data_2JRE # _entry.id 2JRE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2JRE pdb_00002jre 10.2210/pdb2jre/pdb RCSB RCSB100194 ? ? WWPDB D_1000100194 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-07-01 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-09 4 'Structure model' 1 3 2023-12-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Database references' 3 3 'Structure model' 'Derived calculations' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_struct_assembly 3 3 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.deposit_site' # _pdbx_database_status.deposit_site RCSB _pdbx_database_status.entry_id 2JRE _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2007-06-25 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.db_id 15328 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Larson, C.' 1 'Stiffler, M.' 2 'Li, P.' 3 'Rosen, M.' 4 'MacBeath, G.' 5 'Ranganathan, R.' 6 # _citation.id primary _citation.title 'C60-1, a PDZ domain designed using statistical coupling analysis' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Larson, C.' 1 ? primary 'Stiffler, M.' 2 ? primary 'Li, P.' 3 ? primary 'Rosen, M.' 4 ? primary 'MacBeath, G.' 5 ? primary 'Ranganathan, R.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description 'C60-1 PDZ domain peptide' _entity.formula_weight 11589.026 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHGYSDASGFSLYSVELFREKDTSSLGISISGMRDQSTTGEATGIYVKSLIPGSAAALDGRIEPNDKILRVDDVNVQGM AQSDVVEVLRNAGNPVRLLLIRRLPLLE ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHGYSDASGFSLYSVELFREKDTSSLGISISGMRDQSTTGEATGIYVKSLIPGSAAALDGRIEPNDKILRVDDVNVQGM AQSDVVEVLRNAGNPVRLLLIRRLPLLE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 GLY n 1 5 TYR n 1 6 SER n 1 7 ASP n 1 8 ALA n 1 9 SER n 1 10 GLY n 1 11 PHE n 1 12 SER n 1 13 LEU n 1 14 TYR n 1 15 SER n 1 16 VAL n 1 17 GLU n 1 18 LEU n 1 19 PHE n 1 20 ARG n 1 21 GLU n 1 22 LYS n 1 23 ASP n 1 24 THR n 1 25 SER n 1 26 SER n 1 27 LEU n 1 28 GLY n 1 29 ILE n 1 30 SER n 1 31 ILE n 1 32 SER n 1 33 GLY n 1 34 MET n 1 35 ARG n 1 36 ASP n 1 37 GLN n 1 38 SER n 1 39 THR n 1 40 THR n 1 41 GLY n 1 42 GLU n 1 43 ALA n 1 44 THR n 1 45 GLY n 1 46 ILE n 1 47 TYR n 1 48 VAL n 1 49 LYS n 1 50 SER n 1 51 LEU n 1 52 ILE n 1 53 PRO n 1 54 GLY n 1 55 SER n 1 56 ALA n 1 57 ALA n 1 58 ALA n 1 59 LEU n 1 60 ASP n 1 61 GLY n 1 62 ARG n 1 63 ILE n 1 64 GLU n 1 65 PRO n 1 66 ASN n 1 67 ASP n 1 68 LYS n 1 69 ILE n 1 70 LEU n 1 71 ARG n 1 72 VAL n 1 73 ASP n 1 74 ASP n 1 75 VAL n 1 76 ASN n 1 77 VAL n 1 78 GLN n 1 79 GLY n 1 80 MET n 1 81 ALA n 1 82 GLN n 1 83 SER n 1 84 ASP n 1 85 VAL n 1 86 VAL n 1 87 GLU n 1 88 VAL n 1 89 LEU n 1 90 ARG n 1 91 ASN n 1 92 ALA n 1 93 GLY n 1 94 ASN n 1 95 PRO n 1 96 VAL n 1 97 ARG n 1 98 LEU n 1 99 LEU n 1 100 LEU n 1 101 ILE n 1 102 ARG n 1 103 ARG n 1 104 LEU n 1 105 PRO n 1 106 LEU n 1 107 LEU n 1 108 GLU n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details ;The peptide is a synthetic construct designed using statistical coupling analysis and expressed in Escherichia coli BL21 cells using the pHis8.3 vector. ; # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 HIS 3 3 3 HIS HIS A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 TYR 5 5 5 TYR TYR A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 MET 34 34 34 MET MET A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 THR 39 39 39 THR THR A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 TYR 47 47 47 TYR TYR A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 PRO 65 65 65 PRO PRO A . n A 1 66 ASN 66 66 66 ASN ASN A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 ASN 76 76 76 ASN ASN A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 GLN 78 78 78 GLN GLN A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 MET 80 80 80 MET MET A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 GLN 82 82 82 GLN GLN A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 ARG 90 90 90 ARG ARG A . n A 1 91 ASN 91 91 91 ASN ASN A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 ASN 94 94 94 ASN ASN A . n A 1 95 PRO 95 95 95 PRO PRO A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 ILE 101 101 101 ILE ILE A . n A 1 102 ARG 102 102 102 ARG ARG A . n A 1 103 ARG 103 103 103 ARG ARG A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 PRO 105 105 105 PRO PRO A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 GLU 108 108 108 GLU GLU A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2JRE _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2JRE _struct.title 'C60-1, a PDZ domain designed using statistical coupling analysis' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2JRE _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' _struct_keywords.text 'C60-1, PDZ, DE NOVO PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.entity_id 1 _struct_ref.db_name PDB _struct_ref.db_code 2JRE _struct_ref.pdbx_db_accession 2JRE _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2JRE _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 108 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 2JRE _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 108 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 108 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 55 ? GLY A 61 ? SER A 55 GLY A 61 1 ? 7 HELX_P HELX_P2 2 ALA A 81 ? GLY A 93 ? ALA A 81 GLY A 93 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 12 ? PHE A 19 ? SER A 12 PHE A 19 A 2 PRO A 95 ? ARG A 102 ? PRO A 95 ARG A 102 A 3 ASP A 67 ? VAL A 72 ? ASP A 67 VAL A 72 A 4 TYR A 47 ? LEU A 51 ? TYR A 47 LEU A 51 A 5 ILE A 29 ? SER A 32 ? ILE A 29 SER A 32 B 1 SER A 12 ? PHE A 19 ? SER A 12 PHE A 19 B 2 PRO A 95 ? ARG A 102 ? PRO A 95 ARG A 102 B 3 ASP A 67 ? VAL A 72 ? ASP A 67 VAL A 72 B 4 VAL A 75 ? ASN A 76 ? VAL A 75 ASN A 76 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 16 ? N VAL A 16 O LEU A 98 ? O LEU A 98 A 2 3 O ILE A 101 ? O ILE A 101 N LYS A 68 ? N LYS A 68 A 3 4 O ASP A 67 ? O ASP A 67 N VAL A 48 ? N VAL A 48 A 4 5 O LYS A 49 ? O LYS A 49 N SER A 30 ? N SER A 30 B 1 2 N VAL A 16 ? N VAL A 16 O LEU A 98 ? O LEU A 98 B 2 3 O ILE A 101 ? O ILE A 101 N LYS A 68 ? N LYS A 68 B 3 4 N VAL A 72 ? N VAL A 72 O VAL A 75 ? O VAL A 75 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 HH A TYR 14 ? ? HD23 A LEU 104 ? ? 1.23 2 5 HH A TYR 14 ? ? HD23 A LEU 104 ? ? 1.34 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 7 ? ? 58.14 86.42 2 1 THR A 40 ? ? -154.84 23.42 3 1 THR A 44 ? ? 51.39 -169.66 4 1 ASN A 66 ? ? 57.88 74.54 5 1 ASP A 73 ? ? -47.55 108.97 6 1 ALA A 92 ? ? -53.21 -83.00 7 1 PRO A 95 ? ? -57.07 105.10 8 2 SER A 2 ? ? -103.86 -65.81 9 2 ASP A 7 ? ? 57.72 76.49 10 2 ASP A 23 ? ? -95.23 40.40 11 2 SER A 25 ? ? 57.76 19.10 12 2 SER A 38 ? ? -165.72 102.44 13 2 THR A 40 ? ? -159.24 19.41 14 2 GLU A 42 ? ? 57.17 90.38 15 2 PRO A 65 ? ? -74.10 44.84 16 2 ASN A 66 ? ? -167.75 69.50 17 2 LEU A 70 ? ? -124.35 -67.11 18 2 ASP A 73 ? ? -51.07 108.81 19 2 ASP A 74 ? ? 59.39 14.21 20 2 GLN A 78 ? ? -90.72 33.60 21 2 ALA A 92 ? ? -54.62 -86.64 22 2 PRO A 95 ? ? -58.24 107.23 23 3 SER A 2 ? ? -147.54 -53.35 24 3 ASP A 7 ? ? 57.00 82.87 25 3 GLU A 21 ? ? -165.87 -32.83 26 3 THR A 44 ? ? 51.55 -172.08 27 3 ASN A 66 ? ? -174.59 72.09 28 3 LEU A 70 ? ? -121.56 -59.22 29 3 ASP A 73 ? ? -47.28 108.62 30 3 GLN A 78 ? ? -92.28 42.40 31 3 ALA A 92 ? ? -52.33 -85.03 32 3 PRO A 95 ? ? -58.91 104.10 33 4 HIS A 3 ? ? -148.89 -24.91 34 4 ASP A 7 ? ? 54.29 78.74 35 4 ASP A 23 ? ? -87.37 34.09 36 4 SER A 25 ? ? 58.32 17.62 37 4 THR A 40 ? ? -161.16 8.97 38 4 ALA A 43 ? ? -161.80 61.57 39 4 LEU A 70 ? ? -107.34 -60.19 40 4 GLN A 78 ? ? -95.41 44.85 41 4 ALA A 92 ? ? -58.06 -86.49 42 4 PRO A 95 ? ? -56.28 104.93 43 5 ASP A 23 ? ? -84.46 39.72 44 5 SER A 25 ? ? 56.83 17.39 45 5 ASP A 36 ? ? -103.53 -65.91 46 5 GLN A 37 ? ? 60.44 77.87 47 5 SER A 38 ? ? 58.18 86.49 48 5 THR A 44 ? ? 50.85 -167.25 49 5 PRO A 65 ? ? -55.00 174.73 50 5 LEU A 70 ? ? -102.37 -65.69 51 5 ASP A 73 ? ? -48.63 109.28 52 5 ALA A 92 ? ? -57.43 -84.51 53 5 PRO A 95 ? ? -60.79 93.02 54 6 HIS A 3 ? ? -168.59 99.56 55 6 ASP A 23 ? ? -84.05 34.13 56 6 SER A 25 ? ? 58.35 15.92 57 6 GLN A 37 ? ? 62.74 -175.46 58 6 ALA A 43 ? ? -150.62 38.53 59 6 PRO A 65 ? ? -47.62 167.18 60 6 ASN A 66 ? ? 63.97 60.78 61 6 ASP A 73 ? ? -49.76 108.66 62 6 ALA A 92 ? ? -53.03 -81.61 63 6 PRO A 95 ? ? -61.94 98.38 64 7 ASP A 7 ? ? 57.23 85.15 65 7 PHE A 11 ? ? -58.12 102.54 66 7 GLU A 21 ? ? -169.39 26.45 67 7 THR A 40 ? ? -150.99 2.05 68 7 PRO A 65 ? ? -58.46 171.89 69 7 LEU A 70 ? ? -107.29 -64.38 70 7 ASP A 73 ? ? -47.24 109.21 71 7 ALA A 92 ? ? -56.97 -87.73 72 7 PRO A 95 ? ? -59.15 90.82 73 8 HIS A 3 ? ? 55.30 94.13 74 8 TYR A 5 ? ? -99.45 55.88 75 8 SER A 6 ? ? -68.84 95.11 76 8 ASP A 7 ? ? 56.65 85.59 77 8 GLU A 21 ? ? -155.69 -34.49 78 8 ASP A 23 ? ? -93.96 33.98 79 8 THR A 40 ? ? -161.94 7.43 80 8 ALA A 43 ? ? -136.75 -158.88 81 8 THR A 44 ? ? -59.61 175.79 82 8 PRO A 65 ? ? -57.20 172.18 83 8 ASP A 73 ? ? -47.67 108.81 84 8 GLN A 78 ? ? -96.71 38.31 85 8 ALA A 92 ? ? -59.68 -89.62 86 8 PRO A 95 ? ? -59.18 97.53 87 9 HIS A 3 ? ? 56.02 83.57 88 9 ASP A 23 ? ? -85.96 47.59 89 9 GLU A 42 ? ? -68.47 92.27 90 9 LEU A 70 ? ? -111.31 -73.75 91 9 ASP A 73 ? ? -44.25 109.00 92 9 ALA A 92 ? ? -48.90 -85.73 93 9 PRO A 95 ? ? -65.13 92.26 94 10 ASP A 7 ? ? 57.94 71.52 95 10 ASP A 23 ? ? -93.47 30.04 96 10 GLN A 37 ? ? -100.21 69.53 97 10 PRO A 65 ? ? -53.41 175.52 98 10 LEU A 70 ? ? -123.22 -61.59 99 10 ASP A 73 ? ? -46.82 108.44 100 10 GLN A 78 ? ? -96.23 34.12 101 10 ALA A 92 ? ? -53.19 -83.53 102 10 PRO A 95 ? ? -61.59 98.27 103 11 ASP A 23 ? ? -83.37 37.40 104 11 SER A 25 ? ? 59.54 15.72 105 11 ASP A 36 ? ? -146.99 11.87 106 11 SER A 38 ? ? -127.88 -158.85 107 11 PRO A 65 ? ? -55.34 -178.57 108 11 LEU A 70 ? ? -122.54 -66.13 109 11 ASP A 73 ? ? -46.81 107.98 110 11 ASP A 74 ? ? 49.12 22.43 111 11 ALA A 92 ? ? -54.94 -85.62 112 11 PRO A 95 ? ? -60.47 89.91 113 12 SER A 2 ? ? -90.32 -67.02 114 12 TYR A 5 ? ? -101.98 71.69 115 12 ASP A 7 ? ? 55.83 85.80 116 12 PHE A 11 ? ? -61.93 95.28 117 12 GLU A 21 ? ? -160.33 20.72 118 12 SER A 25 ? ? 58.34 16.65 119 12 THR A 39 ? ? 49.31 -165.25 120 12 PRO A 65 ? ? -48.68 157.80 121 12 GLN A 78 ? ? -97.53 33.95 122 12 ALA A 92 ? ? -54.02 -71.66 123 12 PRO A 95 ? ? -47.79 100.09 124 13 TYR A 5 ? ? 55.19 73.14 125 13 SER A 25 ? ? 59.26 19.89 126 13 GLN A 37 ? ? 57.63 88.31 127 13 SER A 38 ? ? -68.68 85.96 128 13 THR A 44 ? ? 49.51 -167.18 129 13 ILE A 46 ? ? 58.97 95.61 130 13 PRO A 53 ? ? -57.56 94.81 131 13 PRO A 65 ? ? -78.30 38.19 132 13 ASN A 66 ? ? -164.93 64.14 133 13 ASP A 73 ? ? -44.30 108.74 134 13 ALA A 92 ? ? -57.50 -86.22 135 13 PRO A 95 ? ? -66.45 81.61 136 14 HIS A 3 ? ? -96.40 -64.46 137 14 SER A 6 ? ? -106.13 -169.32 138 14 ASP A 7 ? ? -54.17 103.53 139 14 SER A 9 ? ? 56.86 19.11 140 14 ASP A 23 ? ? -95.63 51.91 141 14 SER A 38 ? ? -154.77 78.83 142 14 THR A 40 ? ? -168.88 14.79 143 14 GLU A 42 ? ? 58.36 -177.56 144 14 LEU A 70 ? ? -93.25 -63.79 145 14 ALA A 92 ? ? -62.44 -85.27 146 14 PRO A 95 ? ? -56.76 103.54 147 15 ASP A 7 ? ? -55.49 97.63 148 15 ASP A 23 ? ? -83.37 37.54 149 15 SER A 38 ? ? 53.94 71.46 150 15 ALA A 43 ? ? -166.55 56.20 151 15 LEU A 70 ? ? -113.03 -72.17 152 15 ASP A 73 ? ? -47.86 108.30 153 15 ASP A 74 ? ? 58.69 6.68 154 15 GLN A 78 ? ? -94.32 42.25 155 15 ALA A 92 ? ? -49.76 -80.26 156 16 SER A 2 ? ? -154.59 -72.85 157 16 HIS A 3 ? ? 55.53 82.68 158 16 ASP A 7 ? ? 56.40 81.64 159 16 PHE A 11 ? ? -50.65 103.98 160 16 GLU A 21 ? ? -150.93 13.76 161 16 ASP A 23 ? ? -90.62 57.92 162 16 SER A 25 ? ? 49.71 26.84 163 16 SER A 38 ? ? -59.94 103.23 164 16 GLU A 42 ? ? 58.98 -178.73 165 16 ALA A 43 ? ? -163.95 117.26 166 16 THR A 44 ? ? 50.20 -167.41 167 16 ASN A 66 ? ? 61.13 82.98 168 16 LEU A 70 ? ? -101.36 -61.51 169 16 GLN A 78 ? ? -86.77 31.62 170 16 ALA A 92 ? ? -55.49 -83.74 171 16 PRO A 95 ? ? -62.33 96.50 172 17 ASP A 7 ? ? -179.53 89.51 173 17 ALA A 8 ? ? -160.23 102.58 174 17 GLU A 21 ? ? -157.75 64.19 175 17 LYS A 22 ? ? -145.64 34.52 176 17 SER A 25 ? ? 49.62 24.84 177 17 ILE A 29 ? ? -58.93 108.56 178 17 ASP A 36 ? ? -149.67 -68.03 179 17 SER A 38 ? ? -65.52 95.62 180 17 ALA A 43 ? ? -168.53 39.03 181 17 PRO A 65 ? ? -54.66 174.38 182 17 LEU A 70 ? ? -104.12 -63.85 183 17 ASP A 73 ? ? -48.26 108.53 184 17 ASP A 74 ? ? 58.48 6.99 185 17 ALA A 92 ? ? -50.18 -78.72 186 17 PRO A 95 ? ? -65.90 93.23 187 18 ASP A 7 ? ? 55.04 88.07 188 18 PHE A 11 ? ? -62.00 98.16 189 18 GLU A 21 ? ? -141.61 -36.25 190 18 SER A 25 ? ? 58.00 18.56 191 18 ARG A 35 ? ? -150.48 77.49 192 18 ALA A 43 ? ? -163.71 80.43 193 18 PRO A 65 ? ? -59.27 178.05 194 18 LEU A 70 ? ? -100.99 -65.44 195 18 ASP A 74 ? ? 47.32 19.40 196 18 GLN A 78 ? ? -89.94 41.74 197 18 ALA A 92 ? ? -50.48 -84.18 198 18 PRO A 95 ? ? -61.43 92.22 199 19 TYR A 5 ? ? -119.79 62.53 200 19 ASP A 7 ? ? 54.29 74.19 201 19 SER A 9 ? ? -178.11 32.01 202 19 ALA A 43 ? ? -161.82 40.51 203 19 PRO A 65 ? ? -47.27 165.64 204 19 ASP A 73 ? ? -47.69 108.07 205 19 ASP A 74 ? ? 52.30 19.03 206 19 VAL A 77 ? ? -143.07 49.98 207 19 GLN A 78 ? ? -143.30 21.33 208 19 ALA A 92 ? ? -52.15 -83.84 209 20 SER A 2 ? ? 60.08 -178.99 210 20 TYR A 5 ? ? -68.02 91.35 211 20 GLU A 21 ? ? -147.63 11.25 212 20 SER A 25 ? ? 59.61 14.88 213 20 GLN A 37 ? ? -95.54 48.29 214 20 SER A 38 ? ? 54.21 77.73 215 20 GLU A 42 ? ? 57.30 88.53 216 20 PRO A 65 ? ? -78.81 36.95 217 20 ASN A 66 ? ? -169.29 75.93 218 20 ASP A 73 ? ? -41.60 108.11 219 20 ASP A 74 ? ? 56.66 2.76 220 20 ALA A 92 ? ? -54.33 -81.77 221 20 PRO A 95 ? ? -58.25 104.20 222 21 HIS A 3 ? ? -145.75 -4.42 223 21 ASP A 7 ? ? 56.54 79.88 224 21 ASP A 23 ? ? -86.70 42.98 225 21 ALA A 43 ? ? -163.93 -168.92 226 21 THR A 44 ? ? 48.31 -163.00 227 21 PRO A 65 ? ? -54.91 175.64 228 21 LEU A 70 ? ? -105.53 -68.75 229 21 GLN A 78 ? ? -97.51 41.46 230 21 ALA A 92 ? ? -58.38 -84.85 231 22 ASP A 7 ? ? 58.93 97.80 232 22 ASP A 23 ? ? -83.32 34.65 233 22 THR A 40 ? ? -164.76 9.52 234 22 THR A 44 ? ? 52.84 -171.92 235 22 GLN A 78 ? ? -95.26 31.03 236 22 ALA A 92 ? ? -54.53 -88.63 237 22 PRO A 95 ? ? -62.39 97.45 238 23 SER A 2 ? ? -151.39 -54.42 239 23 ASP A 7 ? ? 55.34 85.84 240 23 PHE A 11 ? ? -56.27 106.46 241 23 GLU A 21 ? ? -160.63 26.15 242 23 THR A 40 ? ? -146.05 -3.08 243 23 THR A 44 ? ? 52.13 -171.92 244 23 ARG A 62 ? ? -61.31 0.75 245 23 PRO A 65 ? ? -73.61 28.06 246 23 ASN A 66 ? ? -163.03 49.44 247 23 ASP A 73 ? ? -53.49 108.79 248 23 ALA A 92 ? ? -58.20 -86.85 249 23 PRO A 95 ? ? -61.47 99.38 250 24 HIS A 3 ? ? -165.12 88.48 251 24 ASP A 7 ? ? 58.36 75.82 252 24 GLU A 21 ? ? -168.07 -33.06 253 24 ASP A 23 ? ? -84.77 49.29 254 24 SER A 25 ? ? 56.41 18.04 255 24 ARG A 35 ? ? -160.43 65.22 256 24 ASP A 36 ? ? -66.99 -177.34 257 24 SER A 38 ? ? 51.18 -164.97 258 24 ALA A 43 ? ? 57.06 88.70 259 24 ASP A 73 ? ? -49.15 108.66 260 24 GLN A 78 ? ? -94.25 31.64 261 24 ALA A 92 ? ? -58.03 -87.24 262 24 PRO A 95 ? ? -62.86 89.53 263 25 HIS A 3 ? ? -164.69 100.64 264 25 GLU A 21 ? ? -113.51 -70.26 265 25 ARG A 35 ? ? -144.04 42.12 266 25 SER A 38 ? ? 60.33 -178.87 267 25 THR A 39 ? ? 53.56 -172.74 268 25 PRO A 65 ? ? -57.08 176.97 269 25 LEU A 70 ? ? -114.97 -71.77 270 25 ASP A 73 ? ? -46.70 108.70 271 25 ASP A 74 ? ? 53.41 14.52 272 25 ALA A 92 ? ? -56.77 -83.51 273 25 PRO A 95 ? ? -57.39 92.47 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 25 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2JRE _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2JRE _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1 mM [U-100% 13C; U-100% 15N] protein, 50 mM sodium chloride, 25 mM sodium phosphate, 0.02 % sodium azide, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '1 mM [U-100% 13C; U-100% 15N] protein, 50 mM sodium chloride, 25 mM sodium phosphate, 0.02 % sodium azide, 100% D2O' 2 '100% D2O' '1 mM [U-10% 13C] protein, 50 mM sodium chloride, 25 mM sodium phosphate, 0.02 % sodium azide, 90% H2O/10% D2O' 3 '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id entity 1 mM '[U-100% 13C; U-100% 15N]' 1 'sodium chloride' 50 mM ? 1 'sodium phosphate' 25 mM ? 1 'sodium azide' 0.02 % ? 1 entity 1 mM '[U-100% 13C; U-100% 15N]' 2 'sodium chloride' 50 mM ? 2 'sodium phosphate' 25 mM ? 2 'sodium azide' 0.02 % ? 2 entity 1 mM '[U-10% 13C]' 3 'sodium chloride' 50 mM ? 3 'sodium phosphate' 25 mM ? 3 'sodium azide' 0.02 % ? 3 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 288 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D 1H-15N NOESY' 1 2 2 '3D 1H-13C NOESY' 1 3 1 '2D 1H-15N HSQC' 1 4 3 '2D 1H-13C HSQC' 1 5 1 '3D CBCA(CO)NH' 1 6 1 '3D HNCACB' 1 7 1 '3D HNCO' 1 8 1 '3D C(CO)NH' 1 9 1 '3D H(CCO)NH' 1 10 2 '3D HCCH-TOCSY' 2 11 1 '2D 1H-15N HSQC' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2JRE _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count 64 _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1718 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 675 _pdbx_nmr_constraints.NOE_long_range_total_count 430 _pdbx_nmr_constraints.NOE_medium_range_total_count 152 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 378 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 51 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 51 # _pdbx_nmr_refine.entry_id 2JRE _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal ;Linge, O'Donoghue and Nilges ; 'structure solution' ARIA 1.2 1 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' CNS 1.1 2 'Johnson, One Moon Scientific' 'peak picking' NMRView ? 3 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 4 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS 1.1 5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TYR N N N N 304 TYR CA C N S 305 TYR C C N N 306 TYR O O N N 307 TYR CB C N N 308 TYR CG C Y N 309 TYR CD1 C Y N 310 TYR CD2 C Y N 311 TYR CE1 C Y N 312 TYR CE2 C Y N 313 TYR CZ C Y N 314 TYR OH O N N 315 TYR OXT O N N 316 TYR H H N N 317 TYR H2 H N N 318 TYR HA H N N 319 TYR HB2 H N N 320 TYR HB3 H N N 321 TYR HD1 H N N 322 TYR HD2 H N N 323 TYR HE1 H N N 324 TYR HE2 H N N 325 TYR HH H N N 326 TYR HXT H N N 327 VAL N N N N 328 VAL CA C N S 329 VAL C C N N 330 VAL O O N N 331 VAL CB C N N 332 VAL CG1 C N N 333 VAL CG2 C N N 334 VAL OXT O N N 335 VAL H H N N 336 VAL H2 H N N 337 VAL HA H N N 338 VAL HB H N N 339 VAL HG11 H N N 340 VAL HG12 H N N 341 VAL HG13 H N N 342 VAL HG21 H N N 343 VAL HG22 H N N 344 VAL HG23 H N N 345 VAL HXT H N N 346 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TYR N CA sing N N 291 TYR N H sing N N 292 TYR N H2 sing N N 293 TYR CA C sing N N 294 TYR CA CB sing N N 295 TYR CA HA sing N N 296 TYR C O doub N N 297 TYR C OXT sing N N 298 TYR CB CG sing N N 299 TYR CB HB2 sing N N 300 TYR CB HB3 sing N N 301 TYR CG CD1 doub Y N 302 TYR CG CD2 sing Y N 303 TYR CD1 CE1 sing Y N 304 TYR CD1 HD1 sing N N 305 TYR CD2 CE2 doub Y N 306 TYR CD2 HD2 sing N N 307 TYR CE1 CZ doub Y N 308 TYR CE1 HE1 sing N N 309 TYR CE2 CZ sing Y N 310 TYR CE2 HE2 sing N N 311 TYR CZ OH sing N N 312 TYR OH HH sing N N 313 TYR OXT HXT sing N N 314 VAL N CA sing N N 315 VAL N H sing N N 316 VAL N H2 sing N N 317 VAL CA C sing N N 318 VAL CA CB sing N N 319 VAL CA HA sing N N 320 VAL C O doub N N 321 VAL C OXT sing N N 322 VAL CB CG1 sing N N 323 VAL CB CG2 sing N N 324 VAL CB HB sing N N 325 VAL CG1 HG11 sing N N 326 VAL CG1 HG12 sing N N 327 VAL CG1 HG13 sing N N 328 VAL CG2 HG21 sing N N 329 VAL CG2 HG22 sing N N 330 VAL CG2 HG23 sing N N 331 VAL OXT HXT sing N N 332 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Varian UNITY 1 'Varian Unity' 500 Varian UNITY 2 'Varian Unity' # _atom_sites.entry_id 2JRE _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_