data_2JXB
# 
_entry.id   2JXB 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.392 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2JXB         pdb_00002jxb 10.2210/pdb2jxb/pdb 
RCSB  RCSB100407   ?            ?                   
WWPDB D_1000100407 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2008-09-23 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2022-03-16 
4 'Structure model' 1 3 2024-05-29 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Data collection'           
3 3 'Structure model' 'Database references'       
4 3 'Structure model' 'Derived calculations'      
5 4 'Structure model' 'Data collection'           
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' database_2            
2 3 'Structure model' pdbx_nmr_software     
3 3 'Structure model' pdbx_struct_assembly  
4 3 'Structure model' pdbx_struct_oper_list 
5 3 'Structure model' struct_ref_seq_dif    
6 4 'Structure model' chem_comp_atom        
7 4 'Structure model' chem_comp_bond        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_database_2.pdbx_DOI'                
2 3 'Structure model' '_database_2.pdbx_database_accession' 
3 3 'Structure model' '_pdbx_nmr_software.name'             
4 3 'Structure model' '_struct_ref_seq_dif.details'         
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2JXB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2007-11-09 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Takeuchi, K.'   1 
'Yang, H.'       2 
'Ng, E.'         3 
'Park, S.'       4 
'Sun, Z.J.'      5 
'Reinherz, E.L.' 6 
'Wagner, G.'     7 
# 
_citation.id                        primary 
_citation.title                     
'Structural and functional evidence that Nck interaction with CD3epsilon regulates T-cell receptor activity.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            380 
_citation.page_first                704 
_citation.page_last                 716 
_citation.year                      2008 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18555270 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2008.05.037 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Takeuchi, K.'   1 ? 
primary 'Yang, H.'       2 ? 
primary 'Ng, E.'         3 ? 
primary 'Park, S.Y.'     4 ? 
primary 'Sun, Z.Y.'      5 ? 
primary 'Reinherz, E.L.' 6 ? 
primary 'Wagner, G.'     7 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'T-cell surface glycoprotein CD3 epsilon chain, Cytoplasmic protein NCK2' 
_entity.formula_weight             10267.655 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              
;Fusion protein of T-cell surface glycoprotein CD3 epsilon chain cytoplasmic domain residues 177-188 and Cytoplasmic protein NCK2 first SH3 domain
;
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'T-cell surface antigen T3/Leu-4 epsilon chain, NCK adaptor protein 2, SH2/SH3 adaptor protein NCK-beta, Nck-2' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;HMKERPPPVPNPDYNSLKKGSLVKNLHMTEEVIVIAKWDYTAQQDQELDIKKNERLWLLDDSKTWWRVRNAANRTGYVPS
NYVERK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;HMKERPPPVPNPDYNSLKKGSLVKNLHMTEEVIVIAKWDYTAQQDQELDIKKNERLWLLDDSKTWWRVRNAANRTGYVPS
NYVERK
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  HIS n 
1 2  MET n 
1 3  LYS n 
1 4  GLU n 
1 5  ARG n 
1 6  PRO n 
1 7  PRO n 
1 8  PRO n 
1 9  VAL n 
1 10 PRO n 
1 11 ASN n 
1 12 PRO n 
1 13 ASP n 
1 14 TYR n 
1 15 ASN n 
1 16 SER n 
1 17 LEU n 
1 18 LYS n 
1 19 LYS n 
1 20 GLY n 
1 21 SER n 
1 22 LEU n 
1 23 VAL n 
1 24 LYS n 
1 25 ASN n 
1 26 LEU n 
1 27 HIS n 
1 28 MET n 
1 29 THR n 
1 30 GLU n 
1 31 GLU n 
1 32 VAL n 
1 33 ILE n 
1 34 VAL n 
1 35 ILE n 
1 36 ALA n 
1 37 LYS n 
1 38 TRP n 
1 39 ASP n 
1 40 TYR n 
1 41 THR n 
1 42 ALA n 
1 43 GLN n 
1 44 GLN n 
1 45 ASP n 
1 46 GLN n 
1 47 GLU n 
1 48 LEU n 
1 49 ASP n 
1 50 ILE n 
1 51 LYS n 
1 52 LYS n 
1 53 ASN n 
1 54 GLU n 
1 55 ARG n 
1 56 LEU n 
1 57 TRP n 
1 58 LEU n 
1 59 LEU n 
1 60 ASP n 
1 61 ASP n 
1 62 SER n 
1 63 LYS n 
1 64 THR n 
1 65 TRP n 
1 66 TRP n 
1 67 ARG n 
1 68 VAL n 
1 69 ARG n 
1 70 ASN n 
1 71 ALA n 
1 72 ALA n 
1 73 ASN n 
1 74 ARG n 
1 75 THR n 
1 76 GLY n 
1 77 TYR n 
1 78 VAL n 
1 79 PRO n 
1 80 SER n 
1 81 ASN n 
1 82 TYR n 
1 83 VAL n 
1 84 GLU n 
1 85 ARG n 
1 86 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'CD3E, NCK2' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     ? 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  HIS 1  1  1  HIS HIS A . n 
A 1 2  MET 2  2  2  MET MET A . n 
A 1 3  LYS 3  3  3  LYS LYS A . n 
A 1 4  GLU 4  4  4  GLU GLU A . n 
A 1 5  ARG 5  5  5  ARG ARG A . n 
A 1 6  PRO 6  6  6  PRO PRO A . n 
A 1 7  PRO 7  7  7  PRO PRO A . n 
A 1 8  PRO 8  8  8  PRO PRO A . n 
A 1 9  VAL 9  9  9  VAL VAL A . n 
A 1 10 PRO 10 10 10 PRO PRO A . n 
A 1 11 ASN 11 11 11 ASN ASN A . n 
A 1 12 PRO 12 12 12 PRO PRO A . n 
A 1 13 ASP 13 13 13 ASP ASP A . n 
A 1 14 TYR 14 14 14 TYR TYR A . n 
A 1 15 ASN 15 15 15 ASN ASN A . n 
A 1 16 SER 16 16 16 SER SER A . n 
A 1 17 LEU 17 17 17 LEU LEU A . n 
A 1 18 LYS 18 18 18 LYS LYS A . n 
A 1 19 LYS 19 19 19 LYS LYS A . n 
A 1 20 GLY 20 20 20 GLY GLY A . n 
A 1 21 SER 21 21 21 SER SER A . n 
A 1 22 LEU 22 22 22 LEU LEU A . n 
A 1 23 VAL 23 23 23 VAL VAL A . n 
A 1 24 LYS 24 24 24 LYS LYS A . n 
A 1 25 ASN 25 25 25 ASN ASN A . n 
A 1 26 LEU 26 26 26 LEU LEU A . n 
A 1 27 HIS 27 27 27 HIS HIS A . n 
A 1 28 MET 28 28 28 MET MET A . n 
A 1 29 THR 29 29 29 THR THR A . n 
A 1 30 GLU 30 30 30 GLU GLU A . n 
A 1 31 GLU 31 31 31 GLU GLU A . n 
A 1 32 VAL 32 32 32 VAL VAL A . n 
A 1 33 ILE 33 33 33 ILE ILE A . n 
A 1 34 VAL 34 34 34 VAL VAL A . n 
A 1 35 ILE 35 35 35 ILE ILE A . n 
A 1 36 ALA 36 36 36 ALA ALA A . n 
A 1 37 LYS 37 37 37 LYS LYS A . n 
A 1 38 TRP 38 38 38 TRP TRP A . n 
A 1 39 ASP 39 39 39 ASP ASP A . n 
A 1 40 TYR 40 40 40 TYR TYR A . n 
A 1 41 THR 41 41 41 THR THR A . n 
A 1 42 ALA 42 42 42 ALA ALA A . n 
A 1 43 GLN 43 43 43 GLN GLN A . n 
A 1 44 GLN 44 44 44 GLN GLN A . n 
A 1 45 ASP 45 45 45 ASP ASP A . n 
A 1 46 GLN 46 46 46 GLN GLN A . n 
A 1 47 GLU 47 47 47 GLU GLU A . n 
A 1 48 LEU 48 48 48 LEU LEU A . n 
A 1 49 ASP 49 49 49 ASP ASP A . n 
A 1 50 ILE 50 50 50 ILE ILE A . n 
A 1 51 LYS 51 51 51 LYS LYS A . n 
A 1 52 LYS 52 52 52 LYS LYS A . n 
A 1 53 ASN 53 53 53 ASN ASN A . n 
A 1 54 GLU 54 54 54 GLU GLU A . n 
A 1 55 ARG 55 55 55 ARG ARG A . n 
A 1 56 LEU 56 56 56 LEU LEU A . n 
A 1 57 TRP 57 57 57 TRP TRP A . n 
A 1 58 LEU 58 58 58 LEU LEU A . n 
A 1 59 LEU 59 59 59 LEU LEU A . n 
A 1 60 ASP 60 60 60 ASP ASP A . n 
A 1 61 ASP 61 61 61 ASP ASP A . n 
A 1 62 SER 62 62 62 SER SER A . n 
A 1 63 LYS 63 63 63 LYS LYS A . n 
A 1 64 THR 64 64 64 THR THR A . n 
A 1 65 TRP 65 65 65 TRP TRP A . n 
A 1 66 TRP 66 66 66 TRP TRP A . n 
A 1 67 ARG 67 67 67 ARG ARG A . n 
A 1 68 VAL 68 68 68 VAL VAL A . n 
A 1 69 ARG 69 69 69 ARG ARG A . n 
A 1 70 ASN 70 70 70 ASN ASN A . n 
A 1 71 ALA 71 71 71 ALA ALA A . n 
A 1 72 ALA 72 72 72 ALA ALA A . n 
A 1 73 ASN 73 73 73 ASN ASN A . n 
A 1 74 ARG 74 74 74 ARG ARG A . n 
A 1 75 THR 75 75 75 THR THR A . n 
A 1 76 GLY 76 76 76 GLY GLY A . n 
A 1 77 TYR 77 77 77 TYR TYR A . n 
A 1 78 VAL 78 78 78 VAL VAL A . n 
A 1 79 PRO 79 79 79 PRO PRO A . n 
A 1 80 SER 80 80 80 SER SER A . n 
A 1 81 ASN 81 81 81 ASN ASN A . n 
A 1 82 TYR 82 82 82 TYR TYR A . n 
A 1 83 VAL 83 83 83 VAL VAL A . n 
A 1 84 GLU 84 84 84 GLU GLU A . n 
A 1 85 ARG 85 85 85 ARG ARG A . n 
A 1 86 LYS 86 86 86 LYS LYS A . n 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2JXB 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2JXB 
_struct.title                     'Structure of CD3epsilon-Nck2 first SH3 domain complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2JXB 
_struct_keywords.pdbx_keywords   'Signaling protein complex' 
_struct_keywords.text            
'Nck, CD3epsilon, T-cell receptor, SH3 domain, Immunology, Cytoplasm, SH2 domain, Signaling protein complex' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP NCK2_HUMAN O43639 1 MTEEVIVIAKWDYTAQQDQELDIKKNERLWLLDDSKTWWRVRNAANRTGYVPSNYVERK 1   ? 
2 UNP CD3E_HUMAN P07766 1 KERPPPVPNPDY                                                177 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2JXB A 28 ? 86 ? O43639 1   ? 59  ? 28 86 
2 2 2JXB A 3  ? 14 ? P07766 177 ? 188 ? 3  14 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2JXB HIS A 1  ? UNP O43639 ? ? 'expression tag' 1  1  
1 2JXB MET A 2  ? UNP O43639 ? ? 'expression tag' 2  2  
1 2JXB ASN A 15 ? UNP O43639 ? ? linker           15 3  
1 2JXB SER A 16 ? UNP O43639 ? ? linker           16 4  
1 2JXB LEU A 17 ? UNP O43639 ? ? linker           17 5  
1 2JXB LYS A 18 ? UNP O43639 ? ? linker           18 6  
1 2JXB LYS A 19 ? UNP O43639 ? ? linker           19 7  
1 2JXB GLY A 20 ? UNP O43639 ? ? linker           20 8  
1 2JXB SER A 21 ? UNP O43639 ? ? linker           21 9  
1 2JXB LEU A 22 ? UNP O43639 ? ? linker           22 10 
1 2JXB VAL A 23 ? UNP O43639 ? ? linker           23 11 
1 2JXB LYS A 24 ? UNP O43639 ? ? linker           24 12 
1 2JXB ASN A 25 ? UNP O43639 ? ? linker           25 13 
1 2JXB LEU A 26 ? UNP O43639 ? ? linker           26 14 
1 2JXB HIS A 27 ? UNP O43639 ? ? linker           27 15 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       ASN 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        81 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       VAL 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        83 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        ASN 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         81 
_struct_conf.end_auth_comp_id        VAL 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         83 
_struct_conf.pdbx_PDB_helix_class    5 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   3 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   4 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 32 ? ALA A 36 ? VAL A 32 ALA A 36 
A 2 GLU A 54 ? ASP A 60 ? GLU A 54 ASP A 60 
A 3 TRP A 65 ? ARG A 69 ? TRP A 65 ARG A 69 
A 4 THR A 75 ? PRO A 79 ? THR A 75 PRO A 79 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ALA A 36 ? N ALA A 36 O GLU A 54 ? O GLU A 54 
A 2 3 N LEU A 59 ? N LEU A 59 O ARG A 67 ? O ARG A 67 
A 3 4 N TRP A 66 ? N TRP A 66 O VAL A 78 ? O VAL A 78 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1  PRO A 10 ? ? -69.71  72.27   
2   1  ASN A 11 ? ? 38.49   83.99   
3   1  ASN A 15 ? ? -178.03 143.21  
4   1  SER A 16 ? ? -160.05 -46.53  
5   1  SER A 21 ? ? -112.44 -73.89  
6   1  LEU A 22 ? ? 58.82   97.05   
7   1  ASN A 25 ? ? -177.50 56.84   
8   1  GLU A 30 ? ? -179.17 147.26  
9   1  ALA A 42 ? ? -55.59  100.75  
10  1  GLN A 44 ? ? -127.52 -169.92 
11  1  LEU A 59 ? ? -96.62  -72.43  
12  1  GLU A 84 ? ? -160.01 107.78  
13  2  PRO A 8  ? ? -69.67  -179.85 
14  2  PRO A 10 ? ? -69.76  72.07   
15  2  ASN A 11 ? ? 38.38   83.44   
16  2  ASP A 13 ? ? -159.03 54.42   
17  2  GLU A 31 ? ? -154.15 77.08   
18  2  LEU A 59 ? ? -99.66  -70.70  
19  2  GLU A 84 ? ? -160.38 111.89  
20  3  MET A 2  ? ? 56.34   79.28   
21  3  PRO A 8  ? ? -69.73  -179.41 
22  3  PRO A 10 ? ? -69.87  72.84   
23  3  ASN A 11 ? ? 37.87   83.75   
24  3  SER A 16 ? ? -156.49 -49.14  
25  3  GLU A 30 ? ? -176.92 146.04  
26  3  ALA A 42 ? ? -55.76  100.66  
27  3  LEU A 59 ? ? -98.30  -71.71  
28  3  GLU A 84 ? ? -160.42 112.50  
29  4  GLU A 4  ? ? 62.42   -177.27 
30  4  PRO A 10 ? ? -69.89  72.40   
31  4  ASN A 11 ? ? 38.36   84.39   
32  4  LYS A 18 ? ? 53.55   81.36   
33  4  SER A 21 ? ? 52.62   75.24   
34  4  VAL A 23 ? ? 60.66   93.37   
35  4  ASN A 25 ? ? -162.76 -55.56  
36  4  LEU A 26 ? ? 62.43   164.28  
37  4  GLU A 30 ? ? -179.21 146.82  
38  4  ALA A 42 ? ? -55.69  100.89  
39  4  GLN A 44 ? ? -104.91 -169.64 
40  4  LEU A 59 ? ? -99.88  -71.96  
41  5  MET A 2  ? ? -140.45 -64.94  
42  5  PRO A 10 ? ? -69.72  72.16   
43  5  ASN A 11 ? ? 38.27   83.59   
44  5  LEU A 17 ? ? -58.37  -178.76 
45  5  SER A 21 ? ? 55.17   80.64   
46  5  ASN A 25 ? ? 57.21   73.55   
47  5  HIS A 27 ? ? 60.50   -179.48 
48  5  MET A 28 ? ? 60.79   96.17   
49  5  ALA A 42 ? ? -55.92  100.89  
50  5  LEU A 59 ? ? -100.24 -71.96  
51  5  GLU A 84 ? ? -160.33 110.69  
52  6  MET A 2  ? ? 59.35   89.79   
53  6  GLU A 4  ? ? 62.87   171.80  
54  6  PRO A 8  ? ? -69.85  -179.67 
55  6  PRO A 10 ? ? -69.75  72.71   
56  6  ASN A 11 ? ? 38.67   83.28   
57  6  ASN A 15 ? ? -177.51 -62.31  
58  6  SER A 16 ? ? -179.09 -74.44  
59  6  LEU A 17 ? ? -177.09 33.66   
60  6  SER A 21 ? ? 61.21   72.80   
61  6  VAL A 23 ? ? -176.39 142.23  
62  6  LYS A 24 ? ? 61.75   98.76   
63  6  ASN A 25 ? ? -178.35 98.12   
64  6  GLU A 30 ? ? 65.49   146.02  
65  6  LEU A 59 ? ? -99.12  -72.96  
66  6  GLU A 84 ? ? -160.71 118.54  
67  7  MET A 2  ? ? -172.72 135.02  
68  7  PRO A 8  ? ? -69.80  -178.36 
69  7  PRO A 10 ? ? -69.81  72.72   
70  7  ASN A 11 ? ? 38.00   84.03   
71  7  ASN A 15 ? ? -58.43  172.58  
72  7  MET A 28 ? ? 59.49   96.58   
73  7  ALA A 42 ? ? -55.72  100.46  
74  7  LYS A 52 ? ? -42.91  154.04  
75  7  LEU A 59 ? ? -95.16  -72.31  
76  7  GLU A 84 ? ? -160.50 118.39  
77  8  PRO A 8  ? ? -69.83  -177.17 
78  8  PRO A 10 ? ? -69.72  72.92   
79  8  ASN A 11 ? ? 37.75   84.12   
80  8  ASN A 15 ? ? 62.63   103.75  
81  8  LYS A 19 ? ? 61.04   75.01   
82  8  SER A 21 ? ? 69.25   -75.71  
83  8  LEU A 22 ? ? 56.68   91.64   
84  8  MET A 28 ? ? -147.96 59.30   
85  8  GLU A 30 ? ? 65.45   145.76  
86  8  GLU A 31 ? ? -153.60 83.87   
87  8  LEU A 59 ? ? -101.72 -71.29  
88  8  GLU A 84 ? ? -160.26 106.73  
89  9  PRO A 8  ? ? -69.72  -178.75 
90  9  PRO A 10 ? ? -69.80  74.92   
91  9  ASN A 11 ? ? 38.56   81.73   
92  9  SER A 16 ? ? -155.59 41.48   
93  9  LEU A 17 ? ? -175.37 139.68  
94  9  LEU A 22 ? ? -177.25 -179.74 
95  9  LEU A 26 ? ? 62.09   172.87  
96  9  HIS A 27 ? ? -159.30 39.35   
97  9  ALA A 42 ? ? -55.55  100.13  
98  9  LEU A 59 ? ? -102.23 -68.05  
99  9  ASP A 61 ? ? -119.84 76.43   
100 10 GLU A 4  ? ? -170.57 -171.44 
101 10 PRO A 8  ? ? -69.62  -179.70 
102 10 PRO A 10 ? ? -69.80  73.07   
103 10 ASN A 11 ? ? 37.77   83.98   
104 10 SER A 16 ? ? -163.73 -50.33  
105 10 THR A 29 ? ? -150.16 30.88   
106 10 GLU A 30 ? ? -178.45 146.48  
107 10 ALA A 42 ? ? -55.61  100.52  
108 10 LYS A 52 ? ? -43.75  155.79  
109 10 LEU A 59 ? ? -98.19  -71.44  
110 11 PRO A 8  ? ? -69.73  -178.83 
111 11 PRO A 10 ? ? -69.76  72.71   
112 11 ASN A 11 ? ? 38.04   82.48   
113 11 ASN A 15 ? ? 63.16   105.17  
114 11 LEU A 17 ? ? -172.02 86.55   
115 11 LYS A 19 ? ? -168.19 66.64   
116 11 LEU A 26 ? ? 52.00   81.36   
117 11 LEU A 59 ? ? -99.80  -72.46  
118 12 MET A 2  ? ? -150.90 41.38   
119 12 GLU A 4  ? ? 62.45   -176.24 
120 12 PRO A 10 ? ? -69.74  72.96   
121 12 ASN A 11 ? ? 37.50   84.25   
122 12 LYS A 18 ? ? 62.69   176.93  
123 12 LYS A 19 ? ? -136.58 -55.90  
124 12 LEU A 22 ? ? 59.92   -176.85 
125 12 ASN A 25 ? ? -63.17  -178.96 
126 12 THR A 29 ? ? 56.24   -172.41 
127 12 ALA A 42 ? ? -55.84  100.70  
128 12 LEU A 59 ? ? -101.60 -68.88  
129 12 GLU A 84 ? ? -160.59 113.52  
130 13 GLU A 4  ? ? 54.14   -173.58 
131 13 PRO A 8  ? ? -69.73  -176.22 
132 13 PRO A 10 ? ? -69.88  72.55   
133 13 ASN A 11 ? ? 38.20   83.84   
134 13 LEU A 17 ? ? 56.10   -175.05 
135 13 LYS A 18 ? ? 54.61   -170.04 
136 13 SER A 21 ? ? -141.46 -73.94  
137 13 VAL A 23 ? ? -175.76 141.96  
138 13 LYS A 24 ? ? -147.25 -57.21  
139 13 ASN A 25 ? ? 61.71   167.05  
140 13 MET A 28 ? ? -121.62 -75.18  
141 13 THR A 29 ? ? 59.97   176.38  
142 13 GLU A 30 ? ? 65.54   145.50  
143 13 ALA A 42 ? ? -55.59  100.71  
144 13 LEU A 59 ? ? -98.14  -72.04  
145 13 GLU A 84 ? ? -160.30 115.85  
146 14 GLU A 4  ? ? 62.80   -177.23 
147 14 PRO A 10 ? ? -69.77  72.99   
148 14 ASN A 11 ? ? 37.80   83.92   
149 14 SER A 16 ? ? -179.89 -33.98  
150 14 LEU A 17 ? ? -146.97 28.80   
151 14 LYS A 18 ? ? -105.25 -72.21  
152 14 LYS A 19 ? ? 52.19   81.95   
153 14 LEU A 59 ? ? -94.68  -72.89  
154 15 GLU A 4  ? ? 63.19   -178.70 
155 15 PRO A 10 ? ? -69.73  73.06   
156 15 ASN A 11 ? ? 37.84   83.73   
157 15 LEU A 17 ? ? -141.02 32.04   
158 15 SER A 21 ? ? -169.06 -73.96  
159 15 LEU A 22 ? ? 62.59   167.87  
160 15 LYS A 24 ? ? -178.65 -67.91  
161 15 ASN A 25 ? ? -179.23 -172.48 
162 15 ALA A 42 ? ? -55.97  100.95  
163 15 LEU A 59 ? ? -98.30  -71.86  
164 15 GLU A 84 ? ? -160.53 112.04  
165 16 ARG A 5  ? ? 62.04   159.61  
166 16 PRO A 10 ? ? -69.72  72.07   
167 16 ASN A 11 ? ? 38.29   83.60   
168 16 LEU A 22 ? ? -56.97  177.57  
169 16 HIS A 27 ? ? 59.54   -174.47 
170 16 ALA A 42 ? ? -55.73  100.66  
171 16 LEU A 59 ? ? -102.15 -70.51  
172 17 MET A 2  ? ? 63.19   -179.32 
173 17 PRO A 10 ? ? -69.75  73.13   
174 17 ASN A 11 ? ? 37.46   84.16   
175 17 LEU A 17 ? ? 70.38   -72.28  
176 17 VAL A 23 ? ? -172.99 146.56  
177 17 LYS A 24 ? ? -170.06 -54.93  
178 17 ASN A 25 ? ? 69.20   -75.80  
179 17 LEU A 26 ? ? 59.22   85.04   
180 17 HIS A 27 ? ? -147.60 -48.85  
181 17 GLU A 30 ? ? -179.22 146.95  
182 17 LYS A 52 ? ? -42.35  153.08  
183 17 LEU A 59 ? ? -96.49  -71.67  
184 17 GLU A 84 ? ? -160.77 117.36  
185 18 PRO A 8  ? ? -69.65  -173.09 
186 18 PRO A 10 ? ? -69.75  73.44   
187 18 ASN A 11 ? ? 38.34   82.95   
188 18 SER A 21 ? ? -132.42 -70.46  
189 18 LEU A 26 ? ? -69.73  -173.49 
190 18 HIS A 27 ? ? -100.93 -71.61  
191 18 MET A 28 ? ? -165.39 108.00  
192 18 THR A 29 ? ? -158.74 37.73   
193 18 GLU A 30 ? ? -177.42 146.50  
194 18 ALA A 42 ? ? -55.66  104.89  
195 18 LEU A 59 ? ? -96.46  -73.11  
196 18 GLU A 84 ? ? -160.29 113.06  
197 19 PRO A 10 ? ? -69.85  72.96   
198 19 ASN A 11 ? ? 38.09   83.32   
199 19 SER A 16 ? ? -163.75 34.90   
200 19 LEU A 17 ? ? 56.33   90.26   
201 19 SER A 21 ? ? -157.43 -57.00  
202 19 LEU A 22 ? ? -58.12  109.21  
203 19 LYS A 24 ? ? 62.24   166.83  
204 19 ASN A 25 ? ? 62.93   175.03  
205 19 HIS A 27 ? ? -142.72 -66.23  
206 19 MET A 28 ? ? 63.21   162.00  
207 19 THR A 29 ? ? 178.52  -32.63  
208 19 ALA A 42 ? ? -55.48  108.39  
209 19 LEU A 59 ? ? -95.52  -71.88  
210 19 GLU A 84 ? ? -160.18 115.07  
211 20 MET A 2  ? ? 61.88   178.90  
212 20 GLU A 4  ? ? 61.94   101.88  
213 20 ARG A 5  ? ? 65.99   136.32  
214 20 PRO A 10 ? ? -69.75  72.36   
215 20 ASN A 11 ? ? 38.35   84.14   
216 20 SER A 16 ? ? 62.50   179.87  
217 20 LEU A 22 ? ? 62.53   173.19  
218 20 LYS A 24 ? ? -145.46 -52.68  
219 20 ASN A 25 ? ? 54.39   89.48   
220 20 HIS A 27 ? ? -149.58 35.80   
221 20 THR A 29 ? ? -151.63 30.10   
222 20 GLN A 44 ? ? -102.90 -169.75 
223 20 ASN A 53 ? ? 63.75   67.84   
224 20 LEU A 59 ? ? -99.98  -70.03  
225 20 ASP A 61 ? ? -119.75 72.52   
226 20 GLU A 84 ? ? -161.49 119.41  
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2JXB 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2JXB 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
_pdbx_nmr_sample_details.contents         '2 mM [U-13C; U-15N] entity, 90% H2O/10% D2O' 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_exptl_sample.component             entity 
_pdbx_nmr_exptl_sample.concentration         2 
_pdbx_nmr_exptl_sample.concentration_units   mM 
_pdbx_nmr_exptl_sample.isotopic_labeling     '[U-13C; U-15N]' 
_pdbx_nmr_exptl_sample.solution_id           1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      100 
_pdbx_nmr_exptl_sample_conditions.pH                  6.8 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1 1 '3D HNCA'         
1 2 1 '3D HNCACB'       
1 3 1 '3D HN(CO)CA'     
1 4 1 '3D H(CCO)NH'     
1 5 1 '3D HCCH-TOCSY'   
1 6 1 '3D 1H-15N NOESY' 
1 7 1 '3D 1H-13C NOESY' 
# 
_pdbx_nmr_refine.entry_id           2JXB 
_pdbx_nmr_refine.method             'DGSA-distance geometry simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Guntert, Mumenthaler and Wuthrich' refinement      CYANA   ? 1 
'Bruker Biospin'                    collection      XwinNMR ? 2 
'Keller and Wuthrich'               'data analysis' CARA    ? 3 
'Keller and Wuthrich'               'peak picking'  CARA    ? 4 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASN N    N N N 41  
ASN CA   C N S 42  
ASN C    C N N 43  
ASN O    O N N 44  
ASN CB   C N N 45  
ASN CG   C N N 46  
ASN OD1  O N N 47  
ASN ND2  N N N 48  
ASN OXT  O N N 49  
ASN H    H N N 50  
ASN H2   H N N 51  
ASN HA   H N N 52  
ASN HB2  H N N 53  
ASN HB3  H N N 54  
ASN HD21 H N N 55  
ASN HD22 H N N 56  
ASN HXT  H N N 57  
ASP N    N N N 58  
ASP CA   C N S 59  
ASP C    C N N 60  
ASP O    O N N 61  
ASP CB   C N N 62  
ASP CG   C N N 63  
ASP OD1  O N N 64  
ASP OD2  O N N 65  
ASP OXT  O N N 66  
ASP H    H N N 67  
ASP H2   H N N 68  
ASP HA   H N N 69  
ASP HB2  H N N 70  
ASP HB3  H N N 71  
ASP HD2  H N N 72  
ASP HXT  H N N 73  
GLN N    N N N 74  
GLN CA   C N S 75  
GLN C    C N N 76  
GLN O    O N N 77  
GLN CB   C N N 78  
GLN CG   C N N 79  
GLN CD   C N N 80  
GLN OE1  O N N 81  
GLN NE2  N N N 82  
GLN OXT  O N N 83  
GLN H    H N N 84  
GLN H2   H N N 85  
GLN HA   H N N 86  
GLN HB2  H N N 87  
GLN HB3  H N N 88  
GLN HG2  H N N 89  
GLN HG3  H N N 90  
GLN HE21 H N N 91  
GLN HE22 H N N 92  
GLN HXT  H N N 93  
GLU N    N N N 94  
GLU CA   C N S 95  
GLU C    C N N 96  
GLU O    O N N 97  
GLU CB   C N N 98  
GLU CG   C N N 99  
GLU CD   C N N 100 
GLU OE1  O N N 101 
GLU OE2  O N N 102 
GLU OXT  O N N 103 
GLU H    H N N 104 
GLU H2   H N N 105 
GLU HA   H N N 106 
GLU HB2  H N N 107 
GLU HB3  H N N 108 
GLU HG2  H N N 109 
GLU HG3  H N N 110 
GLU HE2  H N N 111 
GLU HXT  H N N 112 
GLY N    N N N 113 
GLY CA   C N N 114 
GLY C    C N N 115 
GLY O    O N N 116 
GLY OXT  O N N 117 
GLY H    H N N 118 
GLY H2   H N N 119 
GLY HA2  H N N 120 
GLY HA3  H N N 121 
GLY HXT  H N N 122 
HIS N    N N N 123 
HIS CA   C N S 124 
HIS C    C N N 125 
HIS O    O N N 126 
HIS CB   C N N 127 
HIS CG   C Y N 128 
HIS ND1  N Y N 129 
HIS CD2  C Y N 130 
HIS CE1  C Y N 131 
HIS NE2  N Y N 132 
HIS OXT  O N N 133 
HIS H    H N N 134 
HIS H2   H N N 135 
HIS HA   H N N 136 
HIS HB2  H N N 137 
HIS HB3  H N N 138 
HIS HD1  H N N 139 
HIS HD2  H N N 140 
HIS HE1  H N N 141 
HIS HE2  H N N 142 
HIS HXT  H N N 143 
ILE N    N N N 144 
ILE CA   C N S 145 
ILE C    C N N 146 
ILE O    O N N 147 
ILE CB   C N S 148 
ILE CG1  C N N 149 
ILE CG2  C N N 150 
ILE CD1  C N N 151 
ILE OXT  O N N 152 
ILE H    H N N 153 
ILE H2   H N N 154 
ILE HA   H N N 155 
ILE HB   H N N 156 
ILE HG12 H N N 157 
ILE HG13 H N N 158 
ILE HG21 H N N 159 
ILE HG22 H N N 160 
ILE HG23 H N N 161 
ILE HD11 H N N 162 
ILE HD12 H N N 163 
ILE HD13 H N N 164 
ILE HXT  H N N 165 
LEU N    N N N 166 
LEU CA   C N S 167 
LEU C    C N N 168 
LEU O    O N N 169 
LEU CB   C N N 170 
LEU CG   C N N 171 
LEU CD1  C N N 172 
LEU CD2  C N N 173 
LEU OXT  O N N 174 
LEU H    H N N 175 
LEU H2   H N N 176 
LEU HA   H N N 177 
LEU HB2  H N N 178 
LEU HB3  H N N 179 
LEU HG   H N N 180 
LEU HD11 H N N 181 
LEU HD12 H N N 182 
LEU HD13 H N N 183 
LEU HD21 H N N 184 
LEU HD22 H N N 185 
LEU HD23 H N N 186 
LEU HXT  H N N 187 
LYS N    N N N 188 
LYS CA   C N S 189 
LYS C    C N N 190 
LYS O    O N N 191 
LYS CB   C N N 192 
LYS CG   C N N 193 
LYS CD   C N N 194 
LYS CE   C N N 195 
LYS NZ   N N N 196 
LYS OXT  O N N 197 
LYS H    H N N 198 
LYS H2   H N N 199 
LYS HA   H N N 200 
LYS HB2  H N N 201 
LYS HB3  H N N 202 
LYS HG2  H N N 203 
LYS HG3  H N N 204 
LYS HD2  H N N 205 
LYS HD3  H N N 206 
LYS HE2  H N N 207 
LYS HE3  H N N 208 
LYS HZ1  H N N 209 
LYS HZ2  H N N 210 
LYS HZ3  H N N 211 
LYS HXT  H N N 212 
MET N    N N N 213 
MET CA   C N S 214 
MET C    C N N 215 
MET O    O N N 216 
MET CB   C N N 217 
MET CG   C N N 218 
MET SD   S N N 219 
MET CE   C N N 220 
MET OXT  O N N 221 
MET H    H N N 222 
MET H2   H N N 223 
MET HA   H N N 224 
MET HB2  H N N 225 
MET HB3  H N N 226 
MET HG2  H N N 227 
MET HG3  H N N 228 
MET HE1  H N N 229 
MET HE2  H N N 230 
MET HE3  H N N 231 
MET HXT  H N N 232 
PRO N    N N N 233 
PRO CA   C N S 234 
PRO C    C N N 235 
PRO O    O N N 236 
PRO CB   C N N 237 
PRO CG   C N N 238 
PRO CD   C N N 239 
PRO OXT  O N N 240 
PRO H    H N N 241 
PRO HA   H N N 242 
PRO HB2  H N N 243 
PRO HB3  H N N 244 
PRO HG2  H N N 245 
PRO HG3  H N N 246 
PRO HD2  H N N 247 
PRO HD3  H N N 248 
PRO HXT  H N N 249 
SER N    N N N 250 
SER CA   C N S 251 
SER C    C N N 252 
SER O    O N N 253 
SER CB   C N N 254 
SER OG   O N N 255 
SER OXT  O N N 256 
SER H    H N N 257 
SER H2   H N N 258 
SER HA   H N N 259 
SER HB2  H N N 260 
SER HB3  H N N 261 
SER HG   H N N 262 
SER HXT  H N N 263 
THR N    N N N 264 
THR CA   C N S 265 
THR C    C N N 266 
THR O    O N N 267 
THR CB   C N R 268 
THR OG1  O N N 269 
THR CG2  C N N 270 
THR OXT  O N N 271 
THR H    H N N 272 
THR H2   H N N 273 
THR HA   H N N 274 
THR HB   H N N 275 
THR HG1  H N N 276 
THR HG21 H N N 277 
THR HG22 H N N 278 
THR HG23 H N N 279 
THR HXT  H N N 280 
TRP N    N N N 281 
TRP CA   C N S 282 
TRP C    C N N 283 
TRP O    O N N 284 
TRP CB   C N N 285 
TRP CG   C Y N 286 
TRP CD1  C Y N 287 
TRP CD2  C Y N 288 
TRP NE1  N Y N 289 
TRP CE2  C Y N 290 
TRP CE3  C Y N 291 
TRP CZ2  C Y N 292 
TRP CZ3  C Y N 293 
TRP CH2  C Y N 294 
TRP OXT  O N N 295 
TRP H    H N N 296 
TRP H2   H N N 297 
TRP HA   H N N 298 
TRP HB2  H N N 299 
TRP HB3  H N N 300 
TRP HD1  H N N 301 
TRP HE1  H N N 302 
TRP HE3  H N N 303 
TRP HZ2  H N N 304 
TRP HZ3  H N N 305 
TRP HH2  H N N 306 
TRP HXT  H N N 307 
TYR N    N N N 308 
TYR CA   C N S 309 
TYR C    C N N 310 
TYR O    O N N 311 
TYR CB   C N N 312 
TYR CG   C Y N 313 
TYR CD1  C Y N 314 
TYR CD2  C Y N 315 
TYR CE1  C Y N 316 
TYR CE2  C Y N 317 
TYR CZ   C Y N 318 
TYR OH   O N N 319 
TYR OXT  O N N 320 
TYR H    H N N 321 
TYR H2   H N N 322 
TYR HA   H N N 323 
TYR HB2  H N N 324 
TYR HB3  H N N 325 
TYR HD1  H N N 326 
TYR HD2  H N N 327 
TYR HE1  H N N 328 
TYR HE2  H N N 329 
TYR HH   H N N 330 
TYR HXT  H N N 331 
VAL N    N N N 332 
VAL CA   C N S 333 
VAL C    C N N 334 
VAL O    O N N 335 
VAL CB   C N N 336 
VAL CG1  C N N 337 
VAL CG2  C N N 338 
VAL OXT  O N N 339 
VAL H    H N N 340 
VAL H2   H N N 341 
VAL HA   H N N 342 
VAL HB   H N N 343 
VAL HG11 H N N 344 
VAL HG12 H N N 345 
VAL HG13 H N N 346 
VAL HG21 H N N 347 
VAL HG22 H N N 348 
VAL HG23 H N N 349 
VAL HXT  H N N 350 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
GLN N   CA   sing N N 70  
GLN N   H    sing N N 71  
GLN N   H2   sing N N 72  
GLN CA  C    sing N N 73  
GLN CA  CB   sing N N 74  
GLN CA  HA   sing N N 75  
GLN C   O    doub N N 76  
GLN C   OXT  sing N N 77  
GLN CB  CG   sing N N 78  
GLN CB  HB2  sing N N 79  
GLN CB  HB3  sing N N 80  
GLN CG  CD   sing N N 81  
GLN CG  HG2  sing N N 82  
GLN CG  HG3  sing N N 83  
GLN CD  OE1  doub N N 84  
GLN CD  NE2  sing N N 85  
GLN NE2 HE21 sing N N 86  
GLN NE2 HE22 sing N N 87  
GLN OXT HXT  sing N N 88  
GLU N   CA   sing N N 89  
GLU N   H    sing N N 90  
GLU N   H2   sing N N 91  
GLU CA  C    sing N N 92  
GLU CA  CB   sing N N 93  
GLU CA  HA   sing N N 94  
GLU C   O    doub N N 95  
GLU C   OXT  sing N N 96  
GLU CB  CG   sing N N 97  
GLU CB  HB2  sing N N 98  
GLU CB  HB3  sing N N 99  
GLU CG  CD   sing N N 100 
GLU CG  HG2  sing N N 101 
GLU CG  HG3  sing N N 102 
GLU CD  OE1  doub N N 103 
GLU CD  OE2  sing N N 104 
GLU OE2 HE2  sing N N 105 
GLU OXT HXT  sing N N 106 
GLY N   CA   sing N N 107 
GLY N   H    sing N N 108 
GLY N   H2   sing N N 109 
GLY CA  C    sing N N 110 
GLY CA  HA2  sing N N 111 
GLY CA  HA3  sing N N 112 
GLY C   O    doub N N 113 
GLY C   OXT  sing N N 114 
GLY OXT HXT  sing N N 115 
HIS N   CA   sing N N 116 
HIS N   H    sing N N 117 
HIS N   H2   sing N N 118 
HIS CA  C    sing N N 119 
HIS CA  CB   sing N N 120 
HIS CA  HA   sing N N 121 
HIS C   O    doub N N 122 
HIS C   OXT  sing N N 123 
HIS CB  CG   sing N N 124 
HIS CB  HB2  sing N N 125 
HIS CB  HB3  sing N N 126 
HIS CG  ND1  sing Y N 127 
HIS CG  CD2  doub Y N 128 
HIS ND1 CE1  doub Y N 129 
HIS ND1 HD1  sing N N 130 
HIS CD2 NE2  sing Y N 131 
HIS CD2 HD2  sing N N 132 
HIS CE1 NE2  sing Y N 133 
HIS CE1 HE1  sing N N 134 
HIS NE2 HE2  sing N N 135 
HIS OXT HXT  sing N N 136 
ILE N   CA   sing N N 137 
ILE N   H    sing N N 138 
ILE N   H2   sing N N 139 
ILE CA  C    sing N N 140 
ILE CA  CB   sing N N 141 
ILE CA  HA   sing N N 142 
ILE C   O    doub N N 143 
ILE C   OXT  sing N N 144 
ILE CB  CG1  sing N N 145 
ILE CB  CG2  sing N N 146 
ILE CB  HB   sing N N 147 
ILE CG1 CD1  sing N N 148 
ILE CG1 HG12 sing N N 149 
ILE CG1 HG13 sing N N 150 
ILE CG2 HG21 sing N N 151 
ILE CG2 HG22 sing N N 152 
ILE CG2 HG23 sing N N 153 
ILE CD1 HD11 sing N N 154 
ILE CD1 HD12 sing N N 155 
ILE CD1 HD13 sing N N 156 
ILE OXT HXT  sing N N 157 
LEU N   CA   sing N N 158 
LEU N   H    sing N N 159 
LEU N   H2   sing N N 160 
LEU CA  C    sing N N 161 
LEU CA  CB   sing N N 162 
LEU CA  HA   sing N N 163 
LEU C   O    doub N N 164 
LEU C   OXT  sing N N 165 
LEU CB  CG   sing N N 166 
LEU CB  HB2  sing N N 167 
LEU CB  HB3  sing N N 168 
LEU CG  CD1  sing N N 169 
LEU CG  CD2  sing N N 170 
LEU CG  HG   sing N N 171 
LEU CD1 HD11 sing N N 172 
LEU CD1 HD12 sing N N 173 
LEU CD1 HD13 sing N N 174 
LEU CD2 HD21 sing N N 175 
LEU CD2 HD22 sing N N 176 
LEU CD2 HD23 sing N N 177 
LEU OXT HXT  sing N N 178 
LYS N   CA   sing N N 179 
LYS N   H    sing N N 180 
LYS N   H2   sing N N 181 
LYS CA  C    sing N N 182 
LYS CA  CB   sing N N 183 
LYS CA  HA   sing N N 184 
LYS C   O    doub N N 185 
LYS C   OXT  sing N N 186 
LYS CB  CG   sing N N 187 
LYS CB  HB2  sing N N 188 
LYS CB  HB3  sing N N 189 
LYS CG  CD   sing N N 190 
LYS CG  HG2  sing N N 191 
LYS CG  HG3  sing N N 192 
LYS CD  CE   sing N N 193 
LYS CD  HD2  sing N N 194 
LYS CD  HD3  sing N N 195 
LYS CE  NZ   sing N N 196 
LYS CE  HE2  sing N N 197 
LYS CE  HE3  sing N N 198 
LYS NZ  HZ1  sing N N 199 
LYS NZ  HZ2  sing N N 200 
LYS NZ  HZ3  sing N N 201 
LYS OXT HXT  sing N N 202 
MET N   CA   sing N N 203 
MET N   H    sing N N 204 
MET N   H2   sing N N 205 
MET CA  C    sing N N 206 
MET CA  CB   sing N N 207 
MET CA  HA   sing N N 208 
MET C   O    doub N N 209 
MET C   OXT  sing N N 210 
MET CB  CG   sing N N 211 
MET CB  HB2  sing N N 212 
MET CB  HB3  sing N N 213 
MET CG  SD   sing N N 214 
MET CG  HG2  sing N N 215 
MET CG  HG3  sing N N 216 
MET SD  CE   sing N N 217 
MET CE  HE1  sing N N 218 
MET CE  HE2  sing N N 219 
MET CE  HE3  sing N N 220 
MET OXT HXT  sing N N 221 
PRO N   CA   sing N N 222 
PRO N   CD   sing N N 223 
PRO N   H    sing N N 224 
PRO CA  C    sing N N 225 
PRO CA  CB   sing N N 226 
PRO CA  HA   sing N N 227 
PRO C   O    doub N N 228 
PRO C   OXT  sing N N 229 
PRO CB  CG   sing N N 230 
PRO CB  HB2  sing N N 231 
PRO CB  HB3  sing N N 232 
PRO CG  CD   sing N N 233 
PRO CG  HG2  sing N N 234 
PRO CG  HG3  sing N N 235 
PRO CD  HD2  sing N N 236 
PRO CD  HD3  sing N N 237 
PRO OXT HXT  sing N N 238 
SER N   CA   sing N N 239 
SER N   H    sing N N 240 
SER N   H2   sing N N 241 
SER CA  C    sing N N 242 
SER CA  CB   sing N N 243 
SER CA  HA   sing N N 244 
SER C   O    doub N N 245 
SER C   OXT  sing N N 246 
SER CB  OG   sing N N 247 
SER CB  HB2  sing N N 248 
SER CB  HB3  sing N N 249 
SER OG  HG   sing N N 250 
SER OXT HXT  sing N N 251 
THR N   CA   sing N N 252 
THR N   H    sing N N 253 
THR N   H2   sing N N 254 
THR CA  C    sing N N 255 
THR CA  CB   sing N N 256 
THR CA  HA   sing N N 257 
THR C   O    doub N N 258 
THR C   OXT  sing N N 259 
THR CB  OG1  sing N N 260 
THR CB  CG2  sing N N 261 
THR CB  HB   sing N N 262 
THR OG1 HG1  sing N N 263 
THR CG2 HG21 sing N N 264 
THR CG2 HG22 sing N N 265 
THR CG2 HG23 sing N N 266 
THR OXT HXT  sing N N 267 
TRP N   CA   sing N N 268 
TRP N   H    sing N N 269 
TRP N   H2   sing N N 270 
TRP CA  C    sing N N 271 
TRP CA  CB   sing N N 272 
TRP CA  HA   sing N N 273 
TRP C   O    doub N N 274 
TRP C   OXT  sing N N 275 
TRP CB  CG   sing N N 276 
TRP CB  HB2  sing N N 277 
TRP CB  HB3  sing N N 278 
TRP CG  CD1  doub Y N 279 
TRP CG  CD2  sing Y N 280 
TRP CD1 NE1  sing Y N 281 
TRP CD1 HD1  sing N N 282 
TRP CD2 CE2  doub Y N 283 
TRP CD2 CE3  sing Y N 284 
TRP NE1 CE2  sing Y N 285 
TRP NE1 HE1  sing N N 286 
TRP CE2 CZ2  sing Y N 287 
TRP CE3 CZ3  doub Y N 288 
TRP CE3 HE3  sing N N 289 
TRP CZ2 CH2  doub Y N 290 
TRP CZ2 HZ2  sing N N 291 
TRP CZ3 CH2  sing Y N 292 
TRP CZ3 HZ3  sing N N 293 
TRP CH2 HH2  sing N N 294 
TRP OXT HXT  sing N N 295 
TYR N   CA   sing N N 296 
TYR N   H    sing N N 297 
TYR N   H2   sing N N 298 
TYR CA  C    sing N N 299 
TYR CA  CB   sing N N 300 
TYR CA  HA   sing N N 301 
TYR C   O    doub N N 302 
TYR C   OXT  sing N N 303 
TYR CB  CG   sing N N 304 
TYR CB  HB2  sing N N 305 
TYR CB  HB3  sing N N 306 
TYR CG  CD1  doub Y N 307 
TYR CG  CD2  sing Y N 308 
TYR CD1 CE1  sing Y N 309 
TYR CD1 HD1  sing N N 310 
TYR CD2 CE2  doub Y N 311 
TYR CD2 HD2  sing N N 312 
TYR CE1 CZ   doub Y N 313 
TYR CE1 HE1  sing N N 314 
TYR CE2 CZ   sing Y N 315 
TYR CE2 HE2  sing N N 316 
TYR CZ  OH   sing N N 317 
TYR OH  HH   sing N N 318 
TYR OXT HXT  sing N N 319 
VAL N   CA   sing N N 320 
VAL N   H    sing N N 321 
VAL N   H2   sing N N 322 
VAL CA  C    sing N N 323 
VAL CA  CB   sing N N 324 
VAL CA  HA   sing N N 325 
VAL C   O    doub N N 326 
VAL C   OXT  sing N N 327 
VAL CB  CG1  sing N N 328 
VAL CB  CG2  sing N N 329 
VAL CB  HB   sing N N 330 
VAL CG1 HG11 sing N N 331 
VAL CG1 HG12 sing N N 332 
VAL CG1 HG13 sing N N 333 
VAL CG2 HG21 sing N N 334 
VAL CG2 HG22 sing N N 335 
VAL CG2 HG23 sing N N 336 
VAL OXT HXT  sing N N 337 
# 
_pdbx_nmr_spectrometer.field_strength    500 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.model             DRX 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              'Bruker DRX' 
# 
_atom_sites.entry_id                    2JXB 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_