HD21 H N N 171 LEU HD22 H N N 172 LEU HD23 H N N 173 LEU HXT H N N 174 LYS N N N N 175 LYS CA C N S 176 LYS C C N N 177 LYS O O N N 178 LYS CB C N N 179 LYS CG C N N 180 LYS CD C N N 181 LYS CE C N N 182 LYS NZ N N N 183 LYS OXT O N N 184 LYS H H N N 185 LYS H2 H N N 186 LYS HA H N N 187 LYS HB2 H N N 188 LYS HB3 H N N 189 LYS HG2 H N N 190 LYS HG3 H N N 191 LYS HD2 H N N 192 LYS HD3 H N N 193 LYS HE2 H N N 194 LYS HE3 H N N 195 LYS HZ1 H N N 196 LYS HZ2 H N N 197 LYS HZ3 H N N 198 LYS HXT H N N 199 MET N N N N 200 MET CA C N S 201 MET C C N N 202 MET O O N N 203 MET CB C N N 204 MET CG C N N 205 MET SD S N N 206 MET CE C N N 207 MET OXT O N N 208 MET H H N N 209 MET H2 H N N 210 MET HA H N N 211 MET HB2 H N N 212 MET HB3 H N N 213 MET HG2 H N N 214 MET HG3 H N N 215 MET HE1 H N N 216 MET HE2 H N N 217 MET HE3 H N N 218 MET HXT H N N 219 PHE N N N N 220 PHE CA C N S 221 PHE C C N N 222 PHE O O N N 223 PHE CB C N N 224 PHE CG C Y N 225 PHE CD1 C Y N 226 PHE CD2 C Y N 227 PHE CE1 C Y N 228 PHE CE2 C Y N 229 PHE CZ C Y N 230 PHE OXT O N N 231 PHE H H N N 232 PHE H2 H N N 233 PHE HA H N N 234 PHE HB2 H N N 235 PHE HB3 H N N 236 PHE HD1 H N N 237 PHE HD2 H N N 238 PHE HE1 H N N 239 PHE HE2 H N N 240 PHE HZ H N N 241 PHE HXT H N N 242 PRO N N N N 243 PRO CA C N S 244 PRO C C N N 245 PRO O O N N 246 PRO CB C N N 247 PRO CG C N N 248 PRO CD C N N 249 PRO OXT O N N 250 PRO H H N N 251 PRO HA H N N 252 PRO HB2 H N N 253 PRO HB3 H N N 254 PRO HG2 H N N 255 PRO HG3 H N N 256 PRO HD2 H N N 257 PRO HD3 H N N 258 PRO HXT H N N 259 SER N N N N 260 SER CA C N S 261 SER C C N N 262 SER O O N N 263 SER CB C N N 264 SER OG O N N 265 SER OXT O N N 266 SER H H N N 267 SER H2 H N N 268 SER HA H N N 269 SER HB2 H N N 270 SER HB3 H N N 271 SER HG H N N 272 SER HXT H N N 273 THR N N N N 274 THR CA C N S 275 THR C C N N 276 THR O O N N 277 THR CB C N R 278 THR OG1 O N N 279 THR CG2 C N N 280 THR OXT O N N 281 THR H H N N 282 THR H2 H N N 283 THR HA H N N 284 THR HB H N N 285 THR HG1 H N N 286 THR HG21 H N N 287 THR HG22 H N N 288 THR HG23 H N N 289 THR HXT H N N 290 TYR N N N N 291 TYR CA C N S 292 TYR C C N N 293 TYR O O N N 294 TYR CB C N N 295 TYR CG C Y N 296 TYR CD1 C Y N 297 TYR CD2 C Y N 298 TYR CE1 C Y N 299 TYR CE2 C Y N 300 TYR CZ C Y N 301 TYR OH O N N 302 TYR OXT O N N 303 TYR H H N N 304 TYR H2 H N N 305 TYR HA H N N 306 TYR HB2 H N N 307 TYR HB3 H N N 308 TYR HD1 H N N 309 TYR HD2 H N N 310 TYR HE1 H N N 311 TYR HE2 H N N 312 TYR HH H N N 313 TYR HXT H N N 314 VAL N N N N 315 VAL CA C N S 316 VAL C C N N 317 VAL O O N N 318 VAL CB C N N 319 VAL CG1 C N N 320 VAL CG2 C N N 321 VAL OXT O N N 322 VAL H H N N 323 VAL H2 H N N 324 VAL HA H N N 325 VAL HB H N N 326 VAL HG11 H N N 327 VAL HG12 H N N 328 VAL HG13 H N N 329 VAL HG21 H N N 330 VAL HG22 H N N 331 VAL HG23 H N N 332 VAL HXT H N N 333 ZN ZN ZN N N 334 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 CYS N CA sing N N 44 CYS N H sing N N 45 CYS N H2 sing N N 46 CYS CA C sing N N 47 CYS CA CB sing N N 48 CYS CA HA sing N N 49 CYS C O doub N N 50 CYS C OXT sing N N 51 CYS CB SG sing N N 52 CYS CB HB2 sing N N 53 CYS CB HB3 sing N N 54 CYS SG HG sing N N 55 CYS OXT HXT sing N N 56 GLN N CA sing N N 57 GLN N H sing N N 58 GLN N H2 sing N N 59 GLN CA C sing N N 60 GLN CA CB sing N N 61 GLN CA HA sing N N 62 GLN C O doub N N 63 GLN C OXT sing N N 64 GLN CB CG sing N N 65 GLN CB HB2 sing N N 66 GLN CB HB3 sing N N 67 GLN CG CD sing N N 68 GLN CG HG2 sing N N 69 GLN CG HG3 sing N N 70 GLN CD OE1 doub N N 71 GLN CD NE2 sing N N 72 GLN NE2 HE21 sing N N 73 GLN NE2 HE22 sing N N 74 GLN OXT HXT sing N N 75 GLU N CA sing N N 76 GLU N H sing N N 77 GLU N H2 sing N N 78 GLU CA C sing N N 79 GLU CA CB sing N N 80 GLU CA HA sing N N 81 GLU C O doub N N 82 GLU C OXT sing N N 83 GLU CB CG sing N N 84 GLU CB HB2 sing N N 85 GLU CB HB3 sing N N 86 GLU CG CD sing N N 87 GLU CG HG2 sing N N 88 GLU CG HG3 sing N N 89 GLU CD OE1 doub N N 90 GLU CD OE2 sing N N 91 GLU OE2 HE2 sing N N 92 GLU OXT HXT sing N N 93 GLY N CA sing N N 94 GLY N H sing N N 95 GLY N H2 sing N N 96 GLY CA C sing N N 97 GLY CA HA2 sing N N 98 GLY CA HA3 sing N N 99 GLY C O doub N N 100 GLY C OXT sing N N 101 GLY OXT HXT sing N N 102 HIS N CA sing N N 103 HIS N H sing N N 104 HIS N H2 sing N N 105 HIS CA C sing N N 106 HIS CA CB sing N N 107 HIS CA HA sing N N 108 HIS C O doub N N 109 HIS C OXT sing N N 110 HIS CB CG sing N N 111 HIS CB HB2 sing N N 112 HIS CB HB3 sing N N 113 HIS CG ND1 sing Y N 114 HIS CG CD2 doub Y N 115 HIS ND1 CE1 doub Y N 116 HIS ND1 HD1 sing N N 117 HIS CD2 NE2 sing Y N 118 HIS CD2 HD2 sing N N 119 HIS CE1 NE2 sing Y N 120 HIS CE1 HE1 sing N N 121 HIS NE2 HE2 sing N N 122 HIS OXT HXT sing N N 123 ILE N CA sing N N 124 ILE N H sing N N 125 ILE N H2 sing N N 126 ILE CA C sing N N 127 ILE CA CB sing N N 128 ILE CA HA sing N N 129 ILE C O doub N N 130 ILE C OXT sing N N 131 ILE CB CG1 sing N N 132 ILE CB CG2 sing N N 133 ILE CB HB sing N N 134 ILE CG1 CD1 sing N N 135 ILE CG1 HG12 sing N N 136 ILE CG1 HG13 sing N N 137 ILE CG2 HG21 sing N N 138 ILE CG2 HG22 sing N N 139 ILE CG2 HG23 sing N N 140 ILE CD1 HD11 sing N N 141 ILE CD1 HD12 sing N N 142 ILE CD1 HD13 sing N N 143 ILE OXT HXT sing N N 144 LEU N CA sing N N 145 LEU N H sing N N 146 LEU N H2 sing N N 147 LEU CA C sing N N 148 LEU CA CB sing N N 149 LEU CA HA sing N N 150 LEU C O doub N N 151 LEU C OXT sing N N 152 LEU CB CG sing N N 153 LEU CB HB2 sing N N 154 LEU CB HB3 sing N N 155 LEU CG CD1 sing N N 156 LEU CG CD2 sing N N 157 LEU CG HG sing N N 158 LEU CD1 HD11 sing N N 159 LEU CD1 HD12 sing N N 160 LEU CD1 HD13 sing N N 161 LEU CD2 HD21 sing N N 162 LEU CD2 HD22 sing N N 163 LEU CD2 HD23 sing N N 164 LEU OXT HXT sing N N 165 LYS N CA sing N N 166 LYS N H sing N N 167 LYS N H2 sing N N 168 LYS CA C sing N N 169 LYS CA CB sing N N 170 LYS CA HA sing N N 171 LYS C O doub N N 172 LYS C OXT sing N N 173 LYS CB CG sing N N 174 LYS CB HB2 sing N N 175 LYS CB HB3 sing N N 176 LYS CG CD sing N N 177 LYS CG HG2 sing N N 178 LYS CG HG3 sing N N 179 LYS CD CE sing N N 180 LYS CD HD2 sing N N 181 LYS CD HD3 sing N N 182 LYS CE NZ sing N N 183 LYS CE HE2 sing N N 184 LYS CE HE3 sing N N 185 LYS NZ HZ1 sing N N 186 LYS NZ HZ2 sing N N 187 LYS NZ HZ3 sing N N 188 LYS OXT HXT sing N N 189 MET N CA sing N N 190 MET N H sing N N 191 MET N H2 sing N N 192 MET CA C sing N N 193 MET CA CB sing N N 194 MET CA HA sing N N 195 MET C O doub N N 196 MET C OXT sing N N 197 MET CB CG sing N N 198 MET CB HB2 sing N N 199 MET CB HB3 sing N N 200 MET CG SD sing N N 201 MET CG HG2 sing N N 202 MET CG HG3 sing N N 203 MET SD CE sing N N 204 MET CE HE1 sing N N 205 MET CE HE2 sing N N 206 MET CE HE3 sing N N 207 MET OXT HXT sing N N 208 PHE N CA sing N N 209 PHE N H sing N N 210 PHE N H2 sing N N 211 PHE CA C sing N N 212 PHE CA CB sing N N 213 PHE CA HA sing N N 214 PHE C O doub N N 215 PHE C OXT sing N N 216 PHE CB CG sing N N 217 PHE CB HB2 sing N N 218 PHE CB HB3 sing N N 219 PHE CG CD1 doub Y N 220 PHE CG CD2 sing Y N 221 PHE CD1 CE1 sing Y N 222 PHE CD1 HD1 sing N N 223 PHE CD2 CE2 doub Y N 224 PHE CD2 HD2 sing N N 225 PHE CE1 CZ doub Y N 226 PHE CE1 HE1 sing N N 227 PHE CE2 CZ sing Y N 228 PHE CE2 HE2 sing N N 229 PHE CZ HZ sing N N 230 PHE OXT HXT sing N N 231 PRO N CA sing N N 232 PRO N CD sing N N 233 PRO N H sing N N 234 PRO CA C sing N N 235 PRO CA CB sing N N 236 PRO CA HA sing N N 237 PRO C O doub N N 238 PRO C OXT sing N N 239 PRO CB CG sing N N 240 PRO CB HB2 sing N N 241 PRO CB HB3 sing N N 242 PRO CG CD sing N N 243 PRO CG HG2 sing N N 244 PRO CG HG3 sing N N 245 PRO CD HD2 sing N N 246 PRO CD HD3 sing N N 247 PRO OXT HXT sing N N 248 SER N CA sing N N 249 SER N H sing N N 250 SER N H2 sing N N 251 SER CA C sing N N 252 SER CA CB sing N N 253 SER CA HA sing N N 254 SER C O doub N N 255 SER C OXT sing N N 256 SER CB OG sing N N 257 SER CB HB2 sing N N 258 SER CB HB3 sing N N 259 SER OG HG sing N N 260 SER OXT HXT sing N N 261 THR N CA sing N N 262 THR N H sing N N 263 THR N H2 sing N N 264 THR CA C sing N N 265 THR CA CB sing N N 266 THR CA HA sing N N 267 THR C O doub N N 268 THR C OXT sing N N 269 THR CB OG1 sing N N 270 THR CB CG2 sing N N 271 THR CB HB sing N N 272 THR OG1 HG1 sing N N 273 THR CG2 HG21 sing N N 274 THR CG2 HG22 sing N N 275 THR CG2 HG23 sing N N 276 THR OXT HXT sing N N 277 TYR N CA sing N N 278 TYR N H sing N N 279 TYR N H2 sing N N 280 TYR CA C sing N N 281 TYR CA CB sing N N 282 TYR CA HA sing N N 283 TYR C O doub N N 284 TYR C OXT sing N N 285 TYR CB CG sing N N 286 TYR CB HB2 sing N N 287 TYR CB HB3 sing N N 288 TYR CG CD1 doub Y N 289 TYR CG CD2 sing Y N 290 TYR CD1 CE1 sing Y N 291 TYR CD1 HD1 sing N N 292 TYR CD2 CE2 doub Y N 293 TYR CD2 HD2 sing N N 294 TYR CE1 CZ doub Y N 295 TYR CE1 HE1 sing N N 296 TYR CE2 CZ sing Y N 297 TYR CE2 HE2 sing N N 298 TYR CZ OH sing N N 299 TYR OH HH sing N N 300 TYR OXT HXT sing N N 301 VAL N CA sing N N 302 VAL N H sing N N 303 VAL N H2 sing N N 304 VAL CA C sing N N 305 VAL CA CB sing N N 306 VAL CA HA sing N N 307 VAL C O doub N N 308 VAL C OXT sing N N 309 VAL CB CG1 sing N N 310 VAL CB CG2 sing N N 311 VAL CB HB sing N N 312 VAL CG1 HG11 sing N N 313 VAL CG1 HG12 sing N N 314 VAL CG1 HG13 sing N N 315 VAL CG2 HG21 sing N N 316 VAL CG2 HG22 sing N N 317 VAL CG2 HG23 sing N N 318 VAL OXT HXT sing N N 319 # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DMX _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker DMX' # _atom_sites.entry_id 2JR7 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_