data_2JX4 # _entry.id 2JX4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.351 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2JX4 pdb_00002jx4 10.2210/pdb2jx4/pdb RCSB RCSB100400 ? ? WWPDB D_1000100400 ? ? # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2JX4 _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2007-11-06 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bellot, G.' 1 'Demene, H.' 2 # _citation.id primary _citation.title 'Structure of the third intracellular loop of the vasopressin V2 receptor and conformational changes upon binding to gC1qR' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bellot, G.' 1 ? primary 'Granier, S.' 2 ? primary 'Bourguet, W.' 3 ? primary 'Seyer, R.' 4 ? primary 'Rahmeh, R.' 5 ? primary 'Mouillac, B.' 6 ? primary 'Pascal, R.' 7 ? primary 'Mendre, C.' 8 ? primary 'Demene, H.' 9 ? # _cell.entry_id 2JX4 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2JX4 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description 'Vasopressin V2 receptor' _entity.formula_weight 5534.353 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation M266NLE,M272NLE _entity.pdbx_fragment 'residues 225-273' _entity.details ;Synthesis under a cyclized form: thio-ether bridge between the C-terminal cysteine residue (CYC) and the N-terminal Glycine were constructed ; # _entity_name_com.entity_id 1 _entity_name_com.name 'Renal-type arginine vasopressin receptor, Antidiuretic hormone receptor, AVPR V2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code 'G(DGN)VLIFREIHASLVPGPSERAGRRRRGRRTGSPSEGAHVSAA(NLE)AKTVR(NLE)T(CCS)(NH2)' _entity_poly.pdbx_seq_one_letter_code_can GQVLIFREIHASLVPGPSERAGRRRRGRRTGSPSEGAHVSAALAKTVRLTCX _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 DGN n 1 3 VAL n 1 4 LEU n 1 5 ILE n 1 6 PHE n 1 7 ARG n 1 8 GLU n 1 9 ILE n 1 10 HIS n 1 11 ALA n 1 12 SER n 1 13 LEU n 1 14 VAL n 1 15 PRO n 1 16 GLY n 1 17 PRO n 1 18 SER n 1 19 GLU n 1 20 ARG n 1 21 ALA n 1 22 GLY n 1 23 ARG n 1 24 ARG n 1 25 ARG n 1 26 ARG n 1 27 GLY n 1 28 ARG n 1 29 ARG n 1 30 THR n 1 31 GLY n 1 32 SER n 1 33 PRO n 1 34 SER n 1 35 GLU n 1 36 GLY n 1 37 ALA n 1 38 HIS n 1 39 VAL n 1 40 SER n 1 41 ALA n 1 42 ALA n 1 43 NLE n 1 44 ALA n 1 45 LYS n 1 46 THR n 1 47 VAL n 1 48 ARG n 1 49 NLE n 1 50 THR n 1 51 CCS n 1 52 NH2 n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details 'The peptide was chemically synthesized. The source sequence is naturally found in rat (v2 rat receptor).' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code V2R_RAT _struct_ref.pdbx_db_accession Q00788 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code QVLIFREIHASLVPGPSERAGRRRRGRRTGSPSEGAHVSAAMAKTVRMT _struct_ref.pdbx_align_begin 225 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2JX4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 50 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q00788 _struct_ref_seq.db_align_beg 225 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 273 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 225 _struct_ref_seq.pdbx_auth_seq_align_end 273 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2JX4 GLY A 1 ? UNP Q00788 ? ? 'see remark 999' 1 1 1 2JX4 NLE A 43 ? UNP Q00788 MET 266 'engineered mutation' 266 2 1 2JX4 NLE A 49 ? UNP Q00788 MET 272 'engineered mutation' 272 3 1 2JX4 CCS A 51 ? UNP Q00788 ? ? 'see remark 999' 51 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 CCS 'L-peptide linking' n 'CARBOXYMETHYLATED CYSTEINE' ? 'C5 H9 N O4 S' 179.194 DGN 'D-peptide linking' . D-GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 NLE 'L-peptide linking' n NORLEUCINE ? 'C6 H13 N O2' 131.173 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-1H TOCSY' 1 2 1 '2D DQF-COSY' 1 3 1 '2D 1H-1H NOESY' 2 4 1 '2D 1H-1H TOCSY' 2 5 1 '2D 1H-1H NOESY' 3 6 1 '2D DQF-COSY' 3 7 1 '2D 1H-1H TOCSY' 3 8 1 '2D 1H-1H NOESY' 3 9 2 '2D 1H-1H TOCSY' 3 10 2 '2D 1H-1H NOESY' 2 11 1 '2D 1H-13C HSQC' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.temperature_units 1 ? 4 ambient ? 308 K 2 ? 4 ambient ? 318 K 3 ? 4 ambient ? 293 K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1mM H2O, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '1mM D2O, 100% D2O' 2 '100% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Varian INOVA 1 'Varian INOVA' 600 Bruker AVANCE 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2JX4 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 800 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2JX4 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2JX4 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal ;Linge, O'Donoghue and Nilges ; 'structure solution' ARIA 2.0 1 ;Linge, O'Donoghue and Nilges ; refinement ARIA 2.0 2 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2JX4 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2JX4 _struct.title 'NMR structure of the intracellular loop (i3) of the vasopressin V2 receptor (GPCR)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2JX4 _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' _struct_keywords.text ;protein, G-protein coupled receptor, Glycoprotein, Lipoprotein, Membrane, Palmitate, Phosphorylation, Receptor, Transducer, Transmembrane, MEMBRANE PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 DGN A 2 ? VAL A 14 ? DGN A 225 VAL A 237 1 ? 13 HELX_P HELX_P2 2 VAL A 14 ? ARG A 20 ? VAL A 237 ARG A 243 1 ? 7 HELX_P HELX_P3 3 THR A 30 ? CCS A 51 ? THR A 253 CCS A 51 1 ? 22 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale one ? A GLY 1 N ? ? ? 1_555 A CCS 51 CE ? ? A GLY 1 A CCS 51 1_555 ? ? ? ? ? ? ? 1.341 ? ? covale2 covale both ? A GLY 1 C ? ? ? 1_555 A DGN 2 N ? ? A GLY 1 A DGN 225 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale3 covale both ? A CCS 51 C ? ? ? 1_555 A NH2 52 N ? ? A CCS 51 A NH2 52 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale4 covale both ? A CCS 51 N ? ? ? 1_555 A THR 50 C ? ? A CCS 51 A THR 273 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale5 covale both ? A DGN 2 C ? ? ? 1_555 A VAL 3 N ? ? A DGN 225 A VAL 226 1_555 ? ? ? ? ? ? ? 1.321 ? ? covale6 covale both ? A ALA 42 C ? ? ? 1_555 A NLE 43 N ? ? A ALA 265 A NLE 266 1_555 ? ? ? ? ? ? ? 1.313 ? ? covale7 covale both ? A NLE 43 C ? ? ? 1_555 A ALA 44 N ? ? A NLE 266 A ALA 267 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale8 covale both ? A ARG 48 C ? ? ? 1_555 A NLE 49 N ? ? A ARG 271 A NLE 272 1_555 ? ? ? ? ? ? ? 1.324 ? ? covale9 covale both ? A NLE 49 C ? ? ? 1_555 A THR 50 N ? ? A NLE 272 A THR 273 1_555 ? ? ? ? ? ? ? 1.325 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id NH2 _struct_site.pdbx_auth_seq_id 52 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 6 _struct_site.details 'BINDING SITE FOR RESIDUE NH2 A 52' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 GLY A 1 ? GLY A 1 . ? 1_555 ? 2 AC1 6 CCS A 51 ? CCS A 51 . ? 1_555 ? 3 AC1 6 PHE A 6 ? PHE A 229 . ? 1_555 ? 4 AC1 6 VAL A 47 ? VAL A 270 . ? 1_555 ? 5 AC1 6 ARG A 48 ? ARG A 271 . ? 1_555 ? 6 AC1 6 THR A 50 ? THR A 273 . ? 1_555 ? # _atom_sites.entry_id 2JX4 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 DGN 2 225 225 DGN DGN A . n A 1 3 VAL 3 226 226 VAL VAL A . n A 1 4 LEU 4 227 227 LEU LEU A . n A 1 5 ILE 5 228 228 ILE ILE A . n A 1 6 PHE 6 229 229 PHE PHE A . n A 1 7 ARG 7 230 230 ARG ARG A . n A 1 8 GLU 8 231 231 GLU GLU A . n A 1 9 ILE 9 232 232 ILE ILE A . n A 1 10 HIS 10 233 233 HIS HIS A . n A 1 11 ALA 11 234 234 ALA ALA A . n A 1 12 SER 12 235 235 SER SER A . n A 1 13 LEU 13 236 236 LEU LEU A . n A 1 14 VAL 14 237 237 VAL VAL A . n A 1 15 PRO 15 238 238 PRO PRO A . n A 1 16 GLY 16 239 239 GLY GLY A . n A 1 17 PRO 17 240 240 PRO PRO A . n A 1 18 SER 18 241 241 SER SER A . n A 1 19 GLU 19 242 242 GLU GLU A . n A 1 20 ARG 20 243 243 ARG ARG A . n A 1 21 ALA 21 244 244 ALA ALA A . n A 1 22 GLY 22 245 245 GLY GLY A . n A 1 23 ARG 23 246 246 ARG ARG A . n A 1 24 ARG 24 247 247 ARG ARG A . n A 1 25 ARG 25 248 248 ARG ARG A . n A 1 26 ARG 26 249 249 ARG ARG A . n A 1 27 GLY 27 250 250 GLY GLY A . n A 1 28 ARG 28 251 251 ARG ARG A . n A 1 29 ARG 29 252 252 ARG ARG A . n A 1 30 THR 30 253 253 THR THR A . n A 1 31 GLY 31 254 254 GLY GLY A . n A 1 32 SER 32 255 255 SER SER A . n A 1 33 PRO 33 256 256 PRO PRO A . n A 1 34 SER 34 257 257 SER SER A . n A 1 35 GLU 35 258 258 GLU GLU A . n A 1 36 GLY 36 259 259 GLY GLY A . n A 1 37 ALA 37 260 260 ALA ALA A . n A 1 38 HIS 38 261 261 HIS HIS A . n A 1 39 VAL 39 262 262 VAL VAL A . n A 1 40 SER 40 263 263 SER SER A . n A 1 41 ALA 41 264 264 ALA ALA A . n A 1 42 ALA 42 265 265 ALA ALA A . n A 1 43 NLE 43 266 266 NLE NLE A . n A 1 44 ALA 44 267 267 ALA ALA A . n A 1 45 LYS 45 268 268 LYS LYS A . n A 1 46 THR 46 269 269 THR THR A . n A 1 47 VAL 47 270 270 VAL VAL A . n A 1 48 ARG 48 271 271 ARG ARG A . n A 1 49 NLE 49 272 272 NLE NLE A . n A 1 50 THR 50 273 273 THR THR A . n A 1 51 CCS 51 51 51 CCS CCS A . n A 1 52 NH2 52 52 52 NH2 NH2 A . n # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A DGN 2 A DGN 225 ? GLN D-GLUTAMINE 2 A NLE 43 A NLE 266 ? LEU NORLEUCINE 3 A NLE 49 A NLE 272 ? LEU NORLEUCINE 4 A CCS 51 A CCS 51 ? CYS 'CARBOXYMETHYLATED CYSTEINE' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-11-18 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2021-11-10 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_spectrometer 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' struct_conn 6 3 'Structure model' struct_ref_seq_dif 7 3 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_spectrometer.model' 4 3 'Structure model' '_struct_conn.pdbx_dist_value' 5 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 6 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 7 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 8 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 9 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 10 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 11 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 12 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 13 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 14 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' 15 3 'Structure model' '_struct_conn.ptnr2_label_seq_id' 16 3 'Structure model' '_struct_ref_seq_dif.details' 17 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 18 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 19 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_entry_details.sequence_details 'THESE ARE LINKER. THIO-ETHER BRIDGE BETWEEN CCS AND GLY WERE CONSTRUCTED.' _pdbx_entry_details.entry_id 2JX4 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.has_ligand_of_interest ? # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id H2O 1 mM ? 1 D2O 1 mM ? 2 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A DGN 225 ? ? H A ILE 228 ? ? 1.55 2 1 N A GLY 1 ? ? CD A CCS 51 ? ? 1.84 3 2 O A DGN 225 ? ? H A ILE 228 ? ? 1.54 4 2 N A GLY 1 ? ? CD A CCS 51 ? ? 1.84 5 3 O A DGN 225 ? ? H A ILE 228 ? ? 1.55 6 3 N A GLY 1 ? ? CD A CCS 51 ? ? 1.84 7 4 O A DGN 225 ? ? H A ILE 228 ? ? 1.56 8 4 N A GLY 1 ? ? CD A CCS 51 ? ? 1.85 9 5 O A DGN 225 ? ? H A ILE 228 ? ? 1.55 10 5 N A GLY 1 ? ? CD A CCS 51 ? ? 1.84 11 6 O A DGN 225 ? ? H A ILE 228 ? ? 1.56 12 6 N A GLY 1 ? ? CD A CCS 51 ? ? 1.84 13 7 O A DGN 225 ? ? H A ILE 228 ? ? 1.57 14 7 N A GLY 1 ? ? CD A CCS 51 ? ? 1.84 15 8 O A DGN 225 ? ? H A ILE 228 ? ? 1.56 16 8 N A GLY 1 ? ? CD A CCS 51 ? ? 1.84 17 9 O A DGN 225 ? ? H A ILE 228 ? ? 1.56 18 9 N A GLY 1 ? ? CD A CCS 51 ? ? 1.84 19 10 O A DGN 225 ? ? H A ILE 228 ? ? 1.56 20 10 N A GLY 1 ? ? CD A CCS 51 ? ? 1.84 21 11 O A DGN 225 ? ? H A ILE 228 ? ? 1.57 22 11 N A GLY 1 ? ? CD A CCS 51 ? ? 1.84 23 12 O A DGN 225 ? ? H A ILE 228 ? ? 1.57 24 12 N A GLY 1 ? ? CD A CCS 51 ? ? 1.84 25 13 H1 A GLY 1 ? ? HD3 A CCS 51 ? ? 1.15 26 13 O A DGN 225 ? ? H A ILE 228 ? ? 1.57 27 13 N A GLY 1 ? ? CD A CCS 51 ? ? 1.87 28 14 O A DGN 225 ? ? H A ILE 228 ? ? 1.47 29 14 N A GLY 1 ? ? CD A CCS 51 ? ? 1.84 30 15 O A DGN 225 ? ? H A ILE 228 ? ? 1.56 31 15 N A GLY 1 ? ? CD A CCS 51 ? ? 1.84 32 16 O A DGN 225 ? ? H A ILE 228 ? ? 1.55 33 16 N A GLY 1 ? ? CD A CCS 51 ? ? 1.84 34 17 H1 A GLY 1 ? ? HD3 A CCS 51 ? ? 1.15 35 17 O A DGN 225 ? ? H A ILE 228 ? ? 1.58 36 17 N A GLY 1 ? ? CD A CCS 51 ? ? 1.87 37 18 HA A LEU 227 ? ? HE A ARG 230 ? ? 1.32 38 18 O A DGN 225 ? ? H A ILE 228 ? ? 1.47 39 18 N A GLY 1 ? ? CD A CCS 51 ? ? 1.84 40 19 O A DGN 225 ? ? H A ILE 228 ? ? 1.54 41 19 N A GLY 1 ? ? CD A CCS 51 ? ? 1.84 42 20 O A DGN 225 ? ? H A ILE 228 ? ? 1.56 43 20 N A GLY 1 ? ? CD A CCS 51 ? ? 1.84 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 DGN A 225 ? ? 160.64 64.60 2 1 VAL A 226 ? ? -37.62 -26.67 3 1 ARG A 248 ? ? -102.29 -79.09 4 1 ARG A 249 ? ? -59.34 -179.22 5 1 ARG A 251 ? ? -88.94 34.41 6 1 ARG A 252 ? ? -140.28 -34.42 7 1 THR A 273 ? ? -84.97 -75.13 8 2 DGN A 225 ? ? 161.35 64.87 9 2 VAL A 226 ? ? -37.16 -26.74 10 2 ARG A 248 ? ? -69.54 -98.99 11 2 ARG A 249 ? ? -63.54 -170.76 12 2 ARG A 251 ? ? -78.74 39.94 13 2 THR A 273 ? ? -84.14 -78.80 14 3 DGN A 225 ? ? 160.65 65.77 15 3 VAL A 226 ? ? -37.42 -26.94 16 3 ARG A 243 ? ? -55.50 -9.27 17 3 ALA A 244 ? ? -156.22 -5.72 18 3 ARG A 248 ? ? -95.89 -149.04 19 3 ARG A 249 ? ? -58.06 -167.85 20 3 ARG A 251 ? ? -82.79 43.60 21 3 THR A 273 ? ? -83.87 -79.33 22 4 DGN A 225 ? ? 160.56 65.98 23 4 VAL A 226 ? ? -37.70 -26.84 24 4 ARG A 243 ? ? -69.05 0.39 25 4 ALA A 244 ? ? -154.57 -5.53 26 4 ARG A 248 ? ? -119.61 -134.81 27 4 ARG A 251 ? ? -79.79 45.71 28 4 ARG A 252 ? ? -135.56 -31.01 29 4 THR A 273 ? ? -83.03 -78.30 30 5 DGN A 225 ? ? 160.00 65.82 31 5 VAL A 226 ? ? -37.18 -26.93 32 5 ARG A 243 ? ? -76.88 42.88 33 5 ALA A 244 ? ? -143.10 -48.52 34 5 ARG A 247 ? ? -29.53 -51.75 35 5 ARG A 248 ? ? -114.80 -169.82 36 5 ARG A 249 ? ? -49.64 161.30 37 5 ARG A 251 ? ? -104.18 -126.47 38 5 THR A 273 ? ? -84.65 -78.89 39 6 DGN A 225 ? ? 161.63 65.67 40 6 VAL A 226 ? ? -37.52 -26.96 41 6 ARG A 243 ? ? -79.05 41.14 42 6 ALA A 244 ? ? -126.69 -62.33 43 6 ARG A 248 ? ? -90.85 -85.22 44 6 ARG A 249 ? ? -56.69 174.18 45 6 ARG A 251 ? ? -80.49 40.97 46 6 ARG A 252 ? ? -132.35 -35.01 47 6 THR A 273 ? ? -84.29 -78.76 48 7 DGN A 225 ? ? 160.54 67.54 49 7 VAL A 226 ? ? -37.59 -26.32 50 7 ARG A 248 ? ? -69.10 -144.97 51 7 ARG A 249 ? ? -56.61 -167.90 52 7 ARG A 251 ? ? -79.90 41.78 53 7 THR A 273 ? ? -83.08 -78.87 54 8 DGN A 225 ? ? 162.54 66.05 55 8 VAL A 226 ? ? -37.86 -25.92 56 8 ALA A 244 ? ? -162.73 -4.43 57 8 ARG A 251 ? ? -86.54 45.10 58 8 THR A 273 ? ? -85.65 -75.83 59 9 DGN A 225 ? ? 163.65 65.78 60 9 VAL A 226 ? ? -37.46 -26.16 61 9 ARG A 248 ? ? -67.33 -165.98 62 9 ARG A 249 ? ? -48.50 157.80 63 9 ARG A 251 ? ? -80.85 43.60 64 9 THR A 273 ? ? -83.69 -77.68 65 10 DGN A 225 ? ? 160.72 61.87 66 10 VAL A 226 ? ? -34.03 -26.65 67 10 ARG A 243 ? ? -75.41 32.35 68 10 ALA A 244 ? ? -126.42 -53.92 69 10 ARG A 248 ? ? -99.24 -89.72 70 10 ARG A 251 ? ? -80.78 36.04 71 10 THR A 273 ? ? -82.70 -77.15 72 11 DGN A 225 ? ? 160.22 67.51 73 11 VAL A 226 ? ? -37.83 -26.42 74 11 ARG A 248 ? ? -83.29 -88.88 75 11 ARG A 249 ? ? -64.41 -166.61 76 11 ARG A 251 ? ? -79.67 39.65 77 11 ARG A 252 ? ? -140.92 -29.07 78 11 THR A 273 ? ? -86.63 -76.74 79 12 DGN A 225 ? ? 156.66 66.79 80 12 VAL A 226 ? ? -39.15 -26.37 81 12 ARG A 248 ? ? -76.46 -157.34 82 12 ARG A 249 ? ? -46.33 155.70 83 12 ARG A 251 ? ? -83.91 44.84 84 12 THR A 273 ? ? -86.95 -81.89 85 13 DGN A 225 ? ? 161.72 66.89 86 13 VAL A 226 ? ? -39.06 -26.32 87 13 ARG A 248 ? ? -109.47 -78.55 88 13 ARG A 251 ? ? -83.75 40.57 89 13 ARG A 252 ? ? -134.92 -35.73 90 13 THR A 273 ? ? -84.07 -77.77 91 14 DGN A 225 ? ? 163.93 59.00 92 14 ARG A 243 ? ? -46.76 -4.18 93 14 ALA A 244 ? ? -140.30 -16.50 94 14 ARG A 248 ? ? -100.96 -118.45 95 14 ARG A 249 ? ? -61.27 -165.29 96 14 ARG A 251 ? ? -79.70 38.92 97 14 ARG A 252 ? ? -107.37 -70.75 98 14 THR A 273 ? ? -81.89 -70.18 99 15 DGN A 225 ? ? 160.65 67.32 100 15 VAL A 226 ? ? -37.95 -26.42 101 15 ARG A 248 ? ? -89.36 -155.08 102 15 ARG A 249 ? ? -45.11 155.18 103 15 ARG A 251 ? ? -78.34 37.55 104 15 THR A 273 ? ? -85.19 -79.49 105 16 DGN A 225 ? ? 162.38 66.72 106 16 VAL A 226 ? ? -37.44 -25.79 107 16 ARG A 249 ? ? -46.25 155.15 108 16 ARG A 251 ? ? -81.57 44.06 109 16 THR A 273 ? ? -82.25 -77.67 110 17 DGN A 225 ? ? 160.73 67.41 111 17 VAL A 226 ? ? -39.12 -26.46 112 17 ARG A 243 ? ? -58.95 -9.82 113 17 ARG A 248 ? ? -93.27 -86.72 114 17 ARG A 249 ? ? -62.90 -165.82 115 17 ARG A 251 ? ? -81.21 40.82 116 17 ARG A 252 ? ? -131.79 -31.08 117 17 THR A 273 ? ? -86.50 -79.41 118 18 DGN A 225 ? ? 164.59 57.39 119 18 VAL A 226 ? ? -39.49 -25.28 120 18 ARG A 243 ? ? -53.56 4.42 121 18 ARG A 247 ? ? -32.30 -39.62 122 18 ARG A 248 ? ? -64.04 -162.50 123 18 ARG A 249 ? ? -61.32 -156.01 124 18 ARG A 251 ? ? -79.56 42.02 125 19 DGN A 225 ? ? 162.10 64.38 126 19 VAL A 226 ? ? -37.09 -26.54 127 19 ARG A 248 ? ? -67.62 -154.76 128 19 ARG A 249 ? ? -50.46 171.94 129 19 ARG A 251 ? ? -84.98 44.73 130 19 THR A 273 ? ? -85.02 -74.29 131 20 DGN A 225 ? ? 162.60 66.40 132 20 VAL A 226 ? ? -37.64 -26.08 133 20 ARG A 248 ? ? -65.25 -169.12 134 20 ARG A 249 ? ? -52.33 174.41 135 20 ARG A 251 ? ? -84.37 35.97 136 20 THR A 273 ? ? -82.91 -77.73 #