data_2JS0 # _entry.id 2JS0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2JS0 pdb_00002js0 10.2210/pdb2js0/pdb RCSB RCSB100216 ? ? WWPDB D_1000100216 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-02-26 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-09 4 'Structure model' 1 3 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_spectrometer 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' struct_ref_seq_dif 6 4 'Structure model' chem_comp_atom 7 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_spectrometer.model' 4 3 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2JS0 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2007-06-29 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Hake, M.J.' 1 'Choowongkomon, K.' 2 'Carlin, C.R.' 3 'Sonnichsen, F.D.' 4 # _citation.id primary _citation.title 'Specificity determinants of a novel Nck interaction with the juxtamembrane domain of the epidermal growth factor receptor.' _citation.journal_abbrev Biochemistry _citation.journal_volume 47 _citation.page_first 3096 _citation.page_last 3108 _citation.year 2008 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18269246 _citation.pdbx_database_id_DOI 10.1021/bi701549a # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hake, M.J.' 1 ? primary 'Choowongkomon, K.' 2 ? primary 'Kostenko, O.' 3 ? primary 'Carlin, C.R.' 4 ? primary 'Sonnichsen, F.D.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Cytoplasmic protein NCK1' _entity.formula_weight 6990.797 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'SH3 2' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'NCK adaptor protein 1, SH2/SH3 adaptor protein NCK-alpha' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSLNMPAYVKFNYMAEREDELSLIKGTKVIVMEKCSDGWWRGSYNGQVGWFPSNYVTEEGD _entity_poly.pdbx_seq_one_letter_code_can GSLNMPAYVKFNYMAEREDELSLIKGTKVIVMEKCSDGWWRGSYNGQVGWFPSNYVTEEGD _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 LEU n 1 4 ASN n 1 5 MET n 1 6 PRO n 1 7 ALA n 1 8 TYR n 1 9 VAL n 1 10 LYS n 1 11 PHE n 1 12 ASN n 1 13 TYR n 1 14 MET n 1 15 ALA n 1 16 GLU n 1 17 ARG n 1 18 GLU n 1 19 ASP n 1 20 GLU n 1 21 LEU n 1 22 SER n 1 23 LEU n 1 24 ILE n 1 25 LYS n 1 26 GLY n 1 27 THR n 1 28 LYS n 1 29 VAL n 1 30 ILE n 1 31 VAL n 1 32 MET n 1 33 GLU n 1 34 LYS n 1 35 CYS n 1 36 SER n 1 37 ASP n 1 38 GLY n 1 39 TRP n 1 40 TRP n 1 41 ARG n 1 42 GLY n 1 43 SER n 1 44 TYR n 1 45 ASN n 1 46 GLY n 1 47 GLN n 1 48 VAL n 1 49 GLY n 1 50 TRP n 1 51 PHE n 1 52 PRO n 1 53 SER n 1 54 ASN n 1 55 TYR n 1 56 VAL n 1 57 THR n 1 58 GLU n 1 59 GLU n 1 60 GLY n 1 61 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene 'NCK1, NCK' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pGEV2 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 ASN 4 4 4 ASN ASN A . n A 1 5 MET 5 5 5 MET MET A . n A 1 6 PRO 6 6 6 PRO PRO A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 TYR 8 8 8 TYR TYR A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 MET 14 14 14 MET MET A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 MET 32 32 32 MET MET A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 CYS 35 35 35 CYS CYS A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 TRP 39 39 39 TRP TRP A . n A 1 40 TRP 40 40 40 TRP TRP A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 TYR 44 44 44 TYR TYR A . n A 1 45 ASN 45 45 45 ASN ASN A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 GLN 47 47 47 GLN GLN A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 TRP 50 50 50 TRP TRP A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 TYR 55 55 55 TYR TYR A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 ASP 61 61 61 ASP ASP A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2JS0 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2JS0 _struct.title 'Solution structure of second SH3 domain of adaptor Nck' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2JS0 _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text 'SH3 domain, adaptor, signaling, SIGNALING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NCK1_HUMAN _struct_ref.pdbx_db_accession P16333 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code LNMPAYVKFNYMAEREDELSLIKGTKVIVMEKCSDGWWRGSYNGQVGWFPSNYVTEEGD _struct_ref.pdbx_align_begin 107 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2JS0 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 61 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P16333 _struct_ref_seq.db_align_beg 107 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 165 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 61 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2JS0 GLY A 1 ? UNP P16333 ? ? 'expression tag' 1 1 1 2JS0 SER A 2 ? UNP P16333 ? ? 'expression tag' 2 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLN A 47 ? PRO A 52 ? GLN A 47 PRO A 52 A 2 TRP A 39 ? TYR A 44 ? TRP A 39 TYR A 44 A 3 LYS A 28 ? LYS A 34 ? LYS A 28 LYS A 34 A 4 MET A 5 ? VAL A 9 ? MET A 5 VAL A 9 A 5 VAL A 56 ? THR A 57 ? VAL A 56 THR A 57 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O GLN A 47 ? O GLN A 47 N TYR A 44 ? N TYR A 44 A 2 3 O ARG A 41 ? O ARG A 41 N GLU A 33 ? N GLU A 33 A 3 4 O VAL A 31 ? O VAL A 31 N MET A 5 ? N MET A 5 A 4 5 N TYR A 8 ? N TYR A 8 O THR A 57 ? O THR A 57 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 6 HZ1 A LYS 34 ? ? OE2 A GLU 58 ? ? 1.53 2 7 HZ2 A LYS 34 ? ? OE2 A GLU 58 ? ? 1.60 3 8 HG A CYS 35 ? ? OD1 A ASP 37 ? ? 1.57 4 10 HZ3 A LYS 34 ? ? OE2 A GLU 58 ? ? 1.56 5 14 HZ2 A LYS 34 ? ? OE2 A GLU 58 ? ? 1.57 6 16 HZ1 A LYS 34 ? ? OE2 A GLU 58 ? ? 1.60 7 17 HZ1 A LYS 34 ? ? OE1 A GLU 58 ? ? 1.56 8 20 HZ2 A LYS 34 ? ? OE2 A GLU 58 ? ? 1.56 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 37 ? ? -123.63 -162.12 2 1 ASN A 45 ? ? -20.46 93.54 3 1 GLU A 59 ? ? -170.56 91.37 4 2 LEU A 3 ? ? -167.78 118.10 5 2 ASN A 45 ? ? 68.11 -90.10 6 3 ASN A 4 ? ? 65.43 74.38 7 3 ASN A 45 ? ? 73.90 -34.35 8 3 GLU A 58 ? ? -84.03 -71.87 9 3 GLU A 59 ? ? -107.90 76.69 10 4 ASN A 4 ? ? -174.93 42.88 11 4 ASN A 45 ? ? 66.68 -90.92 12 4 GLU A 58 ? ? -65.13 -78.07 13 5 ASN A 4 ? ? -177.33 33.33 14 5 MET A 32 ? ? -94.88 -65.29 15 5 ASN A 45 ? ? -37.77 103.69 16 5 GLN A 47 ? ? -165.68 -168.64 17 5 GLU A 59 ? ? -169.45 102.35 18 6 ASN A 45 ? ? 66.18 -85.75 19 6 GLU A 58 ? ? -65.29 -73.14 20 7 ASN A 45 ? ? -59.61 102.72 21 7 GLU A 58 ? ? -76.52 -74.86 22 8 ASN A 45 ? ? 65.05 -86.24 23 8 GLU A 58 ? ? -61.07 -70.33 24 8 GLU A 59 ? ? -160.85 26.71 25 9 ASN A 45 ? ? 63.92 -79.76 26 9 GLU A 58 ? ? -66.45 -87.09 27 10 LEU A 3 ? ? -109.72 66.93 28 10 ASN A 4 ? ? -175.62 31.77 29 10 GLU A 16 ? ? -132.12 -32.29 30 10 MET A 32 ? ? -94.68 -72.32 31 10 ASN A 45 ? ? 63.58 -88.14 32 10 GLU A 58 ? ? -74.15 -70.87 33 11 ASN A 45 ? ? 61.40 -93.91 34 11 GLU A 58 ? ? -83.38 -73.27 35 11 GLU A 59 ? ? -111.74 74.53 36 12 SER A 36 ? ? -67.50 0.84 37 12 ASN A 45 ? ? 64.46 -91.06 38 12 GLU A 58 ? ? -65.20 -89.72 39 13 ASP A 37 ? ? -110.00 -165.49 40 13 ASN A 45 ? ? -47.66 95.80 41 13 GLU A 58 ? ? -62.28 -75.40 42 14 ASN A 4 ? ? 65.33 85.83 43 14 ASN A 45 ? ? 64.31 -86.87 44 14 GLU A 58 ? ? -92.17 -65.03 45 14 GLU A 59 ? ? -167.71 106.46 46 15 SER A 2 ? ? 54.82 174.41 47 15 ASN A 4 ? ? 178.58 69.57 48 15 ASP A 37 ? ? -148.28 -27.93 49 15 ASN A 45 ? ? 62.19 -93.91 50 15 GLU A 58 ? ? -58.43 -80.46 51 16 ASP A 37 ? ? -113.28 -82.16 52 16 ASN A 45 ? ? -56.04 96.16 53 16 GLU A 58 ? ? -93.64 -67.36 54 17 LEU A 3 ? ? 69.03 -67.18 55 17 ASN A 12 ? ? -68.87 87.18 56 17 GLU A 58 ? ? -55.02 -72.71 57 17 GLU A 59 ? ? -162.73 100.06 58 18 ASN A 4 ? ? -179.58 40.05 59 18 ASN A 45 ? ? 62.00 -97.04 60 18 GLU A 58 ? ? -58.22 -73.18 61 18 GLU A 59 ? ? -149.98 19.81 62 19 ASN A 45 ? ? 59.32 -90.81 63 19 GLU A 58 ? ? -66.24 -77.55 64 20 ASN A 4 ? ? -167.65 56.79 65 20 GLU A 59 ? ? -173.86 27.71 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2JS0 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2JS0 _pdbx_nmr_representative.selection_criteria 'closest to the average' # _pdbx_nmr_sample_details.contents ;0.5-1.0 mM [U-99% 13C; U-99% 15N] Nck1-2, 20 mM sodium phosphate, 100 mM sodium chloride, 2 mM sodium azide, 1 mM EDTA, 4 mM DTT, 90% H2O/10% D2O ; _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id Nck1-2 0.5 mM '[U-99% 13C; U-99% 15N]' 1 'sodium phosphate' 20 mM ? 1 'sodium chloride' 100 mM ? 1 'sodium azide' 2 mM ? 1 EDTA 1 mM ? 1 DTT 4 mM ? 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100 _pdbx_nmr_exptl_sample_conditions.pH 6.1 _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 310 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D 1H-15N NOESY' 1 2 1 '3D 1H-13C NOESY' 1 3 1 '2D 1H-1H NOESY' 1 4 1 '2D 1H-15N HSQC' 1 5 1 '2D 1H-13C HSQC' 1 6 1 '3D HNCO' 1 7 1 '3D HNCACB' 1 8 1 '3D CBCA(CO)NH' 1 9 1 '3D H(CCO)NH' 1 10 1 '3D HCCH-TOCSY' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2JS0 _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 662 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 238 _pdbx_nmr_constraints.NOE_long_range_total_count 259 _pdbx_nmr_constraints.NOE_medium_range_total_count 40 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 125 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # _pdbx_nmr_refine.entry_id 2JS0 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 1 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 2 'Johnson, One Moon Scientific' 'data analysis' NMRView 5.2.1 3 'Johnson, One Moon Scientific' 'peak picking' NMRView 5.2.1 4 'Johnson, One Moon Scientific' 'chemical shift assignment' NMRView 5.2.1 5 'Brunger, Adams, Clore, Gros, Nilges and Read' 'water refinement' CNS 1.1 6 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 2.1 7 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 ILE N N N N 137 ILE CA C N S 138 ILE C C N N 139 ILE O O N N 140 ILE CB C N S 141 ILE CG1 C N N 142 ILE CG2 C N N 143 ILE CD1 C N N 144 ILE OXT O N N 145 ILE H H N N 146 ILE H2 H N N 147 ILE HA H N N 148 ILE HB H N N 149 ILE HG12 H N N 150 ILE HG13 H N N 151 ILE HG21 H N N 152 ILE HG22 H N N 153 ILE HG23 H N N 154 ILE HD11 H N N 155 ILE HD12 H N N 156 ILE HD13 H N N 157 ILE HXT H N N 158 LEU N N N N 159 LEU CA C N S 160 LEU C C N N 161 LEU O O N N 162 LEU CB C N N 163 LEU CG C N N 164 LEU CD1 C N N 165 LEU CD2 C N N 166 LEU OXT O N N 167 LEU H H N N 168 LEU H2 H N N 169 LEU HA H N N 170 LEU HB2 H N N 171 LEU HB3 H N N 172 LEU HG H N N 173 LEU HD11 H N N 174 LEU HD12 H N N 175 LEU HD13 H N N 176 LEU HD21 H N N 177 LEU HD22 H N N 178 LEU HD23 H N N 179 LEU HXT H N N 180 LYS N N N N 181 LYS CA C N S 182 LYS C C N N 183 LYS O O N N 184 LYS CB C N N 185 LYS CG C N N 186 LYS CD C N N 187 LYS CE C N N 188 LYS NZ N N N 189 LYS OXT O N N 190 LYS H H N N 191 LYS H2 H N N 192 LYS HA H N N 193 LYS HB2 H N N 194 LYS HB3 H N N 195 LYS HG2 H N N 196 LYS HG3 H N N 197 LYS HD2 H N N 198 LYS HD3 H N N 199 LYS HE2 H N N 200 LYS HE3 H N N 201 LYS HZ1 H N N 202 LYS HZ2 H N N 203 LYS HZ3 H N N 204 LYS HXT H N N 205 MET N N N N 206 MET CA C N S 207 MET C C N N 208 MET O O N N 209 MET CB C N N 210 MET CG C N N 211 MET SD S N N 212 MET CE C N N 213 MET OXT O N N 214 MET H H N N 215 MET H2 H N N 216 MET HA H N N 217 MET HB2 H N N 218 MET HB3 H N N 219 MET HG2 H N N 220 MET HG3 H N N 221 MET HE1 H N N 222 MET HE2 H N N 223 MET HE3 H N N 224 MET HXT H N N 225 PHE N N N N 226 PHE CA C N S 227 PHE C C N N 228 PHE O O N N 229 PHE CB C N N 230 PHE CG C Y N 231 PHE CD1 C Y N 232 PHE CD2 C Y N 233 PHE CE1 C Y N 234 PHE CE2 C Y N 235 PHE CZ C Y N 236 PHE OXT O N N 237 PHE H H N N 238 PHE H2 H N N 239 PHE HA H N N 240 PHE HB2 H N N 241 PHE HB3 H N N 242 PHE HD1 H N N 243 PHE HD2 H N N 244 PHE HE1 H N N 245 PHE HE2 H N N 246 PHE HZ H N N 247 PHE HXT H N N 248 PRO N N N N 249 PRO CA C N S 250 PRO C C N N 251 PRO O O N N 252 PRO CB C N N 253 PRO CG C N N 254 PRO CD C N N 255 PRO OXT O N N 256 PRO H H N N 257 PRO HA H N N 258 PRO HB2 H N N 259 PRO HB3 H N N 260 PRO HG2 H N N 261 PRO HG3 H N N 262 PRO HD2 H N N 263 PRO HD3 H N N 264 PRO HXT H N N 265 SER N N N N 266 SER CA C N S 267 SER C C N N 268 SER O O N N 269 SER CB C N N 270 SER OG O N N 271 SER OXT O N N 272 SER H H N N 273 SER H2 H N N 274 SER HA H N N 275 SER HB2 H N N 276 SER HB3 H N N 277 SER HG H N N 278 SER HXT H N N 279 THR N N N N 280 THR CA C N S 281 THR C C N N 282 THR O O N N 283 THR CB C N R 284 THR OG1 O N N 285 THR CG2 C N N 286 THR OXT O N N 287 THR H H N N 288 THR H2 H N N 289 THR HA H N N 290 THR HB H N N 291 THR HG1 H N N 292 THR HG21 H N N 293 THR HG22 H N N 294 THR HG23 H N N 295 THR HXT H N N 296 TRP N N N N 297 TRP CA C N S 298 TRP C C N N 299 TRP O O N N 300 TRP CB C N N 301 TRP CG C Y N 302 TRP CD1 C Y N 303 TRP CD2 C Y N 304 TRP NE1 N Y N 305 TRP CE2 C Y N 306 TRP CE3 C Y N 307 TRP CZ2 C Y N 308 TRP CZ3 C Y N 309 TRP CH2 C Y N 310 TRP OXT O N N 311 TRP H H N N 312 TRP H2 H N N 313 TRP HA H N N 314 TRP HB2 H N N 315 TRP HB3 H N N 316 TRP HD1 H N N 317 TRP HE1 H N N 318 TRP HE3 H N N 319 TRP HZ2 H N N 320 TRP HZ3 H N N 321 TRP HH2 H N N 322 TRP HXT H N N 323 TYR N N N N 324 TYR CA C N S 325 TYR C C N N 326 TYR O O N N 327 TYR CB C N N 328 TYR CG C Y N 329 TYR CD1 C Y N 330 TYR CD2 C Y N 331 TYR CE1 C Y N 332 TYR CE2 C Y N 333 TYR CZ C Y N 334 TYR OH O N N 335 TYR OXT O N N 336 TYR H H N N 337 TYR H2 H N N 338 TYR HA H N N 339 TYR HB2 H N N 340 TYR HB3 H N N 341 TYR HD1 H N N 342 TYR HD2 H N N 343 TYR HE1 H N N 344 TYR HE2 H N N 345 TYR HH H N N 346 TYR HXT H N N 347 VAL N N N N 348 VAL CA C N S 349 VAL C C N N 350 VAL O O N N 351 VAL CB C N N 352 VAL CG1 C N N 353 VAL CG2 C N N 354 VAL OXT O N N 355 VAL H H N N 356 VAL H2 H N N 357 VAL HA H N N 358 VAL HB H N N 359 VAL HG11 H N N 360 VAL HG12 H N N 361 VAL HG13 H N N 362 VAL HG21 H N N 363 VAL HG22 H N N 364 VAL HG23 H N N 365 VAL HXT H N N 366 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 ILE N CA sing N N 129 ILE N H sing N N 130 ILE N H2 sing N N 131 ILE CA C sing N N 132 ILE CA CB sing N N 133 ILE CA HA sing N N 134 ILE C O doub N N 135 ILE C OXT sing N N 136 ILE CB CG1 sing N N 137 ILE CB CG2 sing N N 138 ILE CB HB sing N N 139 ILE CG1 CD1 sing N N 140 ILE CG1 HG12 sing N N 141 ILE CG1 HG13 sing N N 142 ILE CG2 HG21 sing N N 143 ILE CG2 HG22 sing N N 144 ILE CG2 HG23 sing N N 145 ILE CD1 HD11 sing N N 146 ILE CD1 HD12 sing N N 147 ILE CD1 HD13 sing N N 148 ILE OXT HXT sing N N 149 LEU N CA sing N N 150 LEU N H sing N N 151 LEU N H2 sing N N 152 LEU CA C sing N N 153 LEU CA CB sing N N 154 LEU CA HA sing N N 155 LEU C O doub N N 156 LEU C OXT sing N N 157 LEU CB CG sing N N 158 LEU CB HB2 sing N N 159 LEU CB HB3 sing N N 160 LEU CG CD1 sing N N 161 LEU CG CD2 sing N N 162 LEU CG HG sing N N 163 LEU CD1 HD11 sing N N 164 LEU CD1 HD12 sing N N 165 LEU CD1 HD13 sing N N 166 LEU CD2 HD21 sing N N 167 LEU CD2 HD22 sing N N 168 LEU CD2 HD23 sing N N 169 LEU OXT HXT sing N N 170 LYS N CA sing N N 171 LYS N H sing N N 172 LYS N H2 sing N N 173 LYS CA C sing N N 174 LYS CA CB sing N N 175 LYS CA HA sing N N 176 LYS C O doub N N 177 LYS C OXT sing N N 178 LYS CB CG sing N N 179 LYS CB HB2 sing N N 180 LYS CB HB3 sing N N 181 LYS CG CD sing N N 182 LYS CG HG2 sing N N 183 LYS CG HG3 sing N N 184 LYS CD CE sing N N 185 LYS CD HD2 sing N N 186 LYS CD HD3 sing N N 187 LYS CE NZ sing N N 188 LYS CE HE2 sing N N 189 LYS CE HE3 sing N N 190 LYS NZ HZ1 sing N N 191 LYS NZ HZ2 sing N N 192 LYS NZ HZ3 sing N N 193 LYS OXT HXT sing N N 194 MET N CA sing N N 195 MET N H sing N N 196 MET N H2 sing N N 197 MET CA C sing N N 198 MET CA CB sing N N 199 MET CA HA sing N N 200 MET C O doub N N 201 MET C OXT sing N N 202 MET CB CG sing N N 203 MET CB HB2 sing N N 204 MET CB HB3 sing N N 205 MET CG SD sing N N 206 MET CG HG2 sing N N 207 MET CG HG3 sing N N 208 MET SD CE sing N N 209 MET CE HE1 sing N N 210 MET CE HE2 sing N N 211 MET CE HE3 sing N N 212 MET OXT HXT sing N N 213 PHE N CA sing N N 214 PHE N H sing N N 215 PHE N H2 sing N N 216 PHE CA C sing N N 217 PHE CA CB sing N N 218 PHE CA HA sing N N 219 PHE C O doub N N 220 PHE C OXT sing N N 221 PHE CB CG sing N N 222 PHE CB HB2 sing N N 223 PHE CB HB3 sing N N 224 PHE CG CD1 doub Y N 225 PHE CG CD2 sing Y N 226 PHE CD1 CE1 sing Y N 227 PHE CD1 HD1 sing N N 228 PHE CD2 CE2 doub Y N 229 PHE CD2 HD2 sing N N 230 PHE CE1 CZ doub Y N 231 PHE CE1 HE1 sing N N 232 PHE CE2 CZ sing Y N 233 PHE CE2 HE2 sing N N 234 PHE CZ HZ sing N N 235 PHE OXT HXT sing N N 236 PRO N CA sing N N 237 PRO N CD sing N N 238 PRO N H sing N N 239 PRO CA C sing N N 240 PRO CA CB sing N N 241 PRO CA HA sing N N 242 PRO C O doub N N 243 PRO C OXT sing N N 244 PRO CB CG sing N N 245 PRO CB HB2 sing N N 246 PRO CB HB3 sing N N 247 PRO CG CD sing N N 248 PRO CG HG2 sing N N 249 PRO CG HG3 sing N N 250 PRO CD HD2 sing N N 251 PRO CD HD3 sing N N 252 PRO OXT HXT sing N N 253 SER N CA sing N N 254 SER N H sing N N 255 SER N H2 sing N N 256 SER CA C sing N N 257 SER CA CB sing N N 258 SER CA HA sing N N 259 SER C O doub N N 260 SER C OXT sing N N 261 SER CB OG sing N N 262 SER CB HB2 sing N N 263 SER CB HB3 sing N N 264 SER OG HG sing N N 265 SER OXT HXT sing N N 266 THR N CA sing N N 267 THR N H sing N N 268 THR N H2 sing N N 269 THR CA C sing N N 270 THR CA CB sing N N 271 THR CA HA sing N N 272 THR C O doub N N 273 THR C OXT sing N N 274 THR CB OG1 sing N N 275 THR CB CG2 sing N N 276 THR CB HB sing N N 277 THR OG1 HG1 sing N N 278 THR CG2 HG21 sing N N 279 THR CG2 HG22 sing N N 280 THR CG2 HG23 sing N N 281 THR OXT HXT sing N N 282 TRP N CA sing N N 283 TRP N H sing N N 284 TRP N H2 sing N N 285 TRP CA C sing N N 286 TRP CA CB sing N N 287 TRP CA HA sing N N 288 TRP C O doub N N 289 TRP C OXT sing N N 290 TRP CB CG sing N N 291 TRP CB HB2 sing N N 292 TRP CB HB3 sing N N 293 TRP CG CD1 doub Y N 294 TRP CG CD2 sing Y N 295 TRP CD1 NE1 sing Y N 296 TRP CD1 HD1 sing N N 297 TRP CD2 CE2 doub Y N 298 TRP CD2 CE3 sing Y N 299 TRP NE1 CE2 sing Y N 300 TRP NE1 HE1 sing N N 301 TRP CE2 CZ2 sing Y N 302 TRP CE3 CZ3 doub Y N 303 TRP CE3 HE3 sing N N 304 TRP CZ2 CH2 doub Y N 305 TRP CZ2 HZ2 sing N N 306 TRP CZ3 CH2 sing Y N 307 TRP CZ3 HZ3 sing N N 308 TRP CH2 HH2 sing N N 309 TRP OXT HXT sing N N 310 TYR N CA sing N N 311 TYR N H sing N N 312 TYR N H2 sing N N 313 TYR CA C sing N N 314 TYR CA CB sing N N 315 TYR CA HA sing N N 316 TYR C O doub N N 317 TYR C OXT sing N N 318 TYR CB CG sing N N 319 TYR CB HB2 sing N N 320 TYR CB HB3 sing N N 321 TYR CG CD1 doub Y N 322 TYR CG CD2 sing Y N 323 TYR CD1 CE1 sing Y N 324 TYR CD1 HD1 sing N N 325 TYR CD2 CE2 doub Y N 326 TYR CD2 HD2 sing N N 327 TYR CE1 CZ doub Y N 328 TYR CE1 HE1 sing N N 329 TYR CE2 CZ sing Y N 330 TYR CE2 HE2 sing N N 331 TYR CZ OH sing N N 332 TYR OH HH sing N N 333 TYR OXT HXT sing N N 334 VAL N CA sing N N 335 VAL N H sing N N 336 VAL N H2 sing N N 337 VAL CA C sing N N 338 VAL CA CB sing N N 339 VAL CA HA sing N N 340 VAL C O doub N N 341 VAL C OXT sing N N 342 VAL CB CG1 sing N N 343 VAL CB CG2 sing N N 344 VAL CB HB sing N N 345 VAL CG1 HG11 sing N N 346 VAL CG1 HG12 sing N N 347 VAL CG1 HG13 sing N N 348 VAL CG2 HG21 sing N N 349 VAL CG2 HG22 sing N N 350 VAL CG2 HG23 sing N N 351 VAL OXT HXT sing N N 352 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Varian INOVA 1 'Varian INOVA' 500 Varian INOVA 2 'Varian INOVA' 600 Bruker AVANCE 3 'Bruker Avance' # _atom_sites.entry_id 2JS0 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_