data_2JT1 # _entry.id 2JT1 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2JT1 pdb_00002jt1 10.2210/pdb2jt1/pdb RCSB RCSB100253 ? ? WWPDB D_1000100253 ? ? BMRB 15386 ? 10.13018/BMR15386 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-10-09 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2018-01-24 4 'Structure model' 1 3 2020-02-19 5 'Structure model' 1 4 2023-06-14 6 'Structure model' 1 5 2024-05-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Structure summary' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' Other 6 5 'Structure model' 'Database references' 7 5 'Structure model' Other 8 6 'Structure model' 'Data collection' 9 6 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' audit_author 2 4 'Structure model' database_2 3 4 'Structure model' pdbx_database_status 4 4 'Structure model' pdbx_nmr_software 5 4 'Structure model' pdbx_nmr_spectrometer 6 4 'Structure model' struct_ref_seq_dif 7 5 'Structure model' database_2 8 5 'Structure model' pdbx_database_status 9 6 'Structure model' chem_comp_atom 10 6 'Structure model' chem_comp_bond 11 6 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_audit_author.name' 2 4 'Structure model' '_pdbx_database_status.status_code_cs' 3 4 'Structure model' '_pdbx_nmr_software.name' 4 4 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_struct_ref_seq_dif.details' 6 5 'Structure model' '_database_2.pdbx_DOI' 7 5 'Structure model' '_database_2.pdbx_database_accession' 8 5 'Structure model' '_pdbx_database_status.status_code_nmr_data' 9 6 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2JT1 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2007-07-17 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type TargetDB StR82 . unspecified BMRB 15386 . unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Aramini, J.M.' 1 'Rossi, P.' 2 'Wang, H.' 3 'Nwosu, C.' 4 'Cunningham, K.' 5 'Ma, L.-C.' 6 'Xiao, R.' 7 'Liu, J.' 8 'Baran, M.C.' 9 'Swapna, G.V.T.' 10 'Acton, T.B.' 11 'Rost, B.' 12 'Montelione, G.T.' 13 'Northeast Structural Genomics Consortium (NESG)' 14 # _citation.id primary _citation.title 'Solution NMR structure of the plasmid-encoded fimbriae regulatory protein PefI from Salmonella enterica serovar Typhimurium.' _citation.journal_abbrev Proteins _citation.journal_volume 79 _citation.page_first 335 _citation.page_last 339 _citation.year 2011 _citation.journal_id_ASTM PSFGEY _citation.country US _citation.journal_id_ISSN 0887-3585 _citation.journal_id_CSD 0867 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 20979070 _citation.pdbx_database_id_DOI 10.1002/prot.22869 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Aramini, J.M.' 1 ? primary 'Rossi, P.' 2 ? primary 'Cort, J.R.' 3 ? primary 'Ma, L.C.' 4 ? primary 'Xiao, R.' 5 ? primary 'Acton, T.B.' 6 ? primary 'Montelione, G.T.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'PefI protein' _entity.formula_weight 8686.916 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MSESIVTKIISIVQERQNMDDGAPVKTRDIADAAGLSIYQVRLYLEQLHDVGVLEKVNAGKGVPGLWRLLEHHHHHH _entity_poly.pdbx_seq_one_letter_code_can MSESIVTKIISIVQERQNMDDGAPVKTRDIADAAGLSIYQVRLYLEQLHDVGVLEKVNAGKGVPGLWRLLEHHHHHH _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier StR82 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 GLU n 1 4 SER n 1 5 ILE n 1 6 VAL n 1 7 THR n 1 8 LYS n 1 9 ILE n 1 10 ILE n 1 11 SER n 1 12 ILE n 1 13 VAL n 1 14 GLN n 1 15 GLU n 1 16 ARG n 1 17 GLN n 1 18 ASN n 1 19 MET n 1 20 ASP n 1 21 ASP n 1 22 GLY n 1 23 ALA n 1 24 PRO n 1 25 VAL n 1 26 LYS n 1 27 THR n 1 28 ARG n 1 29 ASP n 1 30 ILE n 1 31 ALA n 1 32 ASP n 1 33 ALA n 1 34 ALA n 1 35 GLY n 1 36 LEU n 1 37 SER n 1 38 ILE n 1 39 TYR n 1 40 GLN n 1 41 VAL n 1 42 ARG n 1 43 LEU n 1 44 TYR n 1 45 LEU n 1 46 GLU n 1 47 GLN n 1 48 LEU n 1 49 HIS n 1 50 ASP n 1 51 VAL n 1 52 GLY n 1 53 VAL n 1 54 LEU n 1 55 GLU n 1 56 LYS n 1 57 VAL n 1 58 ASN n 1 59 ALA n 1 60 GLY n 1 61 LYS n 1 62 GLY n 1 63 VAL n 1 64 PRO n 1 65 GLY n 1 66 LEU n 1 67 TRP n 1 68 ARG n 1 69 LEU n 1 70 LEU n 1 71 GLU n 1 72 HIS n 1 73 HIS n 1 74 HIS n 1 75 HIS n 1 76 HIS n 1 77 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Salmonella _entity_src_gen.pdbx_gene_src_gene 'pefI, PSLT013' _entity_src_gen.gene_src_species 'Salmonella typhimurium' _entity_src_gen.gene_src_strain 'LT2, SGSC1412' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Salmonella typhimurium LT2' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 99287 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc 700720 _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)MGK' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector StR82-21.1 _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET21 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 MET 19 19 19 MET MET A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 THR 27 27 27 THR THR A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 GLN 40 40 40 GLN GLN A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 TYR 44 44 44 TYR TYR A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 GLN 47 47 47 GLN GLN A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 HIS 49 49 49 HIS HIS A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 PRO 64 64 64 PRO PRO A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 TRP 67 67 67 TRP TRP A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 HIS 72 72 ? ? ? A . n A 1 73 HIS 73 73 ? ? ? A . n A 1 74 HIS 74 74 ? ? ? A . n A 1 75 HIS 75 75 ? ? ? A . n A 1 76 HIS 76 76 ? ? ? A . n A 1 77 HIS 77 77 ? ? ? A . n # _cell.entry_id 2JT1 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2JT1 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2JT1 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2JT1 _struct.title ;Solution NMR structure of PefI (Plasmid-Encoded Fimbriae Regulatory) protein from Salmonella typhimurium. Northeast Structural Genomics target StR82 ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2JT1 _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text ;solution NMR structure, winged helix-turn-helix, transcription regulatory protein, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, TRANSCRIPTION ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q04822_SALTY _struct_ref.pdbx_db_accession Q04822 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MSESIVTKIISIVQERQNMDDGAPVKTRDIADAAGLSIYQVRLYLEQLHDVGVLEKVNAGKGVPGLWRLL _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2JT1 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 70 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q04822 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 70 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 70 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2JT1 GLU A 71 ? UNP Q04822 ? ? 'expression tag' 71 1 1 2JT1 HIS A 72 ? UNP Q04822 ? ? 'expression tag' 72 2 1 2JT1 HIS A 73 ? UNP Q04822 ? ? 'expression tag' 73 3 1 2JT1 HIS A 74 ? UNP Q04822 ? ? 'expression tag' 74 4 1 2JT1 HIS A 75 ? UNP Q04822 ? ? 'expression tag' 75 5 1 2JT1 HIS A 76 ? UNP Q04822 ? ? 'expression tag' 76 6 1 2JT1 HIS A 77 ? UNP Q04822 ? ? 'expression tag' 77 7 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 4 ? ASP A 21 ? SER A 4 ASP A 21 1 ? 18 HELX_P HELX_P2 2 THR A 27 ? GLY A 35 ? THR A 27 GLY A 35 1 ? 9 HELX_P HELX_P3 3 SER A 37 ? VAL A 51 ? SER A 37 VAL A 51 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 25 ? LYS A 26 ? VAL A 25 LYS A 26 A 2 LEU A 66 ? LEU A 69 ? LEU A 66 LEU A 69 A 3 LEU A 54 ? VAL A 57 ? LEU A 54 VAL A 57 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 25 ? N VAL A 25 O TRP A 67 ? O TRP A 67 A 2 3 O ARG A 68 ? O ARG A 68 N GLU A 55 ? N GLU A 55 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? -155.68 -22.71 2 1 SER A 4 ? ? 47.15 -79.71 3 1 ASP A 21 ? ? 64.10 -74.75 4 1 LEU A 70 ? ? -143.40 -49.82 5 2 ASP A 21 ? ? 69.14 -72.57 6 2 VAL A 53 ? ? -124.77 -56.88 7 2 ASN A 58 ? ? -173.00 -176.93 8 2 LEU A 70 ? ? -59.92 90.67 9 3 ASP A 21 ? ? 63.26 -74.58 10 3 ALA A 59 ? ? -69.16 96.80 11 3 LYS A 61 ? ? -175.33 -36.58 12 4 ASP A 21 ? ? 67.26 104.96 13 4 VAL A 53 ? ? -131.77 -51.94 14 4 LEU A 70 ? ? -68.12 92.90 15 5 ASP A 21 ? ? -51.11 95.57 16 6 ASN A 58 ? ? 177.50 -80.16 17 6 ALA A 59 ? ? -174.08 126.36 18 6 PRO A 64 ? ? -55.26 99.77 19 7 GLU A 3 ? ? -86.69 44.31 20 7 MET A 19 ? ? -91.50 -74.19 21 7 VAL A 53 ? ? -129.71 -58.51 22 7 ASN A 58 ? ? 77.05 131.28 23 7 ALA A 59 ? ? -67.22 -80.96 24 8 SER A 2 ? ? -99.79 -68.31 25 8 VAL A 53 ? ? -96.46 -60.15 26 8 LEU A 70 ? ? -69.12 93.15 27 9 LYS A 61 ? ? -61.38 97.29 28 9 ARG A 68 ? ? -165.30 117.55 29 10 ASP A 21 ? ? 68.47 -69.08 30 10 VAL A 53 ? ? -141.36 -60.92 31 10 ASN A 58 ? ? 162.40 -177.86 32 10 ALA A 59 ? ? -67.83 -172.04 33 11 PRO A 24 ? ? -48.34 177.39 34 11 PRO A 64 ? ? -67.75 95.25 35 12 SER A 2 ? ? -57.59 99.61 36 12 ASP A 21 ? ? 54.73 97.24 37 12 ASN A 58 ? ? 76.44 163.34 38 13 ASN A 58 ? ? 60.74 93.79 39 13 LEU A 70 ? ? -69.71 78.53 40 14 SER A 4 ? ? -176.56 111.56 41 14 VAL A 53 ? ? -107.65 -60.69 42 14 ASN A 58 ? ? -161.93 -167.38 43 14 LEU A 70 ? ? -67.32 92.25 44 15 MET A 19 ? ? -102.79 -69.64 45 15 ASP A 21 ? ? 69.30 -60.87 46 16 SER A 2 ? ? 57.59 72.70 47 16 ASP A 21 ? ? -63.01 94.08 48 17 ASP A 21 ? ? 59.22 -88.19 49 18 GLU A 3 ? ? -176.25 -171.89 50 18 ASN A 58 ? ? 49.37 87.09 51 18 LEU A 70 ? ? -68.18 86.14 52 19 ASP A 21 ? ? 74.54 -68.27 53 20 SER A 2 ? ? 56.56 18.95 54 20 ASN A 58 ? ? 56.50 88.78 # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation 0.10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2JT1 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation 1.6 _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 0.36 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method PDBStat # _pdbx_nmr_ensemble_rms.atom_type ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.chain_range_begin ? _pdbx_nmr_ensemble_rms.chain_range_end ? _pdbx_nmr_ensemble_rms.coord_average_rmsd_method ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error ? _pdbx_nmr_ensemble_rms.distance_rms_dev 0.01 _pdbx_nmr_ensemble_rms.distance_rms_dev_error ? _pdbx_nmr_ensemble_rms.entry_id 2JT1 _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev ? _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error ? _pdbx_nmr_ensemble_rms.residue_range_begin ? _pdbx_nmr_ensemble_rms.residue_range_end ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2JT1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;0.72 mM [U-100% 13C; U-100% 15N] Str82, 20 mM ammonium acetate, 450 mM sodium chloride, 10 mM DTT, 5 mM calcium chloride, 0.02 % sodium azide, 95% H2O/5% D2O ; 1 '95% H2O/5% D2O' ;0.46 mM [U-5% 13C; U-100% 15N] Str82, 20 mM ammonium acetate, 450 mM sodium chloride, 10 mM DTT, 5 mM calcium chloride, 0.02 % sodium azide, 95% H2O/5% D2O ; 2 '95% H2O/5% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id Str82 0.72 mM '[U-100% 13C; U-100% 15N]' 1 'ammonium acetate' 20 mM ? 1 'sodium chloride' 450 mM ? 1 DTT 10 mM ? 1 'calcium chloride' 5 mM ? 1 'sodium azide' 0.02 % ? 1 Str82 0.46 mM '[U-5% 13C; U-100% 15N]' 2 'ammonium acetate' 20 mM ? 2 'sodium chloride' 450 mM ? 2 DTT 10 mM ? 2 'calcium chloride' 5 mM ? 2 'sodium azide' 0.02 % ? 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 450 _pdbx_nmr_exptl_sample_conditions.pH 5.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D HNCO' 1 4 1 '3D HN(CA)CO' 1 5 1 '3D HNCACB' 1 6 1 '3D HN(COCA)CB' 1 7 1 '3D HBHA(CO)NH' 1 8 1 '3D HCCH-COSY' 1 9 1 '3D CCH-TOCSY' 1 10 1 '3D simultaneous CN-NOESY' 1 11 1 '3D HNHA' 1 12 1 '3D 1H-13C NOESY aromatic' 1 13 2 '2D 1H-13C HSQC stereospecific LEU/VAL methyl' # _pdbx_nmr_details.entry_id 2JT1 _pdbx_nmr_details.text ;THE PROTEIN IS MONOMERIC BY GEL FILTRATION CHROMATOGRAPHY AND STATIC LIGHT SCATTERING. THE STRUCTURE WAS DETERMINED USING TRIPLE RESONANCE NMR SPECTROSCOPY. AUTOMATED BACKBONE ASSIGNMENTS WERE MADE USING AUTOASSIGN, AND THE SIDE CHAIN ASSIGNMENTS WERE COMPLETED MANUALLY. AUTOMATIC NOESY ASSIGNMENTS WERE DETERMINED USING CYANA 2.1. DIHEDRAL ANGLE CONSTRAINTS WERE OBTAINED FROM TALOS. HYDROGEN BOND CONSTRAINTS WERE DETERMINED USING BOTH AUTOSTRUCTURE AND CYANA, AND WERE APPLIED ONLY IN THE FINAL REFINEMENT STAGE (CNS) OF THE STRUCTURE DETERMINATION. COMPLETENESS OF NMR ASSIGNMENTS (EXCLUDING C-TERMINAL HHHHHH): BACKBONE, 97.8%, SIDE CHAIN, 95.8%, AROMATICS, 100%, STEREOSPECIFIC METHYL, 100%, STEREOSPECIFIC SIDE CHAIN NH2: 100%. FINAL STRUCTURE QUALITY FACTORS (FOR RESIDUES 1 TO 71, PSVS 1.3), WHERE ORDERED RESIDUES [S(PHI) + S(PSI) > 1.8] COMPRISE: 5-19,23-57,66-69: (A) RMSD (ORDERED RESIDUES): BB, 0.5, HEAVY ATOM, 1.0. (B) RAMACHANDRAN STATISTICS FOR ORDERED RESIDUES: MOST FAVORED, 95.9%, ADDITIONALLY ALLOWED, 4.1%, GENEROUSLY ALLOWED, 0.0%, DISALLOWED, 0.0%. (C) PROCHECK SCORES FOR ORDERED RESIDUES (RAW/Z-): PHI-PSI, 0.16/0.94, ALL, 0.11/0.65. (D) MOLPROBITY CLASH SCORE (RAW/Z-): 21.29/-2.13. (E) RPF SCORES FOR GOODNESS OF FIT TO NOESY DATA (RESIDUES 1-71): RECALL, 0.983, PRECISION, 0.930, F-MEASURE, 0.956, DP-SCORE, 0.789. (F) NUMBER OF CLOSE CONTACTS PER 20 MODELS: 2. THE C-TERMINAL HIS TAG RESIDUES OF THE PROTEIN (HHHHHH) WERE NOT INCLUDED IN THE STRUCTURE CALCULATIONS AND HAVE BEEN OMITTED FROM THIS DEPOSITION. COORDINATES FOR THE FOLLOWING RESIDUES ARE NOT WELL DETERMINED (S(PHI) + S(PSI) < 1.8): 1-4,20-22,58-65,70-71. ; # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2JT1 _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1273 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 358 _pdbx_nmr_constraints.NOE_long_range_total_count 345 _pdbx_nmr_constraints.NOE_medium_range_total_count 235 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 335 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 46 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 46 # _pdbx_nmr_refine.entry_id 2JT1 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;THE FINAL STRUCTURES ARE BASED ON A TOTAL OF 1155 CONFORMATIONALLY-RESTRICTING NOE-DERIVED DISTANCE CONSTRAINTS, 92 DIHEDRAL ANGLE CONSTRAINTS, AND 52 HYDROGEN BOND CONSTRAINTS (19.1 CONSTRAINTS PER RESIDUE, 4.5 LONG RANGE CONSTRAINTS PER RESIDUE, COMPUTED FOR RESIDUES 1 TO 71 BY PSVS 1.3). STRUCTURE DETERMINATION WAS PERFORMED ITERATIVELY USING CYANA 2.1. THE 20 STRUCTURES OUT OF 100 WITH THE LOWEST TARGET FUNCTION WERE FURTHER REFINED BY RESTRAINED MOLECULAR DYNAMICS/ENERGY MINIMIZATION IN EXPLICIT WATER (CNS) WITH PARAM19. ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Bruker Biospin' collection TopSpin 1.3 1 'Zimmerman, Moseley, Kulikowski and Montelione' 'chemical shift assignment' AutoAssign 2.4.0 2 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 3 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 2.3 4 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS 1.1 5 'Huang, Tejero, Powers and Montelione' 'data analysis' AutoStructure 2.1.1 6 'Bhattacharya and Montelione' 'structure validation' PSVS 1.3 7 'Tejero and Montelione' 'pdb analysis' PdbStat 5.0 8 'Laskowski, MacArthur, Smith, Jones, Hutchinson, Morris, Moss and Th' 'structure validation' Procheck ? 9 Richardson 'structure validation' MolProbity ? 10 'Koradi, Billeter and Wuthrich' 'structure visualization' MOLMOL 2K-2 11 Goddard 'data analysis' Sparky 3.110 12 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 72 ? A HIS 72 2 1 Y 1 A HIS 73 ? A HIS 73 3 1 Y 1 A HIS 74 ? A HIS 74 4 1 Y 1 A HIS 75 ? A HIS 75 5 1 Y 1 A HIS 76 ? A HIS 76 6 1 Y 1 A HIS 77 ? A HIS 77 7 2 Y 1 A HIS 72 ? A HIS 72 8 2 Y 1 A HIS 73 ? A HIS 73 9 2 Y 1 A HIS 74 ? A HIS 74 10 2 Y 1 A HIS 75 ? A HIS 75 11 2 Y 1 A HIS 76 ? A HIS 76 12 2 Y 1 A HIS 77 ? A HIS 77 13 3 Y 1 A HIS 72 ? A HIS 72 14 3 Y 1 A HIS 73 ? A HIS 73 15 3 Y 1 A HIS 74 ? A HIS 74 16 3 Y 1 A HIS 75 ? A HIS 75 17 3 Y 1 A HIS 76 ? A HIS 76 18 3 Y 1 A HIS 77 ? A HIS 77 19 4 Y 1 A HIS 72 ? A HIS 72 20 4 Y 1 A HIS 73 ? A HIS 73 21 4 Y 1 A HIS 74 ? A HIS 74 22 4 Y 1 A HIS 75 ? A HIS 75 23 4 Y 1 A HIS 76 ? A HIS 76 24 4 Y 1 A HIS 77 ? A HIS 77 25 5 Y 1 A HIS 72 ? A HIS 72 26 5 Y 1 A HIS 73 ? A HIS 73 27 5 Y 1 A HIS 74 ? A HIS 74 28 5 Y 1 A HIS 75 ? A HIS 75 29 5 Y 1 A HIS 76 ? A HIS 76 30 5 Y 1 A HIS 77 ? A HIS 77 31 6 Y 1 A HIS 72 ? A HIS 72 32 6 Y 1 A HIS 73 ? A HIS 73 33 6 Y 1 A HIS 74 ? A HIS 74 34 6 Y 1 A HIS 75 ? A HIS 75 35 6 Y 1 A HIS 76 ? A HIS 76 36 6 Y 1 A HIS 77 ? A HIS 77 37 7 Y 1 A HIS 72 ? A HIS 72 38 7 Y 1 A HIS 73 ? A HIS 73 39 7 Y 1 A HIS 74 ? A HIS 74 40 7 Y 1 A HIS 75 ? A HIS 75 41 7 Y 1 A HIS 76 ? A HIS 76 42 7 Y 1 A HIS 77 ? A HIS 77 43 8 Y 1 A HIS 72 ? A HIS 72 44 8 Y 1 A HIS 73 ? A HIS 73 45 8 Y 1 A HIS 74 ? A HIS 74 46 8 Y 1 A HIS 75 ? A HIS 75 47 8 Y 1 A HIS 76 ? A HIS 76 48 8 Y 1 A HIS 77 ? A HIS 77 49 9 Y 1 A HIS 72 ? A HIS 72 50 9 Y 1 A HIS 73 ? A HIS 73 51 9 Y 1 A HIS 74 ? A HIS 74 52 9 Y 1 A HIS 75 ? A HIS 75 53 9 Y 1 A HIS 76 ? A HIS 76 54 9 Y 1 A HIS 77 ? A HIS 77 55 10 Y 1 A HIS 72 ? A HIS 72 56 10 Y 1 A HIS 73 ? A HIS 73 57 10 Y 1 A HIS 74 ? A HIS 74 58 10 Y 1 A HIS 75 ? A HIS 75 59 10 Y 1 A HIS 76 ? A HIS 76 60 10 Y 1 A HIS 77 ? A HIS 77 61 11 Y 1 A HIS 72 ? A HIS 72 62 11 Y 1 A HIS 73 ? A HIS 73 63 11 Y 1 A HIS 74 ? A HIS 74 64 11 Y 1 A HIS 75 ? A HIS 75 65 11 Y 1 A HIS 76 ? A HIS 76 66 11 Y 1 A HIS 77 ? A HIS 77 67 12 Y 1 A HIS 72 ? A HIS 72 68 12 Y 1 A HIS 73 ? A HIS 73 69 12 Y 1 A HIS 74 ? A HIS 74 70 12 Y 1 A HIS 75 ? A HIS 75 71 12 Y 1 A HIS 76 ? A HIS 76 72 12 Y 1 A HIS 77 ? A HIS 77 73 13 Y 1 A HIS 72 ? A HIS 72 74 13 Y 1 A HIS 73 ? A HIS 73 75 13 Y 1 A HIS 74 ? A HIS 74 76 13 Y 1 A HIS 75 ? A HIS 75 77 13 Y 1 A HIS 76 ? A HIS 76 78 13 Y 1 A HIS 77 ? A HIS 77 79 14 Y 1 A HIS 72 ? A HIS 72 80 14 Y 1 A HIS 73 ? A HIS 73 81 14 Y 1 A HIS 74 ? A HIS 74 82 14 Y 1 A HIS 75 ? A HIS 75 83 14 Y 1 A HIS 76 ? A HIS 76 84 14 Y 1 A HIS 77 ? A HIS 77 85 15 Y 1 A HIS 72 ? A HIS 72 86 15 Y 1 A HIS 73 ? A HIS 73 87 15 Y 1 A HIS 74 ? A HIS 74 88 15 Y 1 A HIS 75 ? A HIS 75 89 15 Y 1 A HIS 76 ? A HIS 76 90 15 Y 1 A HIS 77 ? A HIS 77 91 16 Y 1 A HIS 72 ? A HIS 72 92 16 Y 1 A HIS 73 ? A HIS 73 93 16 Y 1 A HIS 74 ? A HIS 74 94 16 Y 1 A HIS 75 ? A HIS 75 95 16 Y 1 A HIS 76 ? A HIS 76 96 16 Y 1 A HIS 77 ? A HIS 77 97 17 Y 1 A HIS 72 ? A HIS 72 98 17 Y 1 A HIS 73 ? A HIS 73 99 17 Y 1 A HIS 74 ? A HIS 74 100 17 Y 1 A HIS 75 ? A HIS 75 101 17 Y 1 A HIS 76 ? A HIS 76 102 17 Y 1 A HIS 77 ? A HIS 77 103 18 Y 1 A HIS 72 ? A HIS 72 104 18 Y 1 A HIS 73 ? A HIS 73 105 18 Y 1 A HIS 74 ? A HIS 74 106 18 Y 1 A HIS 75 ? A HIS 75 107 18 Y 1 A HIS 76 ? A HIS 76 108 18 Y 1 A HIS 77 ? A HIS 77 109 19 Y 1 A HIS 72 ? A HIS 72 110 19 Y 1 A HIS 73 ? A HIS 73 111 19 Y 1 A HIS 74 ? A HIS 74 112 19 Y 1 A HIS 75 ? A HIS 75 113 19 Y 1 A HIS 76 ? A HIS 76 114 19 Y 1 A HIS 77 ? A HIS 77 115 20 Y 1 A HIS 72 ? A HIS 72 116 20 Y 1 A HIS 73 ? A HIS 73 117 20 Y 1 A HIS 74 ? A HIS 74 118 20 Y 1 A HIS 75 ? A HIS 75 119 20 Y 1 A HIS 76 ? A HIS 76 120 20 Y 1 A HIS 77 ? A HIS 77 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PRO N N N N 233 PRO CA C N S 234 PRO C C N N 235 PRO O O N N 236 PRO CB C N N 237 PRO CG C N N 238 PRO CD C N N 239 PRO OXT O N N 240 PRO H H N N 241 PRO HA H N N 242 PRO HB2 H N N 243 PRO HB3 H N N 244 PRO HG2 H N N 245 PRO HG3 H N N 246 PRO HD2 H N N 247 PRO HD3 H N N 248 PRO HXT H N N 249 SER N N N N 250 SER CA C N S 251 SER C C N N 252 SER O O N N 253 SER CB C N N 254 SER OG O N N 255 SER OXT O N N 256 SER H H N N 257 SER H2 H N N 258 SER HA H N N 259 SER HB2 H N N 260 SER HB3 H N N 261 SER HG H N N 262 SER HXT H N N 263 THR N N N N 264 THR CA C N S 265 THR C C N N 266 THR O O N N 267 THR CB C N R 268 THR OG1 O N N 269 THR CG2 C N N 270 THR OXT O N N 271 THR H H N N 272 THR H2 H N N 273 THR HA H N N 274 THR HB H N N 275 THR HG1 H N N 276 THR HG21 H N N 277 THR HG22 H N N 278 THR HG23 H N N 279 THR HXT H N N 280 TRP N N N N 281 TRP CA C N S 282 TRP C C N N 283 TRP O O N N 284 TRP CB C N N 285 TRP CG C Y N 286 TRP CD1 C Y N 287 TRP CD2 C Y N 288 TRP NE1 N Y N 289 TRP CE2 C Y N 290 TRP CE3 C Y N 291 TRP CZ2 C Y N 292 TRP CZ3 C Y N 293 TRP CH2 C Y N 294 TRP OXT O N N 295 TRP H H N N 296 TRP H2 H N N 297 TRP HA H N N 298 TRP HB2 H N N 299 TRP HB3 H N N 300 TRP HD1 H N N 301 TRP HE1 H N N 302 TRP HE3 H N N 303 TRP HZ2 H N N 304 TRP HZ3 H N N 305 TRP HH2 H N N 306 TRP HXT H N N 307 TYR N N N N 308 TYR CA C N S 309 TYR C C N N 310 TYR O O N N 311 TYR CB C N N 312 TYR CG C Y N 313 TYR CD1 C Y N 314 TYR CD2 C Y N 315 TYR CE1 C Y N 316 TYR CE2 C Y N 317 TYR CZ C Y N 318 TYR OH O N N 319 TYR OXT O N N 320 TYR H H N N 321 TYR H2 H N N 322 TYR HA H N N 323 TYR HB2 H N N 324 TYR HB3 H N N 325 TYR HD1 H N N 326 TYR HD2 H N N 327 TYR HE1 H N N 328 TYR HE2 H N N 329 TYR HH H N N 330 TYR HXT H N N 331 VAL N N N N 332 VAL CA C N S 333 VAL C C N N 334 VAL O O N N 335 VAL CB C N N 336 VAL CG1 C N N 337 VAL CG2 C N N 338 VAL OXT O N N 339 VAL H H N N 340 VAL H2 H N N 341 VAL HA H N N 342 VAL HB H N N 343 VAL HG11 H N N 344 VAL HG12 H N N 345 VAL HG13 H N N 346 VAL HG21 H N N 347 VAL HG22 H N N 348 VAL HG23 H N N 349 VAL HXT H N N 350 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PRO N CA sing N N 222 PRO N CD sing N N 223 PRO N H sing N N 224 PRO CA C sing N N 225 PRO CA CB sing N N 226 PRO CA HA sing N N 227 PRO C O doub N N 228 PRO C OXT sing N N 229 PRO CB CG sing N N 230 PRO CB HB2 sing N N 231 PRO CB HB3 sing N N 232 PRO CG CD sing N N 233 PRO CG HG2 sing N N 234 PRO CG HG3 sing N N 235 PRO CD HD2 sing N N 236 PRO CD HD3 sing N N 237 PRO OXT HXT sing N N 238 SER N CA sing N N 239 SER N H sing N N 240 SER N H2 sing N N 241 SER CA C sing N N 242 SER CA CB sing N N 243 SER CA HA sing N N 244 SER C O doub N N 245 SER C OXT sing N N 246 SER CB OG sing N N 247 SER CB HB2 sing N N 248 SER CB HB3 sing N N 249 SER OG HG sing N N 250 SER OXT HXT sing N N 251 THR N CA sing N N 252 THR N H sing N N 253 THR N H2 sing N N 254 THR CA C sing N N 255 THR CA CB sing N N 256 THR CA HA sing N N 257 THR C O doub N N 258 THR C OXT sing N N 259 THR CB OG1 sing N N 260 THR CB CG2 sing N N 261 THR CB HB sing N N 262 THR OG1 HG1 sing N N 263 THR CG2 HG21 sing N N 264 THR CG2 HG22 sing N N 265 THR CG2 HG23 sing N N 266 THR OXT HXT sing N N 267 TRP N CA sing N N 268 TRP N H sing N N 269 TRP N H2 sing N N 270 TRP CA C sing N N 271 TRP CA CB sing N N 272 TRP CA HA sing N N 273 TRP C O doub N N 274 TRP C OXT sing N N 275 TRP CB CG sing N N 276 TRP CB HB2 sing N N 277 TRP CB HB3 sing N N 278 TRP CG CD1 doub Y N 279 TRP CG CD2 sing Y N 280 TRP CD1 NE1 sing Y N 281 TRP CD1 HD1 sing N N 282 TRP CD2 CE2 doub Y N 283 TRP CD2 CE3 sing Y N 284 TRP NE1 CE2 sing Y N 285 TRP NE1 HE1 sing N N 286 TRP CE2 CZ2 sing Y N 287 TRP CE3 CZ3 doub Y N 288 TRP CE3 HE3 sing N N 289 TRP CZ2 CH2 doub Y N 290 TRP CZ2 HZ2 sing N N 291 TRP CZ3 CH2 sing Y N 292 TRP CZ3 HZ3 sing N N 293 TRP CH2 HH2 sing N N 294 TRP OXT HXT sing N N 295 TYR N CA sing N N 296 TYR N H sing N N 297 TYR N H2 sing N N 298 TYR CA C sing N N 299 TYR CA CB sing N N 300 TYR CA HA sing N N 301 TYR C O doub N N 302 TYR C OXT sing N N 303 TYR CB CG sing N N 304 TYR CB HB2 sing N N 305 TYR CB HB3 sing N N 306 TYR CG CD1 doub Y N 307 TYR CG CD2 sing Y N 308 TYR CD1 CE1 sing Y N 309 TYR CD1 HD1 sing N N 310 TYR CD2 CE2 doub Y N 311 TYR CD2 HD2 sing N N 312 TYR CE1 CZ doub Y N 313 TYR CE1 HE1 sing N N 314 TYR CE2 CZ sing Y N 315 TYR CE2 HE2 sing N N 316 TYR CZ OH sing N N 317 TYR OH HH sing N N 318 TYR OXT HXT sing N N 319 VAL N CA sing N N 320 VAL N H sing N N 321 VAL N H2 sing N N 322 VAL CA C sing N N 323 VAL CA CB sing N N 324 VAL CA HA sing N N 325 VAL C O doub N N 326 VAL C OXT sing N N 327 VAL CB CG1 sing N N 328 VAL CB CG2 sing N N 329 VAL CB HB sing N N 330 VAL CG1 HG11 sing N N 331 VAL CG1 HG12 sing N N 332 VAL CG1 HG13 sing N N 333 VAL CG2 HG21 sing N N 334 VAL CG2 HG22 sing N N 335 VAL CG2 HG23 sing N N 336 VAL OXT HXT sing N N 337 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Bruker AVANCE 1 'Bruker Avance' 600 Bruker AVANCE 2 'Bruker Avance' # _atom_sites.entry_id 2JT1 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_