data_2JRR # _entry.id 2JRR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2JRR pdb_00002jrr 10.2210/pdb2jrr/pdb RCSB RCSB100207 ? ? WWPDB D_1000100207 ? ? BMRB 15341 ? 10.13018/BMR15341 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-07-17 2 'Structure model' 1 1 2008-04-28 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2020-02-19 5 'Structure model' 1 4 2023-06-14 6 'Structure model' 1 5 2023-12-20 7 'Structure model' 1 6 2024-05-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' Other 7 5 'Structure model' 'Database references' 8 5 'Structure model' Other 9 6 'Structure model' 'Data collection' 10 6 'Structure model' Other 11 7 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_nmr_software 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_ref_seq_dif 7 5 'Structure model' database_2 8 5 'Structure model' pdbx_database_status 9 6 'Structure model' chem_comp_atom 10 6 'Structure model' chem_comp_bond 11 6 'Structure model' pdbx_database_status 12 7 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_database_status.status_code_cs' 2 4 'Structure model' '_pdbx_nmr_software.name' 3 4 'Structure model' '_struct_ref_seq_dif.details' 4 5 'Structure model' '_database_2.pdbx_DOI' 5 5 'Structure model' '_database_2.pdbx_database_accession' 6 5 'Structure model' '_pdbx_database_status.status_code_nmr_data' 7 6 'Structure model' '_pdbx_database_status.deposit_site' 8 7 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site RCSB _pdbx_database_status.entry_id 2JRR _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2007-06-28 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type TargetDB SiR90 . unspecified BMRB 15341 . unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Swapna, G.V.T.' 1 'Tejero, R.' 2 'Jiang, M.' 3 'Cunningham, K.' 4 'Maglaqui, M.' 5 'Owens, L.' 6 'Liu, J.' 7 'Wang, H.' 8 'Acton, T.B.' 9 'Xiao, R.' 10 'Baran, M.C.' 11 'Rost, B.' 12 'Montelione, G.T.' 13 'Northeast Structural Genomics Consortium (NESG)' 14 # _citation.id primary _citation.title 'Solution NMR Structure of Q5LLS5 from Silicibacter pomeroyi.' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Swapna, G.V.T.' 1 ? primary 'Tejero, R.' 2 ? primary 'Jiang, M.' 3 ? primary 'Cunningham, K.' 4 ? primary 'Maglaqui, M.' 5 ? primary 'Owens, L.' 6 ? primary 'Liu, J.' 7 ? primary 'Wang, H.' 8 ? primary 'Acton, T.B.' 9 ? primary 'Xiao, R.' 10 ? primary 'Baran, M.B.' 11 ? primary 'Rost, B.' 12 ? primary 'Montelione, G.T.' 13 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Uncharacterized protein' _entity.formula_weight 7516.512 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MTIQAPETKIVDKSRVACDGGEGALGHPRVWLQIPEDTGWVECPYCDCKYVLKGSKADALEHHHHHH _entity_poly.pdbx_seq_one_letter_code_can MTIQAPETKIVDKSRVACDGGEGALGHPRVWLQIPEDTGWVECPYCDCKYVLKGSKADALEHHHHHH _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier SiR90 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 THR n 1 3 ILE n 1 4 GLN n 1 5 ALA n 1 6 PRO n 1 7 GLU n 1 8 THR n 1 9 LYS n 1 10 ILE n 1 11 VAL n 1 12 ASP n 1 13 LYS n 1 14 SER n 1 15 ARG n 1 16 VAL n 1 17 ALA n 1 18 CYS n 1 19 ASP n 1 20 GLY n 1 21 GLY n 1 22 GLU n 1 23 GLY n 1 24 ALA n 1 25 LEU n 1 26 GLY n 1 27 HIS n 1 28 PRO n 1 29 ARG n 1 30 VAL n 1 31 TRP n 1 32 LEU n 1 33 GLN n 1 34 ILE n 1 35 PRO n 1 36 GLU n 1 37 ASP n 1 38 THR n 1 39 GLY n 1 40 TRP n 1 41 VAL n 1 42 GLU n 1 43 CYS n 1 44 PRO n 1 45 TYR n 1 46 CYS n 1 47 ASP n 1 48 CYS n 1 49 LYS n 1 50 TYR n 1 51 VAL n 1 52 LEU n 1 53 LYS n 1 54 GLY n 1 55 SER n 1 56 LYS n 1 57 ALA n 1 58 ASP n 1 59 ALA n 1 60 LEU n 1 61 GLU n 1 62 HIS n 1 63 HIS n 1 64 HIS n 1 65 HIS n 1 66 HIS n 1 67 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Silicibacter _entity_src_gen.pdbx_gene_src_gene SP03846 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'DSS-3, DSM 15171' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Silicibacter pomeroyi' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 89184 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc 700808 _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)MAGIC' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector SiR90-21.0 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET21 _entity_src_gen.plasmid_details Plasmid _entity_src_gen.pdbx_description 'The protein is a monomer by gel filtration chromatography and static light scattering.' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 GLN 4 4 4 GLN GLN A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 PRO 6 6 6 PRO PRO A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 HIS 27 27 27 HIS HIS A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 TRP 31 31 31 TRP TRP A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 TRP 40 40 40 TRP TRP A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 CYS 43 43 43 CYS CYS A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 TYR 45 45 45 TYR TYR A . n A 1 46 CYS 46 46 46 CYS CYS A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 CYS 48 48 48 CYS CYS A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 TYR 50 50 50 TYR TYR A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 HIS 62 62 62 HIS HIS A . n A 1 63 HIS 63 63 63 HIS HIS A . n A 1 64 HIS 64 64 64 HIS HIS A . n A 1 65 HIS 65 65 65 HIS HIS A . n A 1 66 HIS 66 66 66 HIS HIS A . n A 1 67 HIS 67 67 67 HIS HIS A . n # _exptl.entry_id 2JRR _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2JRR _struct.title 'Solution NMR Structure of Q5LLS5 from Silicibacter pomeroyi. Northeast Structural Genomics Consortium target SiR90' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2JRR _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;solution NMR Structure, Protein, SiR90, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q5LLS5_SILPO _struct_ref.pdbx_db_accession Q5LLS5 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MTIQAPETKIVDKSRVACDGGEGALGHPRVWLQIPEDTGWVECPYCDCKYVLKGSKADA _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2JRR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 59 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q5LLS5 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 59 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 59 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2JRR LEU A 60 ? UNP Q5LLS5 ? ? 'cloning artifact' 60 1 1 2JRR GLU A 61 ? UNP Q5LLS5 ? ? 'cloning artifact' 61 2 1 2JRR HIS A 62 ? UNP Q5LLS5 ? ? 'cloning artifact' 62 3 1 2JRR HIS A 63 ? UNP Q5LLS5 ? ? 'cloning artifact' 63 4 1 2JRR HIS A 64 ? UNP Q5LLS5 ? ? 'cloning artifact' 64 5 1 2JRR HIS A 65 ? UNP Q5LLS5 ? ? 'cloning artifact' 65 6 1 2JRR HIS A 66 ? UNP Q5LLS5 ? ? 'cloning artifact' 66 7 1 2JRR HIS A 67 ? UNP Q5LLS5 ? ? 'cloning artifact' 67 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id SER _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 55 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ALA _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 59 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id SER _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 55 _struct_conf.end_auth_comp_id ALA _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 59 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 7 ? VAL A 11 ? GLU A 7 VAL A 11 A 2 CYS A 48 ? LEU A 52 ? CYS A 48 LEU A 52 A 3 TRP A 40 ? CYS A 43 ? TRP A 40 CYS A 43 B 1 ARG A 15 ? GLY A 20 ? ARG A 15 GLY A 20 B 2 GLY A 26 ? GLN A 33 ? GLY A 26 GLN A 33 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 11 ? N VAL A 11 O VAL A 51 ? O VAL A 51 A 2 3 O TYR A 50 ? O TYR A 50 N VAL A 41 ? N VAL A 41 B 1 2 N VAL A 16 ? N VAL A 16 O LEU A 32 ? O LEU A 32 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 3 ? ? 47.34 13.26 2 1 GLN A 4 ? ? 54.60 -165.08 3 1 ALA A 5 ? ? -150.58 88.39 4 1 PRO A 6 ? ? -63.08 85.77 5 1 ASP A 19 ? ? -132.96 -66.35 6 1 ARG A 29 ? ? 77.06 99.13 7 1 THR A 38 ? ? -131.16 -38.82 8 1 PRO A 44 ? ? -69.06 15.61 9 1 TYR A 45 ? ? -96.13 -72.21 10 1 GLU A 61 ? ? 69.30 -75.57 11 1 HIS A 64 ? ? -151.17 -52.28 12 1 HIS A 66 ? ? 44.60 -164.19 13 2 GLN A 4 ? ? 66.51 -76.74 14 2 ALA A 5 ? ? 62.24 103.16 15 2 PRO A 6 ? ? -60.03 87.83 16 2 ASP A 19 ? ? -69.29 -75.21 17 2 ARG A 29 ? ? 179.28 92.27 18 2 TYR A 45 ? ? -99.87 -87.64 19 2 CYS A 46 ? ? -169.78 22.27 20 2 ASP A 47 ? ? -87.75 -88.23 21 2 ALA A 59 ? ? -155.78 18.95 22 2 HIS A 64 ? ? 71.46 -47.86 23 3 ILE A 3 ? ? 70.08 -22.90 24 3 ALA A 5 ? ? -153.45 52.23 25 3 PRO A 6 ? ? -65.91 91.23 26 3 CYS A 18 ? ? -119.46 -164.93 27 3 GLU A 22 ? ? -98.98 -152.76 28 3 PRO A 28 ? ? -17.49 -57.71 29 3 ARG A 29 ? ? 172.20 88.98 30 3 TYR A 45 ? ? -108.96 -93.58 31 3 ASP A 47 ? ? -90.14 -107.39 32 3 HIS A 63 ? ? -171.91 100.05 33 3 HIS A 64 ? ? -156.18 -80.91 34 4 THR A 2 ? ? 58.94 10.70 35 4 GLN A 4 ? ? 62.83 -71.61 36 4 ALA A 5 ? ? 66.57 82.62 37 4 ARG A 29 ? ? 174.48 89.94 38 4 ASP A 47 ? ? 57.70 78.26 39 4 LYS A 53 ? ? -58.91 102.50 40 4 ALA A 59 ? ? 59.42 79.42 41 4 HIS A 64 ? ? -69.56 96.36 42 5 ILE A 3 ? ? -69.94 13.96 43 5 GLN A 4 ? ? 63.25 92.76 44 5 ALA A 5 ? ? -172.96 62.94 45 5 PRO A 6 ? ? -79.58 29.98 46 5 LEU A 25 ? ? 50.41 5.62 47 5 ARG A 29 ? ? 64.25 86.93 48 5 TYR A 45 ? ? -87.33 -89.90 49 5 CYS A 46 ? ? -152.45 82.62 50 5 ASP A 47 ? ? -149.98 -90.22 51 5 CYS A 48 ? ? 179.80 -176.92 52 5 SER A 55 ? ? -151.03 -150.99 53 5 HIS A 65 ? ? -66.59 72.47 54 5 HIS A 66 ? ? 161.19 -32.05 55 6 PRO A 6 ? ? -46.69 99.20 56 6 ASP A 19 ? ? -85.90 -76.65 57 6 LEU A 25 ? ? 71.85 -19.71 58 6 PRO A 28 ? ? -56.22 93.54 59 6 ARG A 29 ? ? 81.72 102.69 60 6 CYS A 46 ? ? -146.10 -7.17 61 6 ALA A 59 ? ? -78.39 36.05 62 6 GLU A 61 ? ? 49.10 121.16 63 6 HIS A 62 ? ? -82.57 40.35 64 6 HIS A 64 ? ? 71.03 134.58 65 7 ILE A 3 ? ? 72.92 -40.16 66 7 PRO A 6 ? ? -86.92 31.05 67 7 GLU A 7 ? ? 51.11 103.83 68 7 ASP A 19 ? ? -66.28 -84.99 69 7 ARG A 29 ? ? 59.74 85.75 70 7 CYS A 46 ? ? -120.08 -91.00 71 7 ASP A 47 ? ? -173.91 19.11 72 7 GLU A 61 ? ? 68.79 -59.95 73 7 HIS A 66 ? ? 81.92 91.89 74 8 THR A 2 ? ? -127.03 -58.08 75 8 ILE A 3 ? ? 72.92 -22.73 76 8 ALA A 5 ? ? -159.85 56.69 77 8 PRO A 6 ? ? -80.90 39.20 78 8 GLU A 22 ? ? -112.04 -149.91 79 8 LEU A 25 ? ? 43.22 26.87 80 8 PRO A 28 ? ? -72.70 48.57 81 8 ARG A 29 ? ? 67.37 85.97 82 8 GLU A 61 ? ? -88.79 -73.44 83 8 HIS A 63 ? ? 69.34 -15.12 84 9 GLN A 4 ? ? 49.08 19.75 85 9 PRO A 6 ? ? -88.04 32.77 86 9 ASP A 19 ? ? -89.94 -75.30 87 9 ARG A 29 ? ? 177.27 93.18 88 9 CYS A 46 ? ? 83.20 31.24 89 9 CYS A 48 ? ? 66.72 -161.92 90 9 ALA A 59 ? ? -133.33 -58.70 91 9 LEU A 60 ? ? -121.85 -68.46 92 9 GLU A 61 ? ? 52.64 -147.53 93 9 HIS A 63 ? ? -64.59 98.22 94 9 HIS A 66 ? ? 66.72 123.95 95 10 GLN A 4 ? ? 65.45 101.19 96 10 PRO A 6 ? ? -66.59 86.81 97 10 ASP A 19 ? ? -83.49 -80.07 98 10 PRO A 28 ? ? -72.20 31.50 99 10 ARG A 29 ? ? 76.69 98.07 100 10 HIS A 62 ? ? -169.38 85.58 101 10 HIS A 65 ? ? -69.12 90.52 102 11 GLN A 4 ? ? 70.84 -84.59 103 11 PRO A 6 ? ? -83.10 37.97 104 11 GLU A 7 ? ? -124.05 -159.62 105 11 CYS A 18 ? ? -85.39 -158.38 106 11 ASP A 19 ? ? 66.92 89.51 107 11 ARG A 29 ? ? -179.42 85.38 108 11 ASP A 58 ? ? -126.91 -162.76 109 11 ALA A 59 ? ? 71.83 45.11 110 12 GLN A 4 ? ? 59.74 80.39 111 12 ALA A 5 ? ? -169.63 -52.49 112 12 PRO A 28 ? ? -63.83 64.64 113 12 ARG A 29 ? ? 49.61 81.53 114 12 SER A 55 ? ? -107.29 -166.65 115 12 ALA A 59 ? ? 63.22 77.51 116 12 HIS A 66 ? ? -175.45 124.29 117 13 THR A 2 ? ? -78.62 24.93 118 13 ILE A 3 ? ? 66.31 -5.27 119 13 PRO A 6 ? ? -67.77 97.34 120 13 GLU A 7 ? ? -23.13 103.75 121 13 ARG A 29 ? ? 178.43 85.41 122 13 ASP A 47 ? ? 71.96 -4.85 123 13 LEU A 60 ? ? 61.85 101.00 124 13 GLU A 61 ? ? 69.07 159.73 125 13 HIS A 66 ? ? 67.87 -163.39 126 14 ILE A 3 ? ? 74.40 -20.06 127 14 GLN A 4 ? ? 73.97 -52.33 128 14 ALA A 5 ? ? 60.16 69.77 129 14 CYS A 18 ? ? -63.70 98.70 130 14 ALA A 24 ? ? -80.84 31.23 131 14 PRO A 28 ? ? -69.10 -72.80 132 14 ARG A 29 ? ? -179.08 94.64 133 14 TYR A 45 ? ? -78.36 -92.92 134 14 CYS A 46 ? ? -172.41 81.38 135 14 ASP A 47 ? ? -136.80 -95.72 136 14 ALA A 59 ? ? 71.08 102.59 137 14 GLU A 61 ? ? 73.42 -82.50 138 15 GLN A 4 ? ? 64.12 -86.10 139 15 ALA A 5 ? ? 46.63 79.28 140 15 PRO A 6 ? ? -64.92 76.72 141 15 GLU A 7 ? ? 55.66 103.27 142 15 PRO A 28 ? ? -72.08 49.34 143 15 ARG A 29 ? ? 64.13 90.72 144 15 TYR A 45 ? ? -94.51 -83.62 145 15 CYS A 46 ? ? -168.14 18.47 146 15 ASP A 47 ? ? -66.60 -79.17 147 15 HIS A 63 ? ? -171.19 -45.80 148 16 GLN A 4 ? ? 68.69 141.59 149 16 ALA A 5 ? ? 61.61 73.91 150 16 ASP A 19 ? ? -69.70 -76.48 151 16 ARG A 29 ? ? 58.60 88.07 152 16 TYR A 45 ? ? -82.83 -76.15 153 16 CYS A 46 ? ? 173.86 92.33 154 16 ASP A 47 ? ? -161.02 -83.03 155 16 HIS A 66 ? ? -147.86 19.00 156 17 ASP A 19 ? ? -98.70 -73.49 157 17 ARG A 29 ? ? 75.16 99.13 158 17 PRO A 44 ? ? -73.13 22.44 159 17 TYR A 45 ? ? -114.94 -88.70 160 17 CYS A 46 ? ? -160.57 18.98 161 17 ASP A 47 ? ? -81.74 -93.50 162 17 ALA A 59 ? ? -153.69 -17.86 163 17 LEU A 60 ? ? -60.64 -73.72 164 17 HIS A 64 ? ? -50.39 108.66 165 17 HIS A 65 ? ? 63.71 -88.88 166 17 HIS A 66 ? ? -148.73 -35.14 167 18 ALA A 5 ? ? -59.47 106.60 168 18 PRO A 6 ? ? -91.77 30.81 169 18 ARG A 29 ? ? -177.78 91.57 170 18 CYS A 46 ? ? -143.90 -2.20 171 18 ASP A 47 ? ? 70.95 -41.17 172 18 ASP A 58 ? ? -117.48 -136.31 173 18 GLU A 61 ? ? -65.78 90.51 174 18 HIS A 63 ? ? -175.69 -35.06 175 18 HIS A 64 ? ? -63.98 92.58 176 18 HIS A 65 ? ? -172.09 -24.04 177 19 ILE A 3 ? ? 37.22 70.65 178 19 GLN A 4 ? ? -45.82 106.09 179 19 ALA A 5 ? ? -165.72 -53.85 180 19 PRO A 6 ? ? -81.48 37.11 181 19 GLU A 7 ? ? -91.72 31.72 182 19 ASP A 19 ? ? 62.97 84.89 183 19 HIS A 27 ? ? 66.24 83.10 184 19 ARG A 29 ? ? 176.84 83.89 185 19 ALA A 59 ? ? 69.96 86.01 186 19 HIS A 64 ? ? 63.25 -76.81 187 19 HIS A 65 ? ? -171.90 133.49 188 20 GLN A 4 ? ? 70.83 -70.57 189 20 PRO A 6 ? ? -68.61 94.80 190 20 GLU A 7 ? ? -41.08 105.62 191 20 ARG A 29 ? ? 60.79 88.78 192 20 TYR A 45 ? ? -90.05 -67.71 193 20 ASP A 47 ? ? 69.06 101.35 194 20 LEU A 60 ? ? 69.70 -29.50 195 20 HIS A 63 ? ? 79.04 -33.45 196 20 HIS A 64 ? ? 69.20 143.77 # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' # _pdbx_nmr_ensemble.entry_id 2JRR _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_ensemble_rms.atom_type ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.chain_range_begin ? _pdbx_nmr_ensemble_rms.chain_range_end ? _pdbx_nmr_ensemble_rms.coord_average_rmsd_method ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error ? _pdbx_nmr_ensemble_rms.distance_rms_dev 0.02 _pdbx_nmr_ensemble_rms.distance_rms_dev_error ? _pdbx_nmr_ensemble_rms.entry_id 2JRR _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev ? _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error ? _pdbx_nmr_ensemble_rms.residue_range_begin ? _pdbx_nmr_ensemble_rms.residue_range_end ? # _pdbx_nmr_representative.entry_id 2JRR _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 '0.65 mM 5% 13C, 100% 15N SiR90, 10 mM Tris, 5 mM DTT, 100 mM NaCl, 95% H2O/5% D2O' ? 2 '0.65 mM [U-100% 13C; U-100% 15N] SiR90, 10 mM Tris, 5 mM DTT, 100 mM NaCl, 95% H2O/5% D2O' ? 3 '0.65 mM [U-100% 13C; U-100% 15N] SiR90, 10 mM Tris, 5 mM DTT, 100 mM NaCl, 100% D2O' ? # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id SiR90 0.65 mM '5% 13C, 100% 15N' 1 Tris 10 mM ? 1 DTT 5 mM ? 1 NaCl 100 mM ? 1 SiR90 0.65 mM '[U-100% 13C; U-100% 15N]' 2 Tris 10 mM ? 2 DTT 5 mM ? 2 NaCl 100 mM ? 2 SiR90 0.65 mM '[U-100% 13C; U-100% 15N]' 3 Tris 10 mM ? 3 DTT 5 mM ? 3 NaCl 100 mM ? 3 # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.temperature_units 1 293 ? ambient 6.5 100 K 2 293 ? ambient 6.5 100 K 3 293 ? ambient 6.5 100 K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 2 '2D 1H-15N HSQC' 1 2 2 '2D 1H-13C HSQC' 1 3 1 '2D 1H-15N HSQC' 2 4 1 '2D 1H-13C HSQC' 2 5 1 '3D CBCA(CO)NH' 2 6 1 '3D HNCACB' 2 7 1 '3D HBHA(CO)NH' 2 8 1 '3D HNHA' 2 9 1 '3D HCCH-TOCSY' 2 10 1 '3D 1H-15N NOESY' 2 11 1 '3D 1H-13C NOESY' 2 12 3 '2D 1H-15N HSQC' 3 # _pdbx_nmr_refine.entry_id 2JRR _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;The structures are based on a total of 819 conformationally restricting NOE-derived distance constraints, 52 dihedral angle constraints, and 26 hydrogen bond constraints.(14.5 constraints per residue, 5.2 long-range constraints per residue, computed for residues 1-62 by PSVS 1.3). Residues 62-67 correspond to the Histidines of the C-terminal tag and could not be assigned. Structure determination was performed iteratively using AutoStructure (XPLOR-NIH). After a final XPLOR calculation using the constraints derived from AutoStructure, the 20 lowest energy structures out of 100 were further refined by restrained Molecular dynamics/Energy minimization in explicit water (CNS). The C-terminal HIS-tag residues of the protein were included in the calculations as well as the deposition. Coordinates for the following residues are not well determined: 1-7,18-29,46-48,58-67. The structure was determined using standard Triple resonance NMR experiments. Automated backbone assignments were made using AutoAssign and the sidechain assignments were completed manually. Automatic NOESY assignments as well as distance, dihedral angle and hydrogen-bond constraints were determined using AutoStructure. Structure quality factors, where ordered residues comprise: 8-17,30-45,49-57. RMSD of BB 0.5A, heavy atoms 1.0A. Ramachandran statistics for ordered residues: Most favoured: 91.1%, Additionally allowed: 8.9%, Generally allowed: 0.0%, Unfavourable: 0%. Procheck scores for ordered residues (raw/Z) phi-psi: -0.56/-1.89; all -0.33/-1.95. Molprobity clash score (raw/Z) 17.48/-1.47. RPF scores for goodness of fit to NOESY data: recall: 0.943, precision: 0.92, F-measure: 0.93. Final DP-score 0.795. ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal 'structure validation' PSVS 1.3 'Bhattacharya , Hang and Montelione' 1 'data analysis' PdbStat 4.1 'Roberto Tejero and Montelione' 2 refinement CNS 1.1 'Brunger, Adams, Clore, Gros, Nilges and Read' 3 refinement 'X-PLOR NIH' 2.11.2 'Schwieters, Kuszewski, Tjandra and Clore' 4 refinement AutoStructure 2.1.1 'Huang, Tejero, Powers and Montelione' 5 'structure solution' AutoStructure 2.1.1 'Huang, Tejero, Powers and Montelione' 6 processing NMRPipe 2.3 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 7 'data analysis' Sparky 3.110 Goddard 8 collection VNMR 6.1c Varian 9 'chemical shift assignment' AutoAssign 2.2.1 'Zimmerman, Moseley, Kulikowski and Montelione' 10 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 CYS N N N N 57 CYS CA C N R 58 CYS C C N N 59 CYS O O N N 60 CYS CB C N N 61 CYS SG S N N 62 CYS OXT O N N 63 CYS H H N N 64 CYS H2 H N N 65 CYS HA H N N 66 CYS HB2 H N N 67 CYS HB3 H N N 68 CYS HG H N N 69 CYS HXT H N N 70 GLN N N N N 71 GLN CA C N S 72 GLN C C N N 73 GLN O O N N 74 GLN CB C N N 75 GLN CG C N N 76 GLN CD C N N 77 GLN OE1 O N N 78 GLN NE2 N N N 79 GLN OXT O N N 80 GLN H H N N 81 GLN H2 H N N 82 GLN HA H N N 83 GLN HB2 H N N 84 GLN HB3 H N N 85 GLN HG2 H N N 86 GLN HG3 H N N 87 GLN HE21 H N N 88 GLN HE22 H N N 89 GLN HXT H N N 90 GLU N N N N 91 GLU CA C N S 92 GLU C C N N 93 GLU O O N N 94 GLU CB C N N 95 GLU CG C N N 96 GLU CD C N N 97 GLU OE1 O N N 98 GLU OE2 O N N 99 GLU OXT O N N 100 GLU H H N N 101 GLU H2 H N N 102 GLU HA H N N 103 GLU HB2 H N N 104 GLU HB3 H N N 105 GLU HG2 H N N 106 GLU HG3 H N N 107 GLU HE2 H N N 108 GLU HXT H N N 109 GLY N N N N 110 GLY CA C N N 111 GLY C C N N 112 GLY O O N N 113 GLY OXT O N N 114 GLY H H N N 115 GLY H2 H N N 116 GLY HA2 H N N 117 GLY HA3 H N N 118 GLY HXT H N N 119 HIS N N N N 120 HIS CA C N S 121 HIS C C N N 122 HIS O O N N 123 HIS CB C N N 124 HIS CG C Y N 125 HIS ND1 N Y N 126 HIS CD2 C Y N 127 HIS CE1 C Y N 128 HIS NE2 N Y N 129 HIS OXT O N N 130 HIS H H N N 131 HIS H2 H N N 132 HIS HA H N N 133 HIS HB2 H N N 134 HIS HB3 H N N 135 HIS HD1 H N N 136 HIS HD2 H N N 137 HIS HE1 H N N 138 HIS HE2 H N N 139 HIS HXT H N N 140 ILE N N N N 141 ILE CA C N S 142 ILE C C N N 143 ILE O O N N 144 ILE CB C N S 145 ILE CG1 C N N 146 ILE CG2 C N N 147 ILE CD1 C N N 148 ILE OXT O N N 149 ILE H H N N 150 ILE H2 H N N 151 ILE HA H N N 152 ILE HB H N N 153 ILE HG12 H N N 154 ILE HG13 H N N 155 ILE HG21 H N N 156 ILE HG22 H N N 157 ILE HG23 H N N 158 ILE HD11 H N N 159 ILE HD12 H N N 160 ILE HD13 H N N 161 ILE HXT H N N 162 LEU N N N N 163 LEU CA C N S 164 LEU C C N N 165 LEU O O N N 166 LEU CB C N N 167 LEU CG C N N 168 LEU CD1 C N N 169 LEU CD2 C N N 170 LEU OXT O N N 171 LEU H H N N 172 LEU H2 H N N 173 LEU HA H N N 174 LEU HB2 H N N 175 LEU HB3 H N N 176 LEU HG H N N 177 LEU HD11 H N N 178 LEU HD12 H N N 179 LEU HD13 H N N 180 LEU HD21 H N N 181 LEU HD22 H N N 182 LEU HD23 H N N 183 LEU HXT H N N 184 LYS N N N N 185 LYS CA C N S 186 LYS C C N N 187 LYS O O N N 188 LYS CB C N N 189 LYS CG C N N 190 LYS CD C N N 191 LYS CE C N N 192 LYS NZ N N N 193 LYS OXT O N N 194 LYS H H N N 195 LYS H2 H N N 196 LYS HA H N N 197 LYS HB2 H N N 198 LYS HB3 H N N 199 LYS HG2 H N N 200 LYS HG3 H N N 201 LYS HD2 H N N 202 LYS HD3 H N N 203 LYS HE2 H N N 204 LYS HE3 H N N 205 LYS HZ1 H N N 206 LYS HZ2 H N N 207 LYS HZ3 H N N 208 LYS HXT H N N 209 MET N N N N 210 MET CA C N S 211 MET C C N N 212 MET O O N N 213 MET CB C N N 214 MET CG C N N 215 MET SD S N N 216 MET CE C N N 217 MET OXT O N N 218 MET H H N N 219 MET H2 H N N 220 MET HA H N N 221 MET HB2 H N N 222 MET HB3 H N N 223 MET HG2 H N N 224 MET HG3 H N N 225 MET HE1 H N N 226 MET HE2 H N N 227 MET HE3 H N N 228 MET HXT H N N 229 PRO N N N N 230 PRO CA C N S 231 PRO C C N N 232 PRO O O N N 233 PRO CB C N N 234 PRO CG C N N 235 PRO CD C N N 236 PRO OXT O N N 237 PRO H H N N 238 PRO HA H N N 239 PRO HB2 H N N 240 PRO HB3 H N N 241 PRO HG2 H N N 242 PRO HG3 H N N 243 PRO HD2 H N N 244 PRO HD3 H N N 245 PRO HXT H N N 246 SER N N N N 247 SER CA C N S 248 SER C C N N 249 SER O O N N 250 SER CB C N N 251 SER OG O N N 252 SER OXT O N N 253 SER H H N N 254 SER H2 H N N 255 SER HA H N N 256 SER HB2 H N N 257 SER HB3 H N N 258 SER HG H N N 259 SER HXT H N N 260 THR N N N N 261 THR CA C N S 262 THR C C N N 263 THR O O N N 264 THR CB C N R 265 THR OG1 O N N 266 THR CG2 C N N 267 THR OXT O N N 268 THR H H N N 269 THR H2 H N N 270 THR HA H N N 271 THR HB H N N 272 THR HG1 H N N 273 THR HG21 H N N 274 THR HG22 H N N 275 THR HG23 H N N 276 THR HXT H N N 277 TRP N N N N 278 TRP CA C N S 279 TRP C C N N 280 TRP O O N N 281 TRP CB C N N 282 TRP CG C Y N 283 TRP CD1 C Y N 284 TRP CD2 C Y N 285 TRP NE1 N Y N 286 TRP CE2 C Y N 287 TRP CE3 C Y N 288 TRP CZ2 C Y N 289 TRP CZ3 C Y N 290 TRP CH2 C Y N 291 TRP OXT O N N 292 TRP H H N N 293 TRP H2 H N N 294 TRP HA H N N 295 TRP HB2 H N N 296 TRP HB3 H N N 297 TRP HD1 H N N 298 TRP HE1 H N N 299 TRP HE3 H N N 300 TRP HZ2 H N N 301 TRP HZ3 H N N 302 TRP HH2 H N N 303 TRP HXT H N N 304 TYR N N N N 305 TYR CA C N S 306 TYR C C N N 307 TYR O O N N 308 TYR CB C N N 309 TYR CG C Y N 310 TYR CD1 C Y N 311 TYR CD2 C Y N 312 TYR CE1 C Y N 313 TYR CE2 C Y N 314 TYR CZ C Y N 315 TYR OH O N N 316 TYR OXT O N N 317 TYR H H N N 318 TYR H2 H N N 319 TYR HA H N N 320 TYR HB2 H N N 321 TYR HB3 H N N 322 TYR HD1 H N N 323 TYR HD2 H N N 324 TYR HE1 H N N 325 TYR HE2 H N N 326 TYR HH H N N 327 TYR HXT H N N 328 VAL N N N N 329 VAL CA C N S 330 VAL C C N N 331 VAL O O N N 332 VAL CB C N N 333 VAL CG1 C N N 334 VAL CG2 C N N 335 VAL OXT O N N 336 VAL H H N N 337 VAL H2 H N N 338 VAL HA H N N 339 VAL HB H N N 340 VAL HG11 H N N 341 VAL HG12 H N N 342 VAL HG13 H N N 343 VAL HG21 H N N 344 VAL HG22 H N N 345 VAL HG23 H N N 346 VAL HXT H N N 347 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 CYS N CA sing N N 54 CYS N H sing N N 55 CYS N H2 sing N N 56 CYS CA C sing N N 57 CYS CA CB sing N N 58 CYS CA HA sing N N 59 CYS C O doub N N 60 CYS C OXT sing N N 61 CYS CB SG sing N N 62 CYS CB HB2 sing N N 63 CYS CB HB3 sing N N 64 CYS SG HG sing N N 65 CYS OXT HXT sing N N 66 GLN N CA sing N N 67 GLN N H sing N N 68 GLN N H2 sing N N 69 GLN CA C sing N N 70 GLN CA CB sing N N 71 GLN CA HA sing N N 72 GLN C O doub N N 73 GLN C OXT sing N N 74 GLN CB CG sing N N 75 GLN CB HB2 sing N N 76 GLN CB HB3 sing N N 77 GLN CG CD sing N N 78 GLN CG HG2 sing N N 79 GLN CG HG3 sing N N 80 GLN CD OE1 doub N N 81 GLN CD NE2 sing N N 82 GLN NE2 HE21 sing N N 83 GLN NE2 HE22 sing N N 84 GLN OXT HXT sing N N 85 GLU N CA sing N N 86 GLU N H sing N N 87 GLU N H2 sing N N 88 GLU CA C sing N N 89 GLU CA CB sing N N 90 GLU CA HA sing N N 91 GLU C O doub N N 92 GLU C OXT sing N N 93 GLU CB CG sing N N 94 GLU CB HB2 sing N N 95 GLU CB HB3 sing N N 96 GLU CG CD sing N N 97 GLU CG HG2 sing N N 98 GLU CG HG3 sing N N 99 GLU CD OE1 doub N N 100 GLU CD OE2 sing N N 101 GLU OE2 HE2 sing N N 102 GLU OXT HXT sing N N 103 GLY N CA sing N N 104 GLY N H sing N N 105 GLY N H2 sing N N 106 GLY CA C sing N N 107 GLY CA HA2 sing N N 108 GLY CA HA3 sing N N 109 GLY C O doub N N 110 GLY C OXT sing N N 111 GLY OXT HXT sing N N 112 HIS N CA sing N N 113 HIS N H sing N N 114 HIS N H2 sing N N 115 HIS CA C sing N N 116 HIS CA CB sing N N 117 HIS CA HA sing N N 118 HIS C O doub N N 119 HIS C OXT sing N N 120 HIS CB CG sing N N 121 HIS CB HB2 sing N N 122 HIS CB HB3 sing N N 123 HIS CG ND1 sing Y N 124 HIS CG CD2 doub Y N 125 HIS ND1 CE1 doub Y N 126 HIS ND1 HD1 sing N N 127 HIS CD2 NE2 sing Y N 128 HIS CD2 HD2 sing N N 129 HIS CE1 NE2 sing Y N 130 HIS CE1 HE1 sing N N 131 HIS NE2 HE2 sing N N 132 HIS OXT HXT sing N N 133 ILE N CA sing N N 134 ILE N H sing N N 135 ILE N H2 sing N N 136 ILE CA C sing N N 137 ILE CA CB sing N N 138 ILE CA HA sing N N 139 ILE C O doub N N 140 ILE C OXT sing N N 141 ILE CB CG1 sing N N 142 ILE CB CG2 sing N N 143 ILE CB HB sing N N 144 ILE CG1 CD1 sing N N 145 ILE CG1 HG12 sing N N 146 ILE CG1 HG13 sing N N 147 ILE CG2 HG21 sing N N 148 ILE CG2 HG22 sing N N 149 ILE CG2 HG23 sing N N 150 ILE CD1 HD11 sing N N 151 ILE CD1 HD12 sing N N 152 ILE CD1 HD13 sing N N 153 ILE OXT HXT sing N N 154 LEU N CA sing N N 155 LEU N H sing N N 156 LEU N H2 sing N N 157 LEU CA C sing N N 158 LEU CA CB sing N N 159 LEU CA HA sing N N 160 LEU C O doub N N 161 LEU C OXT sing N N 162 LEU CB CG sing N N 163 LEU CB HB2 sing N N 164 LEU CB HB3 sing N N 165 LEU CG CD1 sing N N 166 LEU CG CD2 sing N N 167 LEU CG HG sing N N 168 LEU CD1 HD11 sing N N 169 LEU CD1 HD12 sing N N 170 LEU CD1 HD13 sing N N 171 LEU CD2 HD21 sing N N 172 LEU CD2 HD22 sing N N 173 LEU CD2 HD23 sing N N 174 LEU OXT HXT sing N N 175 LYS N CA sing N N 176 LYS N H sing N N 177 LYS N H2 sing N N 178 LYS CA C sing N N 179 LYS CA CB sing N N 180 LYS CA HA sing N N 181 LYS C O doub N N 182 LYS C OXT sing N N 183 LYS CB CG sing N N 184 LYS CB HB2 sing N N 185 LYS CB HB3 sing N N 186 LYS CG CD sing N N 187 LYS CG HG2 sing N N 188 LYS CG HG3 sing N N 189 LYS CD CE sing N N 190 LYS CD HD2 sing N N 191 LYS CD HD3 sing N N 192 LYS CE NZ sing N N 193 LYS CE HE2 sing N N 194 LYS CE HE3 sing N N 195 LYS NZ HZ1 sing N N 196 LYS NZ HZ2 sing N N 197 LYS NZ HZ3 sing N N 198 LYS OXT HXT sing N N 199 MET N CA sing N N 200 MET N H sing N N 201 MET N H2 sing N N 202 MET CA C sing N N 203 MET CA CB sing N N 204 MET CA HA sing N N 205 MET C O doub N N 206 MET C OXT sing N N 207 MET CB CG sing N N 208 MET CB HB2 sing N N 209 MET CB HB3 sing N N 210 MET CG SD sing N N 211 MET CG HG2 sing N N 212 MET CG HG3 sing N N 213 MET SD CE sing N N 214 MET CE HE1 sing N N 215 MET CE HE2 sing N N 216 MET CE HE3 sing N N 217 MET OXT HXT sing N N 218 PRO N CA sing N N 219 PRO N CD sing N N 220 PRO N H sing N N 221 PRO CA C sing N N 222 PRO CA CB sing N N 223 PRO CA HA sing N N 224 PRO C O doub N N 225 PRO C OXT sing N N 226 PRO CB CG sing N N 227 PRO CB HB2 sing N N 228 PRO CB HB3 sing N N 229 PRO CG CD sing N N 230 PRO CG HG2 sing N N 231 PRO CG HG3 sing N N 232 PRO CD HD2 sing N N 233 PRO CD HD3 sing N N 234 PRO OXT HXT sing N N 235 SER N CA sing N N 236 SER N H sing N N 237 SER N H2 sing N N 238 SER CA C sing N N 239 SER CA CB sing N N 240 SER CA HA sing N N 241 SER C O doub N N 242 SER C OXT sing N N 243 SER CB OG sing N N 244 SER CB HB2 sing N N 245 SER CB HB3 sing N N 246 SER OG HG sing N N 247 SER OXT HXT sing N N 248 THR N CA sing N N 249 THR N H sing N N 250 THR N H2 sing N N 251 THR CA C sing N N 252 THR CA CB sing N N 253 THR CA HA sing N N 254 THR C O doub N N 255 THR C OXT sing N N 256 THR CB OG1 sing N N 257 THR CB CG2 sing N N 258 THR CB HB sing N N 259 THR OG1 HG1 sing N N 260 THR CG2 HG21 sing N N 261 THR CG2 HG22 sing N N 262 THR CG2 HG23 sing N N 263 THR OXT HXT sing N N 264 TRP N CA sing N N 265 TRP N H sing N N 266 TRP N H2 sing N N 267 TRP CA C sing N N 268 TRP CA CB sing N N 269 TRP CA HA sing N N 270 TRP C O doub N N 271 TRP C OXT sing N N 272 TRP CB CG sing N N 273 TRP CB HB2 sing N N 274 TRP CB HB3 sing N N 275 TRP CG CD1 doub Y N 276 TRP CG CD2 sing Y N 277 TRP CD1 NE1 sing Y N 278 TRP CD1 HD1 sing N N 279 TRP CD2 CE2 doub Y N 280 TRP CD2 CE3 sing Y N 281 TRP NE1 CE2 sing Y N 282 TRP NE1 HE1 sing N N 283 TRP CE2 CZ2 sing Y N 284 TRP CE3 CZ3 doub Y N 285 TRP CE3 HE3 sing N N 286 TRP CZ2 CH2 doub Y N 287 TRP CZ2 HZ2 sing N N 288 TRP CZ3 CH2 sing Y N 289 TRP CZ3 HZ3 sing N N 290 TRP CH2 HH2 sing N N 291 TRP OXT HXT sing N N 292 TYR N CA sing N N 293 TYR N H sing N N 294 TYR N H2 sing N N 295 TYR CA C sing N N 296 TYR CA CB sing N N 297 TYR CA HA sing N N 298 TYR C O doub N N 299 TYR C OXT sing N N 300 TYR CB CG sing N N 301 TYR CB HB2 sing N N 302 TYR CB HB3 sing N N 303 TYR CG CD1 doub Y N 304 TYR CG CD2 sing Y N 305 TYR CD1 CE1 sing Y N 306 TYR CD1 HD1 sing N N 307 TYR CD2 CE2 doub Y N 308 TYR CD2 HD2 sing N N 309 TYR CE1 CZ doub Y N 310 TYR CE1 HE1 sing N N 311 TYR CE2 CZ sing Y N 312 TYR CE2 HE2 sing N N 313 TYR CZ OH sing N N 314 TYR OH HH sing N N 315 TYR OXT HXT sing N N 316 VAL N CA sing N N 317 VAL N H sing N N 318 VAL N H2 sing N N 319 VAL CA C sing N N 320 VAL CA CB sing N N 321 VAL CA HA sing N N 322 VAL C O doub N N 323 VAL C OXT sing N N 324 VAL CB CG1 sing N N 325 VAL CB CG2 sing N N 326 VAL CB HB sing N N 327 VAL CG1 HG11 sing N N 328 VAL CG1 HG12 sing N N 329 VAL CG1 HG13 sing N N 330 VAL CG2 HG21 sing N N 331 VAL CG2 HG22 sing N N 332 VAL CG2 HG23 sing N N 333 VAL OXT HXT sing N N 334 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 INOVA Varian 600 ? 2 INOVA Varian 500 ? # _atom_sites.entry_id 2JRR _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_