data_2JV2 # _entry.id 2JV2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2JV2 pdb_00002jv2 10.2210/pdb2jv2/pdb RCSB RCSB100326 ? ? BMRB 15465 ? 10.13018/BMR15465 WWPDB D_1000100326 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-09-25 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 4 'Structure model' 1 3 2024-05-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' struct_ref_seq_dif 6 4 'Structure model' chem_comp_atom 7 4 'Structure model' chem_comp_bond 8 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_struct_ref_seq_dif.details' 5 4 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_PDB_obs_spr.id SPRSDE _pdbx_database_PDB_obs_spr.date 2007-09-25 _pdbx_database_PDB_obs_spr.pdb_id 2JV2 _pdbx_database_PDB_obs_spr.replace_pdb_id 2I7M _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2JV2 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2007-09-11 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_id 15465 _pdbx_database_related.db_name BMRB _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Varnay, I.' 1 'Truffault, V.' 2 'Coles, M.' 3 # _citation.id primary _citation.title 'The Solution Structure of Ph1500-N' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Varnay, I.' 1 ? primary 'Djuranovic, S.' 2 ? primary 'Truffault, V.' 3 ? primary 'Lupas, A.' 4 ? primary 'Kessler, H.' 5 ? primary 'Coles, M.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Putative uncharacterized protein PH1500' _entity.formula_weight 9449.224 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details 'cis-P66, cis-P68' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;HHHHHHMEGVIMSELKLKPLPKVELPPDFVDVIRIKLQGKTVRTGDVIGISILGKEVKFKVVQAYPSPLRVEDRTKITLV THP ; _entity_poly.pdbx_seq_one_letter_code_can ;HHHHHHMEGVIMSELKLKPLPKVELPPDFVDVIRIKLQGKTVRTGDVIGISILGKEVKFKVVQAYPSPLRVEDRTKITLV THP ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 HIS n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 MET n 1 8 GLU n 1 9 GLY n 1 10 VAL n 1 11 ILE n 1 12 MET n 1 13 SER n 1 14 GLU n 1 15 LEU n 1 16 LYS n 1 17 LEU n 1 18 LYS n 1 19 PRO n 1 20 LEU n 1 21 PRO n 1 22 LYS n 1 23 VAL n 1 24 GLU n 1 25 LEU n 1 26 PRO n 1 27 PRO n 1 28 ASP n 1 29 PHE n 1 30 VAL n 1 31 ASP n 1 32 VAL n 1 33 ILE n 1 34 ARG n 1 35 ILE n 1 36 LYS n 1 37 LEU n 1 38 GLN n 1 39 GLY n 1 40 LYS n 1 41 THR n 1 42 VAL n 1 43 ARG n 1 44 THR n 1 45 GLY n 1 46 ASP n 1 47 VAL n 1 48 ILE n 1 49 GLY n 1 50 ILE n 1 51 SER n 1 52 ILE n 1 53 LEU n 1 54 GLY n 1 55 LYS n 1 56 GLU n 1 57 VAL n 1 58 LYS n 1 59 PHE n 1 60 LYS n 1 61 VAL n 1 62 VAL n 1 63 GLN n 1 64 ALA n 1 65 TYR n 1 66 PRO n 1 67 SER n 1 68 PRO n 1 69 LEU n 1 70 ARG n 1 71 VAL n 1 72 GLU n 1 73 ASP n 1 74 ARG n 1 75 THR n 1 76 LYS n 1 77 ILE n 1 78 THR n 1 79 LEU n 1 80 VAL n 1 81 THR n 1 82 HIS n 1 83 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Pyrococcus _entity_src_gen.pdbx_gene_src_gene PH1500 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pyrococcus horikoshii' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 53953 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector pET30b _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 HIS 1 1 ? ? ? A . n A 1 2 HIS 2 2 ? ? ? A . n A 1 3 HIS 3 3 ? ? ? A . n A 1 4 HIS 4 4 ? ? ? A . n A 1 5 HIS 5 5 ? ? ? A . n A 1 6 HIS 6 6 ? ? ? A . n A 1 7 MET 7 7 ? ? ? A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 MET 12 12 12 MET MET A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 PRO 21 21 21 PRO PRO A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 PRO 27 27 27 PRO PRO A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 GLN 38 38 38 GLN GLN A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 TYR 65 65 65 TYR TYR A . n A 1 66 PRO 66 66 66 PRO PRO A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 PRO 68 68 68 PRO PRO A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 ILE 77 77 77 ILE ILE A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 HIS 82 82 82 HIS HIS A . n A 1 83 PRO 83 83 83 PRO PRO A . n # _cell.entry_id 2JV2 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2JV2 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2JV2 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2JV2 _struct.title 'Solution Structure of the N-terminal Domain of PH1500' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 2JV2 _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' _struct_keywords.text 'AAA ATPASE NC-DOMAIN-LIKE, UNKNOWN FUNCTION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code O59169_PYRHO _struct_ref.pdbx_db_accession O59169 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MEGVIMSELKLKPLPKVELPPDFVDVIRIKLQGKTVRTGDVIGISILGKEVKFKVVQAYPSPLRVEDRTKITLVTHP _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2JV2 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 7 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 83 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O59169 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 77 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 7 _struct_ref_seq.pdbx_auth_seq_align_end 83 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2JV2 HIS A 1 ? UNP O59169 ? ? 'expression tag' 1 1 1 2JV2 HIS A 2 ? UNP O59169 ? ? 'expression tag' 2 2 1 2JV2 HIS A 3 ? UNP O59169 ? ? 'expression tag' 3 3 1 2JV2 HIS A 4 ? UNP O59169 ? ? 'expression tag' 4 4 1 2JV2 HIS A 5 ? UNP O59169 ? ? 'expression tag' 5 5 1 2JV2 HIS A 6 ? UNP O59169 ? ? 'expression tag' 6 6 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id PRO _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 26 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLN _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 38 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id PRO _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 26 _struct_conf.end_auth_comp_id GLN _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 38 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 TYR 65 A . ? TYR 65 A PRO 66 A ? PRO 66 A 1 -16.39 2 SER 67 A . ? SER 67 A PRO 68 A ? PRO 68 A 1 -16.56 3 TYR 65 A . ? TYR 65 A PRO 66 A ? PRO 66 A 2 -16.70 4 SER 67 A . ? SER 67 A PRO 68 A ? PRO 68 A 2 -15.04 5 TYR 65 A . ? TYR 65 A PRO 66 A ? PRO 66 A 3 -15.99 6 SER 67 A . ? SER 67 A PRO 68 A ? PRO 68 A 3 -24.19 7 TYR 65 A . ? TYR 65 A PRO 66 A ? PRO 66 A 4 -17.24 8 SER 67 A . ? SER 67 A PRO 68 A ? PRO 68 A 4 -17.72 9 TYR 65 A . ? TYR 65 A PRO 66 A ? PRO 66 A 5 -17.18 10 SER 67 A . ? SER 67 A PRO 68 A ? PRO 68 A 5 -17.45 11 TYR 65 A . ? TYR 65 A PRO 66 A ? PRO 66 A 6 -17.84 12 SER 67 A . ? SER 67 A PRO 68 A ? PRO 68 A 6 -17.17 13 TYR 65 A . ? TYR 65 A PRO 66 A ? PRO 66 A 7 -17.17 14 SER 67 A . ? SER 67 A PRO 68 A ? PRO 68 A 7 -20.12 15 TYR 65 A . ? TYR 65 A PRO 66 A ? PRO 66 A 8 -15.38 16 SER 67 A . ? SER 67 A PRO 68 A ? PRO 68 A 8 -21.47 17 TYR 65 A . ? TYR 65 A PRO 66 A ? PRO 66 A 9 -16.46 18 SER 67 A . ? SER 67 A PRO 68 A ? PRO 68 A 9 -24.68 19 TYR 65 A . ? TYR 65 A PRO 66 A ? PRO 66 A 10 -17.92 20 SER 67 A . ? SER 67 A PRO 68 A ? PRO 68 A 10 -19.67 21 TYR 65 A . ? TYR 65 A PRO 66 A ? PRO 66 A 11 -16.14 22 SER 67 A . ? SER 67 A PRO 68 A ? PRO 68 A 11 -15.14 23 TYR 65 A . ? TYR 65 A PRO 66 A ? PRO 66 A 12 -17.20 24 SER 67 A . ? SER 67 A PRO 68 A ? PRO 68 A 12 -23.05 25 TYR 65 A . ? TYR 65 A PRO 66 A ? PRO 66 A 13 -14.67 26 SER 67 A . ? SER 67 A PRO 68 A ? PRO 68 A 13 -14.90 27 TYR 65 A . ? TYR 65 A PRO 66 A ? PRO 66 A 14 -17.11 28 SER 67 A . ? SER 67 A PRO 68 A ? PRO 68 A 14 -25.65 29 TYR 65 A . ? TYR 65 A PRO 66 A ? PRO 66 A 15 -15.56 30 SER 67 A . ? SER 67 A PRO 68 A ? PRO 68 A 15 -22.36 31 TYR 65 A . ? TYR 65 A PRO 66 A ? PRO 66 A 16 -15.76 32 SER 67 A . ? SER 67 A PRO 68 A ? PRO 68 A 16 -24.02 33 TYR 65 A . ? TYR 65 A PRO 66 A ? PRO 66 A 17 -16.75 34 SER 67 A . ? SER 67 A PRO 68 A ? PRO 68 A 17 -25.61 35 TYR 65 A . ? TYR 65 A PRO 66 A ? PRO 66 A 18 -16.61 36 SER 67 A . ? SER 67 A PRO 68 A ? PRO 68 A 18 -16.47 37 TYR 65 A . ? TYR 65 A PRO 66 A ? PRO 66 A 19 -15.39 38 SER 67 A . ? SER 67 A PRO 68 A ? PRO 68 A 19 -23.37 39 TYR 65 A . ? TYR 65 A PRO 66 A ? PRO 66 A 20 -16.80 40 SER 67 A . ? SER 67 A PRO 68 A ? PRO 68 A 20 -24.94 41 TYR 65 A . ? TYR 65 A PRO 66 A ? PRO 66 A 21 -17.91 42 SER 67 A . ? SER 67 A PRO 68 A ? PRO 68 A 21 -21.02 43 TYR 65 A . ? TYR 65 A PRO 66 A ? PRO 66 A 22 -17.40 44 SER 67 A . ? SER 67 A PRO 68 A ? PRO 68 A 22 -26.11 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 47 ? ILE A 52 ? VAL A 47 ILE A 52 A 2 LYS A 55 ? TYR A 65 ? LYS A 55 TYR A 65 A 3 GLU A 14 ? PRO A 19 ? GLU A 14 PRO A 19 A 4 LYS A 76 ? LEU A 79 ? LYS A 76 LEU A 79 B 1 THR A 41 ? VAL A 42 ? THR A 41 VAL A 42 B 2 LEU A 69 ? ARG A 70 ? LEU A 69 ARG A 70 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 52 ? N ILE A 52 O LYS A 55 ? O LYS A 55 A 2 3 O TYR A 65 ? O TYR A 65 N GLU A 14 ? N GLU A 14 A 3 4 N LEU A 15 ? N LEU A 15 O LYS A 76 ? O LYS A 76 B 1 2 N VAL A 42 ? N VAL A 42 O LEU A 69 ? O LEU A 69 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 3 THR A 81 ? ? -148.02 -49.62 2 6 THR A 81 ? ? -147.71 33.22 3 9 THR A 81 ? ? -148.30 -52.97 4 11 THR A 81 ? ? -148.37 -47.44 5 18 VAL A 10 ? ? 51.16 85.84 6 21 THR A 81 ? ? -148.07 32.91 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 22 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2JV2 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2JV2 _pdbx_nmr_representative.selection_criteria 'minimized average structure' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1 mM HYPOTHETICAL PROTEIN PH1500, 50 mM PHOSPHATE BUFFER, 50 mM sodium chloride, 90 % H2O, 10 % D2O, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '1 mM [U-100% 15N] HYPOTHETICAL PROTEIN PH1500, 50 mM PHOSPHATE BUFFER, 50 mM sodium chloride, 90 % H2O, 10 % D2O, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' ;1 mM [U-100% 13C; U-100% 15N] HYPOTHETICAL PROTEIN PH1500, 50 mM PHOSPHATE BUFFER, 50 mM sodium chloride, 90 % H2O, 10 % D2O, 90% H2O/10% D2O ; 3 '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'HYPOTHETICAL PROTEIN PH1500' 1 mM ? 1 'PHOSPHATE BUFFER' 50 mM ? 1 'sodium chloride' 50 mM ? 1 H2O 90 % ? 1 D2O 10 % ? 1 'HYPOTHETICAL PROTEIN PH1500' 1 mM '[U-100% 15N]' 2 'PHOSPHATE BUFFER' 50 mM ? 2 'sodium chloride' 50 mM ? 2 H2O 90 % ? 2 D2O 10 % ? 2 'HYPOTHETICAL PROTEIN PH1500' 1 mM '[U-100% 13C; U-100% 15N]' 3 'PHOSPHATE BUFFER' 50 mM ? 3 'sodium chloride' 50 mM ? 3 H2O 90 % ? 3 D2O 10 % ? 3 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 50 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 300 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D NOESY' 1 2 2 '3D_15N-SEPARATED_ NOESY' 1 3 2 HNHA 1 4 2 HNHB 1 5 3 CNH-NOESY 1 6 3 3D_13C-SEPARATED_NOESY 1 7 3 '3D CBCA(CO)NH' 1 8 3 '3D HNCACB' 1 9 3 '3D HNCO' 1 10 3 '3D HCCH-TOCSY' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2JV2 _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 786 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 194 _pdbx_nmr_constraints.NOE_long_range_total_count 193 _pdbx_nmr_constraints.NOE_medium_range_total_count 96 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 269 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 51 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 19 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 58 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 58 # _pdbx_nmr_refine.entry_id 2JV2 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;Protocol including conformational database potential, BASED ON 748 DISTANCE RESTRAINTS, TALOS RESTRAINTS FOR 55 RESIDUES, 47 SIDECHAIN CHI1 AND 11 SIDECHAIN CHI2 DIHEDRAL RESTRAINTS, 34 HBOND RESTRAINTS AND 51 PHI AND 16 PSI J-COUPLING RESTRAINTS. ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'BRUNGER, A.T. et al.' 'structure solution' 'X-PLOR NIH' 2.9.4A 1 'BRUNGER, A.T. et al.' refinement 'X-PLOR NIH' 2.9.4A 2 Bruker collection XwinNMR 3.6 3 Bruker processing XwinNMR 3.6 4 'Goddard, T.D. et al.' 'data analysis' Sparky 3.110 5 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 1 ? A HIS 1 2 1 Y 1 A HIS 2 ? A HIS 2 3 1 Y 1 A HIS 3 ? A HIS 3 4 1 Y 1 A HIS 4 ? A HIS 4 5 1 Y 1 A HIS 5 ? A HIS 5 6 1 Y 1 A HIS 6 ? A HIS 6 7 1 Y 1 A MET 7 ? A MET 7 8 2 Y 1 A HIS 1 ? A HIS 1 9 2 Y 1 A HIS 2 ? A HIS 2 10 2 Y 1 A HIS 3 ? A HIS 3 11 2 Y 1 A HIS 4 ? A HIS 4 12 2 Y 1 A HIS 5 ? A HIS 5 13 2 Y 1 A HIS 6 ? A HIS 6 14 2 Y 1 A MET 7 ? A MET 7 15 3 Y 1 A HIS 1 ? A HIS 1 16 3 Y 1 A HIS 2 ? A HIS 2 17 3 Y 1 A HIS 3 ? A HIS 3 18 3 Y 1 A HIS 4 ? A HIS 4 19 3 Y 1 A HIS 5 ? A HIS 5 20 3 Y 1 A HIS 6 ? A HIS 6 21 3 Y 1 A MET 7 ? A MET 7 22 4 Y 1 A HIS 1 ? A HIS 1 23 4 Y 1 A HIS 2 ? A HIS 2 24 4 Y 1 A HIS 3 ? A HIS 3 25 4 Y 1 A HIS 4 ? A HIS 4 26 4 Y 1 A HIS 5 ? A HIS 5 27 4 Y 1 A HIS 6 ? A HIS 6 28 4 Y 1 A MET 7 ? A MET 7 29 5 Y 1 A HIS 1 ? A HIS 1 30 5 Y 1 A HIS 2 ? A HIS 2 31 5 Y 1 A HIS 3 ? A HIS 3 32 5 Y 1 A HIS 4 ? A HIS 4 33 5 Y 1 A HIS 5 ? A HIS 5 34 5 Y 1 A HIS 6 ? A HIS 6 35 5 Y 1 A MET 7 ? A MET 7 36 6 Y 1 A HIS 1 ? A HIS 1 37 6 Y 1 A HIS 2 ? A HIS 2 38 6 Y 1 A HIS 3 ? A HIS 3 39 6 Y 1 A HIS 4 ? A HIS 4 40 6 Y 1 A HIS 5 ? A HIS 5 41 6 Y 1 A HIS 6 ? A HIS 6 42 6 Y 1 A MET 7 ? A MET 7 43 7 Y 1 A HIS 1 ? A HIS 1 44 7 Y 1 A HIS 2 ? A HIS 2 45 7 Y 1 A HIS 3 ? A HIS 3 46 7 Y 1 A HIS 4 ? A HIS 4 47 7 Y 1 A HIS 5 ? A HIS 5 48 7 Y 1 A HIS 6 ? A HIS 6 49 7 Y 1 A MET 7 ? A MET 7 50 8 Y 1 A HIS 1 ? A HIS 1 51 8 Y 1 A HIS 2 ? A HIS 2 52 8 Y 1 A HIS 3 ? A HIS 3 53 8 Y 1 A HIS 4 ? A HIS 4 54 8 Y 1 A HIS 5 ? A HIS 5 55 8 Y 1 A HIS 6 ? A HIS 6 56 8 Y 1 A MET 7 ? A MET 7 57 9 Y 1 A HIS 1 ? A HIS 1 58 9 Y 1 A HIS 2 ? A HIS 2 59 9 Y 1 A HIS 3 ? A HIS 3 60 9 Y 1 A HIS 4 ? A HIS 4 61 9 Y 1 A HIS 5 ? A HIS 5 62 9 Y 1 A HIS 6 ? A HIS 6 63 9 Y 1 A MET 7 ? A MET 7 64 10 Y 1 A HIS 1 ? A HIS 1 65 10 Y 1 A HIS 2 ? A HIS 2 66 10 Y 1 A HIS 3 ? A HIS 3 67 10 Y 1 A HIS 4 ? A HIS 4 68 10 Y 1 A HIS 5 ? A HIS 5 69 10 Y 1 A HIS 6 ? A HIS 6 70 10 Y 1 A MET 7 ? A MET 7 71 11 Y 1 A HIS 1 ? A HIS 1 72 11 Y 1 A HIS 2 ? A HIS 2 73 11 Y 1 A HIS 3 ? A HIS 3 74 11 Y 1 A HIS 4 ? A HIS 4 75 11 Y 1 A HIS 5 ? A HIS 5 76 11 Y 1 A HIS 6 ? A HIS 6 77 11 Y 1 A MET 7 ? A MET 7 78 12 Y 1 A HIS 1 ? A HIS 1 79 12 Y 1 A HIS 2 ? A HIS 2 80 12 Y 1 A HIS 3 ? A HIS 3 81 12 Y 1 A HIS 4 ? A HIS 4 82 12 Y 1 A HIS 5 ? A HIS 5 83 12 Y 1 A HIS 6 ? A HIS 6 84 12 Y 1 A MET 7 ? A MET 7 85 13 Y 1 A HIS 1 ? A HIS 1 86 13 Y 1 A HIS 2 ? A HIS 2 87 13 Y 1 A HIS 3 ? A HIS 3 88 13 Y 1 A HIS 4 ? A HIS 4 89 13 Y 1 A HIS 5 ? A HIS 5 90 13 Y 1 A HIS 6 ? A HIS 6 91 13 Y 1 A MET 7 ? A MET 7 92 14 Y 1 A HIS 1 ? A HIS 1 93 14 Y 1 A HIS 2 ? A HIS 2 94 14 Y 1 A HIS 3 ? A HIS 3 95 14 Y 1 A HIS 4 ? A HIS 4 96 14 Y 1 A HIS 5 ? A HIS 5 97 14 Y 1 A HIS 6 ? A HIS 6 98 14 Y 1 A MET 7 ? A MET 7 99 15 Y 1 A HIS 1 ? A HIS 1 100 15 Y 1 A HIS 2 ? A HIS 2 101 15 Y 1 A HIS 3 ? A HIS 3 102 15 Y 1 A HIS 4 ? A HIS 4 103 15 Y 1 A HIS 5 ? A HIS 5 104 15 Y 1 A HIS 6 ? A HIS 6 105 15 Y 1 A MET 7 ? A MET 7 106 16 Y 1 A HIS 1 ? A HIS 1 107 16 Y 1 A HIS 2 ? A HIS 2 108 16 Y 1 A HIS 3 ? A HIS 3 109 16 Y 1 A HIS 4 ? A HIS 4 110 16 Y 1 A HIS 5 ? A HIS 5 111 16 Y 1 A HIS 6 ? A HIS 6 112 16 Y 1 A MET 7 ? A MET 7 113 17 Y 1 A HIS 1 ? A HIS 1 114 17 Y 1 A HIS 2 ? A HIS 2 115 17 Y 1 A HIS 3 ? A HIS 3 116 17 Y 1 A HIS 4 ? A HIS 4 117 17 Y 1 A HIS 5 ? A HIS 5 118 17 Y 1 A HIS 6 ? A HIS 6 119 17 Y 1 A MET 7 ? A MET 7 120 18 Y 1 A HIS 1 ? A HIS 1 121 18 Y 1 A HIS 2 ? A HIS 2 122 18 Y 1 A HIS 3 ? A HIS 3 123 18 Y 1 A HIS 4 ? A HIS 4 124 18 Y 1 A HIS 5 ? A HIS 5 125 18 Y 1 A HIS 6 ? A HIS 6 126 18 Y 1 A MET 7 ? A MET 7 127 19 Y 1 A HIS 1 ? A HIS 1 128 19 Y 1 A HIS 2 ? A HIS 2 129 19 Y 1 A HIS 3 ? A HIS 3 130 19 Y 1 A HIS 4 ? A HIS 4 131 19 Y 1 A HIS 5 ? A HIS 5 132 19 Y 1 A HIS 6 ? A HIS 6 133 19 Y 1 A MET 7 ? A MET 7 134 20 Y 1 A HIS 1 ? A HIS 1 135 20 Y 1 A HIS 2 ? A HIS 2 136 20 Y 1 A HIS 3 ? A HIS 3 137 20 Y 1 A HIS 4 ? A HIS 4 138 20 Y 1 A HIS 5 ? A HIS 5 139 20 Y 1 A HIS 6 ? A HIS 6 140 20 Y 1 A MET 7 ? A MET 7 141 21 Y 1 A HIS 1 ? A HIS 1 142 21 Y 1 A HIS 2 ? A HIS 2 143 21 Y 1 A HIS 3 ? A HIS 3 144 21 Y 1 A HIS 4 ? A HIS 4 145 21 Y 1 A HIS 5 ? A HIS 5 146 21 Y 1 A HIS 6 ? A HIS 6 147 21 Y 1 A MET 7 ? A MET 7 148 22 Y 1 A HIS 1 ? A HIS 1 149 22 Y 1 A HIS 2 ? A HIS 2 150 22 Y 1 A HIS 3 ? A HIS 3 151 22 Y 1 A HIS 4 ? A HIS 4 152 22 Y 1 A HIS 5 ? A HIS 5 153 22 Y 1 A HIS 6 ? A HIS 6 154 22 Y 1 A MET 7 ? A MET 7 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 GLN N N N N 57 GLN CA C N S 58 GLN C C N N 59 GLN O O N N 60 GLN CB C N N 61 GLN CG C N N 62 GLN CD C N N 63 GLN OE1 O N N 64 GLN NE2 N N N 65 GLN OXT O N N 66 GLN H H N N 67 GLN H2 H N N 68 GLN HA H N N 69 GLN HB2 H N N 70 GLN HB3 H N N 71 GLN HG2 H N N 72 GLN HG3 H N N 73 GLN HE21 H N N 74 GLN HE22 H N N 75 GLN HXT H N N 76 GLU N N N N 77 GLU CA C N S 78 GLU C C N N 79 GLU O O N N 80 GLU CB C N N 81 GLU CG C N N 82 GLU CD C N N 83 GLU OE1 O N N 84 GLU OE2 O N N 85 GLU OXT O N N 86 GLU H H N N 87 GLU H2 H N N 88 GLU HA H N N 89 GLU HB2 H N N 90 GLU HB3 H N N 91 GLU HG2 H N N 92 GLU HG3 H N N 93 GLU HE2 H N N 94 GLU HXT H N N 95 GLY N N N N 96 GLY CA C N N 97 GLY C C N N 98 GLY O O N N 99 GLY OXT O N N 100 GLY H H N N 101 GLY H2 H N N 102 GLY HA2 H N N 103 GLY HA3 H N N 104 GLY HXT H N N 105 HIS N N N N 106 HIS CA C N S 107 HIS C C N N 108 HIS O O N N 109 HIS CB C N N 110 HIS CG C Y N 111 HIS ND1 N Y N 112 HIS CD2 C Y N 113 HIS CE1 C Y N 114 HIS NE2 N Y N 115 HIS OXT O N N 116 HIS H H N N 117 HIS H2 H N N 118 HIS HA H N N 119 HIS HB2 H N N 120 HIS HB3 H N N 121 HIS HD1 H N N 122 HIS HD2 H N N 123 HIS HE1 H N N 124 HIS HE2 H N N 125 HIS HXT H N N 126 ILE N N N N 127 ILE CA C N S 128 ILE C C N N 129 ILE O O N N 130 ILE CB C N S 131 ILE CG1 C N N 132 ILE CG2 C N N 133 ILE CD1 C N N 134 ILE OXT O N N 135 ILE H H N N 136 ILE H2 H N N 137 ILE HA H N N 138 ILE HB H N N 139 ILE HG12 H N N 140 ILE HG13 H N N 141 ILE HG21 H N N 142 ILE HG22 H N N 143 ILE HG23 H N N 144 ILE HD11 H N N 145 ILE HD12 H N N 146 ILE HD13 H N N 147 ILE HXT H N N 148 LEU N N N N 149 LEU CA C N S 150 LEU C C N N 151 LEU O O N N 152 LEU CB C N N 153 LEU CG C N N 154 LEU CD1 C N N 155 LEU CD2 C N N 156 LEU OXT O N N 157 LEU H H N N 158 LEU H2 H N N 159 LEU HA H N N 160 LEU HB2 H N N 161 LEU HB3 H N N 162 LEU HG H N N 163 LEU HD11 H N N 164 LEU HD12 H N N 165 LEU HD13 H N N 166 LEU HD21 H N N 167 LEU HD22 H N N 168 LEU HD23 H N N 169 LEU HXT H N N 170 LYS N N N N 171 LYS CA C N S 172 LYS C C N N 173 LYS O O N N 174 LYS CB C N N 175 LYS CG C N N 176 LYS CD C N N 177 LYS CE C N N 178 LYS NZ N N N 179 LYS OXT O N N 180 LYS H H N N 181 LYS H2 H N N 182 LYS HA H N N 183 LYS HB2 H N N 184 LYS HB3 H N N 185 LYS HG2 H N N 186 LYS HG3 H N N 187 LYS HD2 H N N 188 LYS HD3 H N N 189 LYS HE2 H N N 190 LYS HE3 H N N 191 LYS HZ1 H N N 192 LYS HZ2 H N N 193 LYS HZ3 H N N 194 LYS HXT H N N 195 MET N N N N 196 MET CA C N S 197 MET C C N N 198 MET O O N N 199 MET CB C N N 200 MET CG C N N 201 MET SD S N N 202 MET CE C N N 203 MET OXT O N N 204 MET H H N N 205 MET H2 H N N 206 MET HA H N N 207 MET HB2 H N N 208 MET HB3 H N N 209 MET HG2 H N N 210 MET HG3 H N N 211 MET HE1 H N N 212 MET HE2 H N N 213 MET HE3 H N N 214 MET HXT H N N 215 PHE N N N N 216 PHE CA C N S 217 PHE C C N N 218 PHE O O N N 219 PHE CB C N N 220 PHE CG C Y N 221 PHE CD1 C Y N 222 PHE CD2 C Y N 223 PHE CE1 C Y N 224 PHE CE2 C Y N 225 PHE CZ C Y N 226 PHE OXT O N N 227 PHE H H N N 228 PHE H2 H N N 229 PHE HA H N N 230 PHE HB2 H N N 231 PHE HB3 H N N 232 PHE HD1 H N N 233 PHE HD2 H N N 234 PHE HE1 H N N 235 PHE HE2 H N N 236 PHE HZ H N N 237 PHE HXT H N N 238 PRO N N N N 239 PRO CA C N S 240 PRO C C N N 241 PRO O O N N 242 PRO CB C N N 243 PRO CG C N N 244 PRO CD C N N 245 PRO OXT O N N 246 PRO H H N N 247 PRO HA H N N 248 PRO HB2 H N N 249 PRO HB3 H N N 250 PRO HG2 H N N 251 PRO HG3 H N N 252 PRO HD2 H N N 253 PRO HD3 H N N 254 PRO HXT H N N 255 SER N N N N 256 SER CA C N S 257 SER C C N N 258 SER O O N N 259 SER CB C N N 260 SER OG O N N 261 SER OXT O N N 262 SER H H N N 263 SER H2 H N N 264 SER HA H N N 265 SER HB2 H N N 266 SER HB3 H N N 267 SER HG H N N 268 SER HXT H N N 269 THR N N N N 270 THR CA C N S 271 THR C C N N 272 THR O O N N 273 THR CB C N R 274 THR OG1 O N N 275 THR CG2 C N N 276 THR OXT O N N 277 THR H H N N 278 THR H2 H N N 279 THR HA H N N 280 THR HB H N N 281 THR HG1 H N N 282 THR HG21 H N N 283 THR HG22 H N N 284 THR HG23 H N N 285 THR HXT H N N 286 TYR N N N N 287 TYR CA C N S 288 TYR C C N N 289 TYR O O N N 290 TYR CB C N N 291 TYR CG C Y N 292 TYR CD1 C Y N 293 TYR CD2 C Y N 294 TYR CE1 C Y N 295 TYR CE2 C Y N 296 TYR CZ C Y N 297 TYR OH O N N 298 TYR OXT O N N 299 TYR H H N N 300 TYR H2 H N N 301 TYR HA H N N 302 TYR HB2 H N N 303 TYR HB3 H N N 304 TYR HD1 H N N 305 TYR HD2 H N N 306 TYR HE1 H N N 307 TYR HE2 H N N 308 TYR HH H N N 309 TYR HXT H N N 310 VAL N N N N 311 VAL CA C N S 312 VAL C C N N 313 VAL O O N N 314 VAL CB C N N 315 VAL CG1 C N N 316 VAL CG2 C N N 317 VAL OXT O N N 318 VAL H H N N 319 VAL H2 H N N 320 VAL HA H N N 321 VAL HB H N N 322 VAL HG11 H N N 323 VAL HG12 H N N 324 VAL HG13 H N N 325 VAL HG21 H N N 326 VAL HG22 H N N 327 VAL HG23 H N N 328 VAL HXT H N N 329 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 GLN N CA sing N N 54 GLN N H sing N N 55 GLN N H2 sing N N 56 GLN CA C sing N N 57 GLN CA CB sing N N 58 GLN CA HA sing N N 59 GLN C O doub N N 60 GLN C OXT sing N N 61 GLN CB CG sing N N 62 GLN CB HB2 sing N N 63 GLN CB HB3 sing N N 64 GLN CG CD sing N N 65 GLN CG HG2 sing N N 66 GLN CG HG3 sing N N 67 GLN CD OE1 doub N N 68 GLN CD NE2 sing N N 69 GLN NE2 HE21 sing N N 70 GLN NE2 HE22 sing N N 71 GLN OXT HXT sing N N 72 GLU N CA sing N N 73 GLU N H sing N N 74 GLU N H2 sing N N 75 GLU CA C sing N N 76 GLU CA CB sing N N 77 GLU CA HA sing N N 78 GLU C O doub N N 79 GLU C OXT sing N N 80 GLU CB CG sing N N 81 GLU CB HB2 sing N N 82 GLU CB HB3 sing N N 83 GLU CG CD sing N N 84 GLU CG HG2 sing N N 85 GLU CG HG3 sing N N 86 GLU CD OE1 doub N N 87 GLU CD OE2 sing N N 88 GLU OE2 HE2 sing N N 89 GLU OXT HXT sing N N 90 GLY N CA sing N N 91 GLY N H sing N N 92 GLY N H2 sing N N 93 GLY CA C sing N N 94 GLY CA HA2 sing N N 95 GLY CA HA3 sing N N 96 GLY C O doub N N 97 GLY C OXT sing N N 98 GLY OXT HXT sing N N 99 HIS N CA sing N N 100 HIS N H sing N N 101 HIS N H2 sing N N 102 HIS CA C sing N N 103 HIS CA CB sing N N 104 HIS CA HA sing N N 105 HIS C O doub N N 106 HIS C OXT sing N N 107 HIS CB CG sing N N 108 HIS CB HB2 sing N N 109 HIS CB HB3 sing N N 110 HIS CG ND1 sing Y N 111 HIS CG CD2 doub Y N 112 HIS ND1 CE1 doub Y N 113 HIS ND1 HD1 sing N N 114 HIS CD2 NE2 sing Y N 115 HIS CD2 HD2 sing N N 116 HIS CE1 NE2 sing Y N 117 HIS CE1 HE1 sing N N 118 HIS NE2 HE2 sing N N 119 HIS OXT HXT sing N N 120 ILE N CA sing N N 121 ILE N H sing N N 122 ILE N H2 sing N N 123 ILE CA C sing N N 124 ILE CA CB sing N N 125 ILE CA HA sing N N 126 ILE C O doub N N 127 ILE C OXT sing N N 128 ILE CB CG1 sing N N 129 ILE CB CG2 sing N N 130 ILE CB HB sing N N 131 ILE CG1 CD1 sing N N 132 ILE CG1 HG12 sing N N 133 ILE CG1 HG13 sing N N 134 ILE CG2 HG21 sing N N 135 ILE CG2 HG22 sing N N 136 ILE CG2 HG23 sing N N 137 ILE CD1 HD11 sing N N 138 ILE CD1 HD12 sing N N 139 ILE CD1 HD13 sing N N 140 ILE OXT HXT sing N N 141 LEU N CA sing N N 142 LEU N H sing N N 143 LEU N H2 sing N N 144 LEU CA C sing N N 145 LEU CA CB sing N N 146 LEU CA HA sing N N 147 LEU C O doub N N 148 LEU C OXT sing N N 149 LEU CB CG sing N N 150 LEU CB HB2 sing N N 151 LEU CB HB3 sing N N 152 LEU CG CD1 sing N N 153 LEU CG CD2 sing N N 154 LEU CG HG sing N N 155 LEU CD1 HD11 sing N N 156 LEU CD1 HD12 sing N N 157 LEU CD1 HD13 sing N N 158 LEU CD2 HD21 sing N N 159 LEU CD2 HD22 sing N N 160 LEU CD2 HD23 sing N N 161 LEU OXT HXT sing N N 162 LYS N CA sing N N 163 LYS N H sing N N 164 LYS N H2 sing N N 165 LYS CA C sing N N 166 LYS CA CB sing N N 167 LYS CA HA sing N N 168 LYS C O doub N N 169 LYS C OXT sing N N 170 LYS CB CG sing N N 171 LYS CB HB2 sing N N 172 LYS CB HB3 sing N N 173 LYS CG CD sing N N 174 LYS CG HG2 sing N N 175 LYS CG HG3 sing N N 176 LYS CD CE sing N N 177 LYS CD HD2 sing N N 178 LYS CD HD3 sing N N 179 LYS CE NZ sing N N 180 LYS CE HE2 sing N N 181 LYS CE HE3 sing N N 182 LYS NZ HZ1 sing N N 183 LYS NZ HZ2 sing N N 184 LYS NZ HZ3 sing N N 185 LYS OXT HXT sing N N 186 MET N CA sing N N 187 MET N H sing N N 188 MET N H2 sing N N 189 MET CA C sing N N 190 MET CA CB sing N N 191 MET CA HA sing N N 192 MET C O doub N N 193 MET C OXT sing N N 194 MET CB CG sing N N 195 MET CB HB2 sing N N 196 MET CB HB3 sing N N 197 MET CG SD sing N N 198 MET CG HG2 sing N N 199 MET CG HG3 sing N N 200 MET SD CE sing N N 201 MET CE HE1 sing N N 202 MET CE HE2 sing N N 203 MET CE HE3 sing N N 204 MET OXT HXT sing N N 205 PHE N CA sing N N 206 PHE N H sing N N 207 PHE N H2 sing N N 208 PHE CA C sing N N 209 PHE CA CB sing N N 210 PHE CA HA sing N N 211 PHE C O doub N N 212 PHE C OXT sing N N 213 PHE CB CG sing N N 214 PHE CB HB2 sing N N 215 PHE CB HB3 sing N N 216 PHE CG CD1 doub Y N 217 PHE CG CD2 sing Y N 218 PHE CD1 CE1 sing Y N 219 PHE CD1 HD1 sing N N 220 PHE CD2 CE2 doub Y N 221 PHE CD2 HD2 sing N N 222 PHE CE1 CZ doub Y N 223 PHE CE1 HE1 sing N N 224 PHE CE2 CZ sing Y N 225 PHE CE2 HE2 sing N N 226 PHE CZ HZ sing N N 227 PHE OXT HXT sing N N 228 PRO N CA sing N N 229 PRO N CD sing N N 230 PRO N H sing N N 231 PRO CA C sing N N 232 PRO CA CB sing N N 233 PRO CA HA sing N N 234 PRO C O doub N N 235 PRO C OXT sing N N 236 PRO CB CG sing N N 237 PRO CB HB2 sing N N 238 PRO CB HB3 sing N N 239 PRO CG CD sing N N 240 PRO CG HG2 sing N N 241 PRO CG HG3 sing N N 242 PRO CD HD2 sing N N 243 PRO CD HD3 sing N N 244 PRO OXT HXT sing N N 245 SER N CA sing N N 246 SER N H sing N N 247 SER N H2 sing N N 248 SER CA C sing N N 249 SER CA CB sing N N 250 SER CA HA sing N N 251 SER C O doub N N 252 SER C OXT sing N N 253 SER CB OG sing N N 254 SER CB HB2 sing N N 255 SER CB HB3 sing N N 256 SER OG HG sing N N 257 SER OXT HXT sing N N 258 THR N CA sing N N 259 THR N H sing N N 260 THR N H2 sing N N 261 THR CA C sing N N 262 THR CA CB sing N N 263 THR CA HA sing N N 264 THR C O doub N N 265 THR C OXT sing N N 266 THR CB OG1 sing N N 267 THR CB CG2 sing N N 268 THR CB HB sing N N 269 THR OG1 HG1 sing N N 270 THR CG2 HG21 sing N N 271 THR CG2 HG22 sing N N 272 THR CG2 HG23 sing N N 273 THR OXT HXT sing N N 274 TYR N CA sing N N 275 TYR N H sing N N 276 TYR N H2 sing N N 277 TYR CA C sing N N 278 TYR CA CB sing N N 279 TYR CA HA sing N N 280 TYR C O doub N N 281 TYR C OXT sing N N 282 TYR CB CG sing N N 283 TYR CB HB2 sing N N 284 TYR CB HB3 sing N N 285 TYR CG CD1 doub Y N 286 TYR CG CD2 sing Y N 287 TYR CD1 CE1 sing Y N 288 TYR CD1 HD1 sing N N 289 TYR CD2 CE2 doub Y N 290 TYR CD2 HD2 sing N N 291 TYR CE1 CZ doub Y N 292 TYR CE1 HE1 sing N N 293 TYR CE2 CZ sing Y N 294 TYR CE2 HE2 sing N N 295 TYR CZ OH sing N N 296 TYR OH HH sing N N 297 TYR OXT HXT sing N N 298 VAL N CA sing N N 299 VAL N H sing N N 300 VAL N H2 sing N N 301 VAL CA C sing N N 302 VAL CA CB sing N N 303 VAL CA HA sing N N 304 VAL C O doub N N 305 VAL C OXT sing N N 306 VAL CB CG1 sing N N 307 VAL CB CG2 sing N N 308 VAL CB HB sing N N 309 VAL CG1 HG11 sing N N 310 VAL CG1 HG12 sing N N 311 VAL CG1 HG13 sing N N 312 VAL CG2 HG21 sing N N 313 VAL CG2 HG22 sing N N 314 VAL CG2 HG23 sing N N 315 VAL OXT HXT sing N N 316 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Bruker DMX 1 'BRUKER DMX' 900 Bruker DMX 2 'BRUKER DMX' # _atom_sites.entry_id 2JV2 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_