data_2JXY # _entry.id 2JXY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2JXY pdb_00002jxy 10.2210/pdb2jxy/pdb RCSB RCSB100429 ? ? WWPDB D_1000100429 ? ? # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2JXY _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2007-12-01 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bertini, I.' 1 'Calderone, V.' 2 'Fragai, M.' 3 'Jaiswal, R.' 4 'Luchinat, C.' 5 'Melikian, M.' 6 # _citation.id primary _citation.title 'Evidence of reciprocal reorientation of the catalytic and hemopexin-like domains of full-length MMP-12' _citation.journal_abbrev J.Am.Chem.Soc. _citation.journal_volume 130 _citation.page_first 7011 _citation.page_last 7021 _citation.year 2008 _citation.journal_id_ASTM JACSAT _citation.country US _citation.journal_id_ISSN 0002-7863 _citation.journal_id_CSD 0004 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18465858 _citation.pdbx_database_id_DOI 10.1021/ja710491y # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bertini, I.' 1 ? primary 'Calderone, V.' 2 ? primary 'Fragai, M.' 3 ? primary 'Jaiswal, R.' 4 ? primary 'Luchinat, C.' 5 ? primary 'Melikian, M.' 6 ? primary 'Mylonas, E.' 7 ? primary 'Svergun, D.I.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Macrophage metalloelastase' 23200.453 1 3.4.24.65 ? 'Hemopexin-like domain' ? 2 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'HME, Matrix metalloproteinase-12, MMP-12, Macrophage elastase, ME' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MEPALCDPNLSFDAVTTVGNKIFFFKDRFFWLKVSERPKTSVNLISSLWPTLPSGIEAAYEIEARNQVFLFKDDKYWLIS NLRPEPNYPKSIHSFGFPNFVKKIDAAVFNPRFYRTYFFVDNQYWRYDERRQMMDPGYPKLITKNFQGIGPKIDAVFYSK NKYYYFFQGSNQFEYDFLLQRITKTLKSNSWFGC ; _entity_poly.pdbx_seq_one_letter_code_can ;MEPALCDPNLSFDAVTTVGNKIFFFKDRFFWLKVSERPKTSVNLISSLWPTLPSGIEAAYEIEARNQVFLFKDDKYWLIS NLRPEPNYPKSIHSFGFPNFVKKIDAAVFNPRFYRTYFFVDNQYWRYDERRQMMDPGYPKLITKNFQGIGPKIDAVFYSK NKYYYFFQGSNQFEYDFLLQRITKTLKSNSWFGC ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 PRO n 1 4 ALA n 1 5 LEU n 1 6 CYS n 1 7 ASP n 1 8 PRO n 1 9 ASN n 1 10 LEU n 1 11 SER n 1 12 PHE n 1 13 ASP n 1 14 ALA n 1 15 VAL n 1 16 THR n 1 17 THR n 1 18 VAL n 1 19 GLY n 1 20 ASN n 1 21 LYS n 1 22 ILE n 1 23 PHE n 1 24 PHE n 1 25 PHE n 1 26 LYS n 1 27 ASP n 1 28 ARG n 1 29 PHE n 1 30 PHE n 1 31 TRP n 1 32 LEU n 1 33 LYS n 1 34 VAL n 1 35 SER n 1 36 GLU n 1 37 ARG n 1 38 PRO n 1 39 LYS n 1 40 THR n 1 41 SER n 1 42 VAL n 1 43 ASN n 1 44 LEU n 1 45 ILE n 1 46 SER n 1 47 SER n 1 48 LEU n 1 49 TRP n 1 50 PRO n 1 51 THR n 1 52 LEU n 1 53 PRO n 1 54 SER n 1 55 GLY n 1 56 ILE n 1 57 GLU n 1 58 ALA n 1 59 ALA n 1 60 TYR n 1 61 GLU n 1 62 ILE n 1 63 GLU n 1 64 ALA n 1 65 ARG n 1 66 ASN n 1 67 GLN n 1 68 VAL n 1 69 PHE n 1 70 LEU n 1 71 PHE n 1 72 LYS n 1 73 ASP n 1 74 ASP n 1 75 LYS n 1 76 TYR n 1 77 TRP n 1 78 LEU n 1 79 ILE n 1 80 SER n 1 81 ASN n 1 82 LEU n 1 83 ARG n 1 84 PRO n 1 85 GLU n 1 86 PRO n 1 87 ASN n 1 88 TYR n 1 89 PRO n 1 90 LYS n 1 91 SER n 1 92 ILE n 1 93 HIS n 1 94 SER n 1 95 PHE n 1 96 GLY n 1 97 PHE n 1 98 PRO n 1 99 ASN n 1 100 PHE n 1 101 VAL n 1 102 LYS n 1 103 LYS n 1 104 ILE n 1 105 ASP n 1 106 ALA n 1 107 ALA n 1 108 VAL n 1 109 PHE n 1 110 ASN n 1 111 PRO n 1 112 ARG n 1 113 PHE n 1 114 TYR n 1 115 ARG n 1 116 THR n 1 117 TYR n 1 118 PHE n 1 119 PHE n 1 120 VAL n 1 121 ASP n 1 122 ASN n 1 123 GLN n 1 124 TYR n 1 125 TRP n 1 126 ARG n 1 127 TYR n 1 128 ASP n 1 129 GLU n 1 130 ARG n 1 131 ARG n 1 132 GLN n 1 133 MET n 1 134 MET n 1 135 ASP n 1 136 PRO n 1 137 GLY n 1 138 TYR n 1 139 PRO n 1 140 LYS n 1 141 LEU n 1 142 ILE n 1 143 THR n 1 144 LYS n 1 145 ASN n 1 146 PHE n 1 147 GLN n 1 148 GLY n 1 149 ILE n 1 150 GLY n 1 151 PRO n 1 152 LYS n 1 153 ILE n 1 154 ASP n 1 155 ALA n 1 156 VAL n 1 157 PHE n 1 158 TYR n 1 159 SER n 1 160 LYS n 1 161 ASN n 1 162 LYS n 1 163 TYR n 1 164 TYR n 1 165 TYR n 1 166 PHE n 1 167 PHE n 1 168 GLN n 1 169 GLY n 1 170 SER n 1 171 ASN n 1 172 GLN n 1 173 PHE n 1 174 GLU n 1 175 TYR n 1 176 ASP n 1 177 PHE n 1 178 LEU n 1 179 LEU n 1 180 GLN n 1 181 ARG n 1 182 ILE n 1 183 THR n 1 184 LYS n 1 185 THR n 1 186 LEU n 1 187 LYS n 1 188 SER n 1 189 ASN n 1 190 SER n 1 191 TRP n 1 192 PHE n 1 193 GLY n 1 194 CYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pET21a _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MMP12_HUMAN _struct_ref.pdbx_db_accession P39900 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EPALCDPNLSFDAVTTVGNKIFFFKDRFFWLKVSERPKTSVNLISSLWPTLPSGIEAAYEIEARNQVFLFKDDKYWLISN LRPEPNYPKSIHSFGFPNFVKKIDAAVFNPRFYRTYFFVDNQYWRYDERRQMMDPGYPKLITKNFQGIGPKIDAVFYSKN KYYYFFQGSNQFEYDFLLQRITKTLKSNSWFGC ; _struct_ref.pdbx_align_begin 278 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2JXY _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 194 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P39900 _struct_ref_seq.db_align_beg 278 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 470 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 278 _struct_ref_seq.pdbx_auth_seq_align_end 470 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2JXY _struct_ref_seq_dif.mon_id MET _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P39900 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 277 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 2 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 300 _pdbx_nmr_exptl_sample_conditions.pH 7.2 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '0.5mM [U-100% 13C; U-100% 15N] HPX_DOMAIN, 90% H2O, 10% D2O' 1 '90% H2O/10% D2O' '0.7mM [U-100% 15N] HPX_DOMAIN, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 900 Bruker AVANCE 1 'Bruker AVANCE' 500 Bruker DRX 2 'Bruker DRX' # _pdbx_nmr_refine.entry_id 2JXY _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details '20000 steps' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2JXY _pdbx_nmr_details.text 'Acquired and processed using topspin software.' # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'lowest target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 1600 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2JXY _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2JXY _pdbx_nmr_representative.selection_criteria 'rmsd closest to mean' # _pdbx_nmr_software.authors 'Guntert, Braun and Wuthrich' _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name DYANA _pdbx_nmr_software.version ? _pdbx_nmr_software.ordinal 1 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2JXY _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2JXY _struct.title 'Solution structure of the hemopexin-like domain of MMP12' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2JXY _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text ;b-sheet hydrophobic core, Calcium, Extracellular matrix, Glycoprotein, Hydrolase, Metal-binding, Metalloprotease, Polymorphism, Protease, Secreted, Zinc, Zymogen ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 91 ? PHE A 95 ? SER A 367 PHE A 371 5 ? 5 HELX_P HELX_P2 2 LEU A 141 ? PHE A 146 ? LEU A 417 PHE A 422 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 194 SG ? ? A CYS 282 A CYS 470 1_555 ? ? ? ? ? ? ? 2.305 ? ? metalc1 metalc ? ? A ASP 13 O ? ? ? 1_555 B CA . CA ? ? A ASP 289 A CA 471 1_555 ? ? ? ? ? ? ? 1.821 ? ? metalc2 metalc ? ? A GLU 57 O ? ? ? 1_555 B CA . CA ? ? A GLU 333 A CA 471 1_555 ? ? ? ? ? ? ? 2.665 ? ? metalc3 metalc ? ? A ASP 105 O ? ? ? 1_555 B CA . CA ? ? A ASP 381 A CA 471 1_555 ? ? ? ? ? ? ? 1.660 ? ? metalc4 metalc ? ? A ASP 154 O ? ? ? 1_555 B CA . CA ? ? A ASP 430 A CA 471 1_555 ? ? ? ? ? ? ? 2.916 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 3 ? C ? 3 ? D ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel D 1 2 ? anti-parallel D 2 3 ? anti-parallel D 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ALA A 14 ? VAL A 18 ? ALA A 290 VAL A 294 A 2 LYS A 21 ? LYS A 26 ? LYS A 297 LYS A 302 A 3 PHE A 29 ? LEU A 32 ? PHE A 305 LEU A 308 A 4 ASN A 43 ? LEU A 44 ? ASN A 319 LEU A 320 B 1 ALA A 59 ? ILE A 62 ? ALA A 335 ILE A 338 B 2 GLN A 67 ? LYS A 72 ? GLN A 343 LYS A 348 B 3 LYS A 75 ? ILE A 79 ? LYS A 351 ILE A 355 C 1 ALA A 107 ? PHE A 109 ? ALA A 383 PHE A 385 C 2 ARG A 115 ? PHE A 118 ? ARG A 391 PHE A 394 C 3 TYR A 127 ? ASP A 128 ? TYR A 403 ASP A 404 D 1 ALA A 155 ? PHE A 157 ? ALA A 431 PHE A 433 D 2 TYR A 164 ? PHE A 167 ? TYR A 440 PHE A 443 D 3 GLN A 172 ? TYR A 175 ? GLN A 448 TYR A 451 D 4 THR A 185 ? LEU A 186 ? THR A 461 LEU A 462 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N VAL A 18 ? N VAL A 294 O LYS A 21 ? O LYS A 297 A 2 3 N PHE A 24 ? N PHE A 300 O TRP A 31 ? O TRP A 307 A 3 4 N PHE A 30 ? N PHE A 306 O ASN A 43 ? O ASN A 319 B 1 2 N TYR A 60 ? N TYR A 336 O PHE A 69 ? O PHE A 345 B 2 3 N VAL A 68 ? N VAL A 344 O ILE A 79 ? O ILE A 355 C 1 2 N VAL A 108 ? N VAL A 384 O TYR A 117 ? O TYR A 393 C 2 3 N THR A 116 ? N THR A 392 O TYR A 127 ? O TYR A 403 D 1 2 N PHE A 157 ? N PHE A 433 O TYR A 165 ? O TYR A 441 D 2 3 N PHE A 166 ? N PHE A 442 O PHE A 173 ? O PHE A 449 D 3 4 N GLN A 172 ? N GLN A 448 O LEU A 186 ? O LEU A 462 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id CA _struct_site.pdbx_auth_seq_id 471 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 3 _struct_site.details 'BINDING SITE FOR RESIDUE CA A 471' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 PHE A 12 ? PHE A 288 . ? 1_555 ? 2 AC1 3 ASP A 13 ? ASP A 289 . ? 1_555 ? 3 AC1 3 GLU A 57 ? GLU A 333 . ? 1_555 ? # _atom_sites.entry_id 2JXY _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 277 277 MET MET A . n A 1 2 GLU 2 278 278 GLU GLU A . n A 1 3 PRO 3 279 279 PRO PRO A . n A 1 4 ALA 4 280 280 ALA ALA A . n A 1 5 LEU 5 281 281 LEU LEU A . n A 1 6 CYS 6 282 282 CYS CYS A . n A 1 7 ASP 7 283 283 ASP ASP A . n A 1 8 PRO 8 284 284 PRO PRO A . n A 1 9 ASN 9 285 285 ASN ASN A . n A 1 10 LEU 10 286 286 LEU LEU A . n A 1 11 SER 11 287 287 SER SER A . n A 1 12 PHE 12 288 288 PHE PHE A . n A 1 13 ASP 13 289 289 ASP ASP A . n A 1 14 ALA 14 290 290 ALA ALA A . n A 1 15 VAL 15 291 291 VAL VAL A . n A 1 16 THR 16 292 292 THR THR A . n A 1 17 THR 17 293 293 THR THR A . n A 1 18 VAL 18 294 294 VAL VAL A . n A 1 19 GLY 19 295 295 GLY GLY A . n A 1 20 ASN 20 296 296 ASN ASN A . n A 1 21 LYS 21 297 297 LYS LYS A . n A 1 22 ILE 22 298 298 ILE ILE A . n A 1 23 PHE 23 299 299 PHE PHE A . n A 1 24 PHE 24 300 300 PHE PHE A . n A 1 25 PHE 25 301 301 PHE PHE A . n A 1 26 LYS 26 302 302 LYS LYS A . n A 1 27 ASP 27 303 303 ASP ASP A . n A 1 28 ARG 28 304 304 ARG ARG A . n A 1 29 PHE 29 305 305 PHE PHE A . n A 1 30 PHE 30 306 306 PHE PHE A . n A 1 31 TRP 31 307 307 TRP TRP A . n A 1 32 LEU 32 308 308 LEU LEU A . n A 1 33 LYS 33 309 309 LYS LYS A . n A 1 34 VAL 34 310 310 VAL VAL A . n A 1 35 SER 35 311 311 SER SER A . n A 1 36 GLU 36 312 312 GLU GLU A . n A 1 37 ARG 37 313 313 ARG ARG A . n A 1 38 PRO 38 314 314 PRO PRO A . n A 1 39 LYS 39 315 315 LYS LYS A . n A 1 40 THR 40 316 316 THR THR A . n A 1 41 SER 41 317 317 SER SER A . n A 1 42 VAL 42 318 318 VAL VAL A . n A 1 43 ASN 43 319 319 ASN ASN A . n A 1 44 LEU 44 320 320 LEU LEU A . n A 1 45 ILE 45 321 321 ILE ILE A . n A 1 46 SER 46 322 322 SER SER A . n A 1 47 SER 47 323 323 SER SER A . n A 1 48 LEU 48 324 324 LEU LEU A . n A 1 49 TRP 49 325 325 TRP TRP A . n A 1 50 PRO 50 326 326 PRO PRO A . n A 1 51 THR 51 327 327 THR THR A . n A 1 52 LEU 52 328 328 LEU LEU A . n A 1 53 PRO 53 329 329 PRO PRO A . n A 1 54 SER 54 330 330 SER SER A . n A 1 55 GLY 55 331 331 GLY GLY A . n A 1 56 ILE 56 332 332 ILE ILE A . n A 1 57 GLU 57 333 333 GLU GLU A . n A 1 58 ALA 58 334 334 ALA ALA A . n A 1 59 ALA 59 335 335 ALA ALA A . n A 1 60 TYR 60 336 336 TYR TYR A . n A 1 61 GLU 61 337 337 GLU GLU A . n A 1 62 ILE 62 338 338 ILE ILE A . n A 1 63 GLU 63 339 339 GLU GLU A . n A 1 64 ALA 64 340 340 ALA ALA A . n A 1 65 ARG 65 341 341 ARG ARG A . n A 1 66 ASN 66 342 342 ASN ASN A . n A 1 67 GLN 67 343 343 GLN GLN A . n A 1 68 VAL 68 344 344 VAL VAL A . n A 1 69 PHE 69 345 345 PHE PHE A . n A 1 70 LEU 70 346 346 LEU LEU A . n A 1 71 PHE 71 347 347 PHE PHE A . n A 1 72 LYS 72 348 348 LYS LYS A . n A 1 73 ASP 73 349 349 ASP ASP A . n A 1 74 ASP 74 350 350 ASP ASP A . n A 1 75 LYS 75 351 351 LYS LYS A . n A 1 76 TYR 76 352 352 TYR TYR A . n A 1 77 TRP 77 353 353 TRP TRP A . n A 1 78 LEU 78 354 354 LEU LEU A . n A 1 79 ILE 79 355 355 ILE ILE A . n A 1 80 SER 80 356 356 SER SER A . n A 1 81 ASN 81 357 357 ASN ASN A . n A 1 82 LEU 82 358 358 LEU LEU A . n A 1 83 ARG 83 359 359 ARG ARG A . n A 1 84 PRO 84 360 360 PRO PRO A . n A 1 85 GLU 85 361 361 GLU GLU A . n A 1 86 PRO 86 362 362 PRO PRO A . n A 1 87 ASN 87 363 363 ASN ASN A . n A 1 88 TYR 88 364 364 TYR TYR A . n A 1 89 PRO 89 365 365 PRO PRO A . n A 1 90 LYS 90 366 366 LYS LYS A . n A 1 91 SER 91 367 367 SER SER A . n A 1 92 ILE 92 368 368 ILE ILE A . n A 1 93 HIS 93 369 369 HIS HIS A . n A 1 94 SER 94 370 370 SER SER A . n A 1 95 PHE 95 371 371 PHE PHE A . n A 1 96 GLY 96 372 372 GLY GLY A . n A 1 97 PHE 97 373 373 PHE PHE A . n A 1 98 PRO 98 374 374 PRO PRO A . n A 1 99 ASN 99 375 375 ASN ASN A . n A 1 100 PHE 100 376 376 PHE PHE A . n A 1 101 VAL 101 377 377 VAL VAL A . n A 1 102 LYS 102 378 378 LYS LYS A . n A 1 103 LYS 103 379 379 LYS LYS A . n A 1 104 ILE 104 380 380 ILE ILE A . n A 1 105 ASP 105 381 381 ASP ASP A . n A 1 106 ALA 106 382 382 ALA ALA A . n A 1 107 ALA 107 383 383 ALA ALA A . n A 1 108 VAL 108 384 384 VAL VAL A . n A 1 109 PHE 109 385 385 PHE PHE A . n A 1 110 ASN 110 386 386 ASN ASN A . n A 1 111 PRO 111 387 387 PRO PRO A . n A 1 112 ARG 112 388 388 ARG ARG A . n A 1 113 PHE 113 389 389 PHE PHE A . n A 1 114 TYR 114 390 390 TYR TYR A . n A 1 115 ARG 115 391 391 ARG ARG A . n A 1 116 THR 116 392 392 THR THR A . n A 1 117 TYR 117 393 393 TYR TYR A . n A 1 118 PHE 118 394 394 PHE PHE A . n A 1 119 PHE 119 395 395 PHE PHE A . n A 1 120 VAL 120 396 396 VAL VAL A . n A 1 121 ASP 121 397 397 ASP ASP A . n A 1 122 ASN 122 398 398 ASN ASN A . n A 1 123 GLN 123 399 399 GLN GLN A . n A 1 124 TYR 124 400 400 TYR TYR A . n A 1 125 TRP 125 401 401 TRP TRP A . n A 1 126 ARG 126 402 402 ARG ARG A . n A 1 127 TYR 127 403 403 TYR TYR A . n A 1 128 ASP 128 404 404 ASP ASP A . n A 1 129 GLU 129 405 405 GLU GLU A . n A 1 130 ARG 130 406 406 ARG ARG A . n A 1 131 ARG 131 407 407 ARG ARG A . n A 1 132 GLN 132 408 408 GLN GLN A . n A 1 133 MET 133 409 409 MET MET A . n A 1 134 MET 134 410 410 MET MET A . n A 1 135 ASP 135 411 411 ASP ASP A . n A 1 136 PRO 136 412 412 PRO PRO A . n A 1 137 GLY 137 413 413 GLY GLY A . n A 1 138 TYR 138 414 414 TYR TYR A . n A 1 139 PRO 139 415 415 PRO PRO A . n A 1 140 LYS 140 416 416 LYS LYS A . n A 1 141 LEU 141 417 417 LEU LEU A . n A 1 142 ILE 142 418 418 ILE ILE A . n A 1 143 THR 143 419 419 THR THR A . n A 1 144 LYS 144 420 420 LYS LYS A . n A 1 145 ASN 145 421 421 ASN ASN A . n A 1 146 PHE 146 422 422 PHE PHE A . n A 1 147 GLN 147 423 423 GLN GLN A . n A 1 148 GLY 148 424 424 GLY GLY A . n A 1 149 ILE 149 425 425 ILE ILE A . n A 1 150 GLY 150 426 426 GLY GLY A . n A 1 151 PRO 151 427 427 PRO PRO A . n A 1 152 LYS 152 428 428 LYS LYS A . n A 1 153 ILE 153 429 429 ILE ILE A . n A 1 154 ASP 154 430 430 ASP ASP A . n A 1 155 ALA 155 431 431 ALA ALA A . n A 1 156 VAL 156 432 432 VAL VAL A . n A 1 157 PHE 157 433 433 PHE PHE A . n A 1 158 TYR 158 434 434 TYR TYR A . n A 1 159 SER 159 435 435 SER SER A . n A 1 160 LYS 160 436 436 LYS LYS A . n A 1 161 ASN 161 437 437 ASN ASN A . n A 1 162 LYS 162 438 438 LYS LYS A . n A 1 163 TYR 163 439 439 TYR TYR A . n A 1 164 TYR 164 440 440 TYR TYR A . n A 1 165 TYR 165 441 441 TYR TYR A . n A 1 166 PHE 166 442 442 PHE PHE A . n A 1 167 PHE 167 443 443 PHE PHE A . n A 1 168 GLN 168 444 444 GLN GLN A . n A 1 169 GLY 169 445 445 GLY GLY A . n A 1 170 SER 170 446 446 SER SER A . n A 1 171 ASN 171 447 447 ASN ASN A . n A 1 172 GLN 172 448 448 GLN GLN A . n A 1 173 PHE 173 449 449 PHE PHE A . n A 1 174 GLU 174 450 450 GLU GLU A . n A 1 175 TYR 175 451 451 TYR TYR A . n A 1 176 ASP 176 452 452 ASP ASP A . n A 1 177 PHE 177 453 453 PHE PHE A . n A 1 178 LEU 178 454 454 LEU LEU A . n A 1 179 LEU 179 455 455 LEU LEU A . n A 1 180 GLN 180 456 456 GLN GLN A . n A 1 181 ARG 181 457 457 ARG ARG A . n A 1 182 ILE 182 458 458 ILE ILE A . n A 1 183 THR 183 459 459 THR THR A . n A 1 184 LYS 184 460 460 LYS LYS A . n A 1 185 THR 185 461 461 THR THR A . n A 1 186 LEU 186 462 462 LEU LEU A . n A 1 187 LYS 187 463 463 LYS LYS A . n A 1 188 SER 188 464 464 SER SER A . n A 1 189 ASN 189 465 465 ASN ASN A . n A 1 190 SER 190 466 466 SER SER A . n A 1 191 TRP 191 467 467 TRP TRP A . n A 1 192 PHE 192 468 468 PHE PHE A . n A 1 193 GLY 193 469 469 GLY GLY A . n A 1 194 CYS 194 470 470 CYS CYS A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id CA _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 471 _pdbx_nonpoly_scheme.auth_seq_num 471 _pdbx_nonpoly_scheme.pdb_mon_id CA _pdbx_nonpoly_scheme.auth_mon_id CA _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A ASP 13 ? A ASP 289 ? 1_555 CA ? B CA . ? A CA 471 ? 1_555 O ? A GLU 57 ? A GLU 333 ? 1_555 99.3 ? 2 O ? A ASP 13 ? A ASP 289 ? 1_555 CA ? B CA . ? A CA 471 ? 1_555 O ? A ASP 105 ? A ASP 381 ? 1_555 163.0 ? 3 O ? A GLU 57 ? A GLU 333 ? 1_555 CA ? B CA . ? A CA 471 ? 1_555 O ? A ASP 105 ? A ASP 381 ? 1_555 94.8 ? 4 O ? A ASP 13 ? A ASP 289 ? 1_555 CA ? B CA . ? A CA 471 ? 1_555 O ? A ASP 154 ? A ASP 430 ? 1_555 97.6 ? 5 O ? A GLU 57 ? A GLU 333 ? 1_555 CA ? B CA . ? A CA 471 ? 1_555 O ? A ASP 154 ? A ASP 430 ? 1_555 157.6 ? 6 O ? A ASP 105 ? A ASP 381 ? 1_555 CA ? B CA . ? A CA 471 ? 1_555 O ? A ASP 154 ? A ASP 430 ? 1_555 66.4 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-05-27 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_spectrometer 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_conn_angle 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_conn 7 3 'Structure model' struct_ref_seq_dif 8 3 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_spectrometer.model' 4 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 5 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 7 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 8 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 9 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 10 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 11 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 12 3 'Structure model' '_pdbx_struct_conn_angle.value' 13 3 'Structure model' '_struct_conn.pdbx_dist_value' 14 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 15 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 16 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 17 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 18 3 'Structure model' '_struct_ref_seq_dif.details' 19 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 20 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 21 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id HPX_DOMAIN 0.5 mM '[U-100% 13C; U-100% 15N]' 1 HPX_DOMAIN 0.7 mM '[U-100% 15N]' 2 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count 1 _pdbx_nmr_constraints.entry_id 2JXY _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count 72 _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 3890 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count ? _pdbx_nmr_constraints.NOE_long_range_total_count ? _pdbx_nmr_constraints.NOE_medium_range_total_count ? _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count ? _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 95 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 94 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A ILE 368 ? ? H A PHE 371 ? ? 1.50 2 1 O A SER 367 ? ? H A SER 370 ? ? 1.51 3 2 O A ILE 321 ? ? H A LEU 324 ? ? 1.49 4 3 HG A CYS 282 ? ? SG A CYS 470 ? ? 1.05 5 3 O A PHE 300 ? ? H A TRP 307 ? ? 1.54 6 5 O A ILE 321 ? ? H A LEU 324 ? ? 1.50 7 5 O A ILE 368 ? ? H A PHE 371 ? ? 1.60 8 6 O A SER 367 ? ? H A SER 370 ? ? 1.52 9 7 O A ILE 321 ? ? H A LEU 324 ? ? 1.50 10 8 SG A CYS 282 ? ? HG A CYS 470 ? ? 1.39 11 10 O A THR 419 ? ? HE21 A GLN 423 ? ? 1.55 12 11 H A TYR 352 ? ? O A LYS 366 ? ? 1.55 13 11 HH22 A ARG 402 ? ? OD2 A ASP 411 ? ? 1.59 14 12 O A ILE 368 ? ? H A PHE 371 ? ? 1.57 15 12 O A ASP 303 ? ? H A PHE 305 ? ? 1.60 16 15 O A ILE 321 ? ? H A LEU 324 ? ? 1.55 17 16 O A SER 367 ? ? H A SER 370 ? ? 1.46 18 16 O A ALA 290 ? ? H A PHE 301 ? ? 1.54 19 16 O A ASP 303 ? ? H A PHE 305 ? ? 1.56 20 18 O A ILE 368 ? ? H A PHE 371 ? ? 1.50 21 18 O A SER 367 ? ? H A SER 370 ? ? 1.54 22 18 O A ASN 465 ? ? H A GLY 469 ? ? 1.56 23 18 OD1 A ASP 452 ? ? H A LEU 454 ? ? 1.60 24 19 O A ILE 321 ? ? H A LEU 324 ? ? 1.50 25 20 O A SER 367 ? ? H A SER 370 ? ? 1.54 26 20 O A ILE 321 ? ? H A LEU 324 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 280 ? ? -41.30 106.59 2 1 ASP A 283 ? ? -179.04 119.54 3 1 ASN A 285 ? ? 177.68 42.46 4 1 ASP A 303 ? ? 55.69 -91.08 5 1 LYS A 309 ? ? -168.25 89.04 6 1 SER A 311 ? ? 64.31 -85.50 7 1 LEU A 324 ? ? -109.08 -74.00 8 1 PRO A 326 ? ? -74.96 -83.03 9 1 ALA A 340 ? ? -155.58 -58.29 10 1 LYS A 348 ? ? -161.82 119.32 11 1 ASP A 349 ? ? 57.23 -150.94 12 1 ASP A 350 ? ? -87.91 42.17 13 1 GLU A 361 ? ? -36.41 124.74 14 1 ASN A 363 ? ? 63.45 61.41 15 1 PHE A 371 ? ? 164.68 71.23 16 1 PHE A 373 ? ? -34.23 96.30 17 1 PRO A 374 ? ? -75.06 -76.88 18 1 ASN A 375 ? ? -96.80 -78.80 19 1 PHE A 376 ? ? -144.70 58.33 20 1 LYS A 378 ? ? 178.75 -38.28 21 1 PHE A 389 ? ? -151.30 -38.66 22 1 TYR A 390 ? ? 74.08 31.93 23 1 VAL A 396 ? ? -114.62 74.20 24 1 ASP A 397 ? ? 75.96 -65.35 25 1 ASN A 398 ? ? -151.43 50.78 26 1 GLN A 408 ? ? 83.09 29.86 27 1 TYR A 414 ? ? 61.16 63.45 28 1 ILE A 418 ? ? -69.49 -71.35 29 1 THR A 419 ? ? -38.07 -29.93 30 1 ASP A 430 ? ? -75.65 -86.85 31 1 LYS A 436 ? ? 174.62 -160.17 32 1 LYS A 438 ? ? -168.21 49.30 33 1 SER A 446 ? ? -151.57 33.08 34 1 LEU A 455 ? ? -163.51 29.97 35 1 ASN A 465 ? ? -104.07 57.42 36 2 ALA A 280 ? ? -48.28 96.13 37 2 ASP A 283 ? ? -176.21 109.33 38 2 ASN A 285 ? ? -146.21 36.21 39 2 LYS A 302 ? ? -161.60 70.33 40 2 ASP A 303 ? ? 49.14 83.15 41 2 ARG A 304 ? ? 76.06 -54.23 42 2 LYS A 309 ? ? -165.01 98.26 43 2 SER A 311 ? ? 67.20 -75.40 44 2 GLU A 312 ? ? -165.52 77.88 45 2 SER A 322 ? ? -37.61 -33.90 46 2 PRO A 326 ? ? -75.07 -90.08 47 2 SER A 330 ? ? 80.76 -0.05 48 2 ILE A 332 ? ? 42.43 89.60 49 2 ALA A 334 ? ? -168.97 115.84 50 2 LYS A 348 ? ? -178.53 143.88 51 2 ASP A 349 ? ? 51.25 -154.32 52 2 ASP A 350 ? ? -91.62 41.84 53 2 PHE A 373 ? ? 52.10 92.71 54 2 PRO A 374 ? ? -75.00 -162.76 55 2 PHE A 376 ? ? -161.64 102.83 56 2 LYS A 378 ? ? -179.86 -37.10 57 2 ASP A 397 ? ? 51.69 -154.94 58 2 ASN A 398 ? ? -84.72 49.91 59 2 GLN A 408 ? ? 74.52 36.45 60 2 ASP A 430 ? ? -105.14 -60.02 61 2 LYS A 436 ? ? -74.05 -167.32 62 2 LYS A 438 ? ? -159.98 46.48 63 2 SER A 446 ? ? -155.80 38.02 64 2 LEU A 455 ? ? -175.37 35.75 65 2 LYS A 460 ? ? -160.13 112.24 66 2 ASN A 465 ? ? -112.19 72.20 67 3 PRO A 279 ? ? -74.94 -72.28 68 3 ALA A 280 ? ? -135.84 -54.06 69 3 CYS A 282 ? ? -177.80 40.22 70 3 ASP A 283 ? ? -174.20 127.06 71 3 ASP A 289 ? ? -96.50 -62.55 72 3 LYS A 302 ? ? -174.85 145.70 73 3 ARG A 304 ? ? 71.89 -74.25 74 3 SER A 311 ? ? 63.94 -98.04 75 3 LYS A 315 ? ? -140.57 -77.44 76 3 LEU A 324 ? ? -96.47 -83.09 77 3 PRO A 326 ? ? -74.92 -88.42 78 3 ASP A 349 ? ? 53.54 -151.84 79 3 ASP A 350 ? ? -89.37 41.92 80 3 ASN A 363 ? ? 84.96 102.22 81 3 PHE A 371 ? ? -96.12 33.47 82 3 PHE A 373 ? ? 54.71 95.67 83 3 PRO A 374 ? ? -75.00 -163.94 84 3 ASN A 375 ? ? -116.30 51.22 85 3 PHE A 376 ? ? 178.09 36.72 86 3 LYS A 378 ? ? 169.86 -36.73 87 3 ASP A 397 ? ? 50.49 -153.80 88 3 ASN A 398 ? ? -89.04 49.63 89 3 GLN A 408 ? ? 77.46 40.60 90 3 ILE A 418 ? ? -60.64 -73.45 91 3 THR A 419 ? ? -38.64 -30.77 92 3 ASP A 430 ? ? -107.01 -63.11 93 3 LYS A 436 ? ? -100.41 -154.35 94 3 LYS A 438 ? ? -147.31 39.37 95 3 LEU A 455 ? ? -168.08 32.28 96 3 THR A 461 ? ? -155.12 87.07 97 3 ASN A 465 ? ? -94.08 51.59 98 3 TRP A 467 ? ? -177.89 -40.81 99 4 GLU A 278 ? ? 40.21 79.92 100 4 ALA A 280 ? ? -46.03 96.16 101 4 CYS A 282 ? ? -96.78 57.97 102 4 ASN A 285 ? ? -174.93 34.29 103 4 ASP A 289 ? ? -96.00 -62.60 104 4 ASP A 303 ? ? -167.54 -60.03 105 4 GLU A 312 ? ? 70.49 41.41 106 4 ILE A 321 ? ? -68.26 -72.74 107 4 LEU A 324 ? ? -97.94 -76.72 108 4 PRO A 326 ? ? -74.99 -74.22 109 4 GLU A 339 ? ? -69.30 63.99 110 4 ALA A 340 ? ? -140.58 -67.46 111 4 ASN A 342 ? ? 61.47 79.12 112 4 LYS A 348 ? ? -163.76 117.54 113 4 ASP A 349 ? ? 54.45 -150.88 114 4 ASP A 350 ? ? -87.88 41.34 115 4 ASN A 363 ? ? 85.73 102.94 116 4 PHE A 373 ? ? 58.08 95.04 117 4 ASN A 375 ? ? 74.05 45.77 118 4 PHE A 376 ? ? -159.53 -43.71 119 4 VAL A 377 ? ? -48.82 170.75 120 4 LYS A 378 ? ? -177.88 -35.46 121 4 ASP A 397 ? ? 51.88 -154.97 122 4 ASN A 398 ? ? -87.59 49.60 123 4 GLN A 408 ? ? 71.59 46.52 124 4 ILE A 418 ? ? -69.78 -73.01 125 4 THR A 419 ? ? -38.12 -31.48 126 4 ILE A 425 ? ? -134.57 -64.64 127 4 LYS A 438 ? ? -156.85 59.67 128 4 GLN A 444 ? ? -163.99 66.04 129 4 SER A 446 ? ? -172.47 49.81 130 4 LEU A 455 ? ? -173.48 35.33 131 5 PRO A 279 ? ? -75.03 -161.88 132 5 ALA A 280 ? ? -165.10 -61.02 133 5 LEU A 281 ? ? 44.54 73.15 134 5 CYS A 282 ? ? 178.20 -80.99 135 5 ASN A 296 ? ? -146.81 34.83 136 5 LYS A 302 ? ? -128.84 -69.34 137 5 ASP A 303 ? ? -143.93 -68.13 138 5 ARG A 304 ? ? -108.87 -61.01 139 5 SER A 311 ? ? 64.58 -81.57 140 5 GLU A 312 ? ? -154.82 72.65 141 5 SER A 323 ? ? -38.39 -36.05 142 5 LEU A 324 ? ? -107.29 -74.22 143 5 PRO A 326 ? ? -75.09 -77.77 144 5 SER A 330 ? ? 60.33 -169.51 145 5 ALA A 340 ? ? -160.44 -60.54 146 5 ASN A 342 ? ? 77.64 51.87 147 5 LYS A 348 ? ? -170.60 128.50 148 5 ASP A 349 ? ? 56.65 -150.06 149 5 ASP A 350 ? ? -89.89 40.27 150 5 ASN A 357 ? ? 76.49 -59.66 151 5 LEU A 358 ? ? -161.22 -59.76 152 5 ASN A 363 ? ? 80.33 109.51 153 5 PHE A 371 ? ? -156.93 45.26 154 5 PHE A 373 ? ? 37.36 61.01 155 5 PRO A 374 ? ? -75.00 -162.75 156 5 PHE A 376 ? ? 169.17 80.83 157 5 LYS A 378 ? ? -174.36 -45.68 158 5 ASP A 397 ? ? 48.42 -152.28 159 5 ASN A 398 ? ? -88.13 45.85 160 5 GLN A 408 ? ? 83.57 40.70 161 5 LYS A 420 ? ? -70.82 -72.52 162 5 ILE A 425 ? ? -62.63 -72.64 163 5 ASP A 430 ? ? -86.77 -83.56 164 5 LYS A 436 ? ? 169.82 -162.44 165 5 LYS A 438 ? ? -161.36 62.60 166 5 SER A 446 ? ? 179.30 41.59 167 5 LEU A 455 ? ? -171.72 -38.70 168 5 GLN A 456 ? ? 84.26 64.31 169 5 PHE A 468 ? ? -39.87 -37.62 170 6 GLU A 278 ? ? -48.89 165.76 171 6 ASP A 283 ? ? -177.31 110.06 172 6 ASN A 285 ? ? -161.92 48.80 173 6 ASP A 289 ? ? -126.09 -53.21 174 6 ASP A 303 ? ? 56.71 -87.81 175 6 VAL A 310 ? ? -174.33 -179.96 176 6 SER A 311 ? ? 44.41 88.92 177 6 GLU A 312 ? ? 37.03 73.70 178 6 ILE A 321 ? ? -59.13 -73.78 179 6 LEU A 324 ? ? -102.81 -79.78 180 6 PRO A 326 ? ? -75.06 -89.04 181 6 ASP A 349 ? ? 50.15 -149.44 182 6 ASP A 350 ? ? -86.25 40.44 183 6 ASN A 357 ? ? 68.82 -65.35 184 6 LEU A 358 ? ? -144.15 -52.25 185 6 ASN A 363 ? ? 87.03 73.80 186 6 PHE A 371 ? ? 161.44 -27.03 187 6 PHE A 376 ? ? -178.34 -49.33 188 6 VAL A 377 ? ? -43.87 163.97 189 6 LYS A 378 ? ? -170.40 -40.59 190 6 ASP A 397 ? ? 51.81 -152.92 191 6 ASN A 398 ? ? -85.22 49.86 192 6 GLN A 408 ? ? 80.45 32.52 193 6 ILE A 425 ? ? -147.24 -48.18 194 6 LYS A 436 ? ? 173.37 -156.26 195 6 LYS A 438 ? ? 176.37 65.27 196 6 GLN A 448 ? ? -103.52 63.49 197 6 LEU A 455 ? ? -133.65 -44.35 198 6 GLN A 456 ? ? 82.43 34.79 199 6 THR A 461 ? ? -141.94 59.57 200 6 TRP A 467 ? ? -164.65 -44.97 201 7 GLU A 278 ? ? -37.17 100.86 202 7 PRO A 279 ? ? -75.10 -161.57 203 7 ALA A 280 ? ? 174.24 107.06 204 7 LEU A 281 ? ? -97.03 59.95 205 7 CYS A 282 ? ? 160.95 48.63 206 7 ASP A 283 ? ? -175.47 130.33 207 7 ASN A 285 ? ? -170.47 32.69 208 7 ASP A 289 ? ? -104.20 -64.99 209 7 VAL A 294 ? ? -117.86 71.60 210 7 PHE A 301 ? ? -107.61 60.25 211 7 LYS A 302 ? ? -36.16 -76.84 212 7 ASP A 303 ? ? -145.67 -77.32 213 7 SER A 311 ? ? 68.17 -80.49 214 7 ARG A 313 ? ? -36.40 97.42 215 7 ILE A 321 ? ? -69.85 -75.23 216 7 SER A 323 ? ? -39.28 -33.29 217 7 LEU A 324 ? ? -105.44 -80.40 218 7 PRO A 326 ? ? -74.98 -79.98 219 7 ASP A 349 ? ? 52.28 -152.15 220 7 ASP A 350 ? ? -86.23 44.46 221 7 ASN A 363 ? ? 86.23 103.79 222 7 PHE A 373 ? ? 56.30 87.40 223 7 ASN A 375 ? ? 59.59 74.99 224 7 PHE A 376 ? ? 179.32 -36.54 225 7 LYS A 378 ? ? 179.77 -36.30 226 7 PRO A 387 ? ? -74.95 49.50 227 7 ARG A 388 ? ? -156.96 -39.07 228 7 ASP A 397 ? ? 62.77 -84.47 229 7 THR A 419 ? ? -37.83 -39.51 230 7 LYS A 436 ? ? -69.69 -167.70 231 7 LYS A 438 ? ? -161.54 46.51 232 7 SER A 446 ? ? -141.65 44.13 233 7 THR A 459 ? ? -69.96 -70.14 234 7 SER A 464 ? ? 44.92 25.35 235 7 TRP A 467 ? ? 177.08 56.31 236 7 PHE A 468 ? ? -163.42 -41.16 237 8 PRO A 279 ? ? -74.95 -86.17 238 8 ALA A 280 ? ? -166.86 -52.25 239 8 LEU A 281 ? ? 73.75 36.04 240 8 CYS A 282 ? ? 178.75 42.75 241 8 ASN A 285 ? ? -165.11 55.99 242 8 LYS A 302 ? ? -127.06 -53.55 243 8 ASP A 303 ? ? -165.30 79.76 244 8 ARG A 304 ? ? 80.45 -10.27 245 8 VAL A 310 ? ? 177.81 -72.08 246 8 SER A 311 ? ? -37.33 -82.69 247 8 LEU A 324 ? ? -105.48 -76.29 248 8 TRP A 325 ? ? -48.79 153.04 249 8 PRO A 326 ? ? -75.00 -79.13 250 8 SER A 330 ? ? 53.04 -162.42 251 8 GLU A 339 ? ? -67.13 73.19 252 8 ALA A 340 ? ? -156.52 -55.50 253 8 ASN A 342 ? ? 56.59 75.64 254 8 ASP A 349 ? ? 53.75 -151.00 255 8 ASP A 350 ? ? -87.13 43.98 256 8 ASN A 363 ? ? 86.75 96.60 257 8 PHE A 371 ? ? -153.50 39.51 258 8 PHE A 373 ? ? 35.57 60.68 259 8 PRO A 374 ? ? -74.87 -88.01 260 8 ASN A 375 ? ? -135.95 -46.95 261 8 PHE A 376 ? ? -171.32 84.19 262 8 LYS A 378 ? ? 172.84 -34.29 263 8 ARG A 388 ? ? -87.20 44.43 264 8 PHE A 389 ? ? -172.69 -37.83 265 8 TYR A 390 ? ? 72.33 39.79 266 8 ASP A 397 ? ? 52.80 -151.14 267 8 ASN A 398 ? ? -87.72 49.21 268 8 GLN A 408 ? ? 81.00 39.65 269 8 ILE A 425 ? ? -147.16 -58.75 270 8 ASP A 430 ? ? -98.99 -71.06 271 8 VAL A 432 ? ? -160.07 108.52 272 8 LYS A 436 ? ? -71.30 -152.35 273 8 LYS A 438 ? ? 44.96 29.48 274 8 GLN A 444 ? ? -152.39 69.50 275 8 SER A 446 ? ? -150.58 40.22 276 8 LEU A 455 ? ? -164.92 30.48 277 8 GLN A 456 ? ? 45.70 75.78 278 8 TRP A 467 ? ? -122.05 -70.18 279 9 GLU A 278 ? ? -157.07 60.86 280 9 ALA A 280 ? ? 27.84 56.22 281 9 LEU A 281 ? ? -103.19 40.12 282 9 CYS A 282 ? ? -171.79 -60.42 283 9 ASN A 285 ? ? -167.19 32.35 284 9 ASP A 289 ? ? -145.23 -57.10 285 9 ASN A 296 ? ? 80.05 -2.93 286 9 ASP A 303 ? ? 65.21 -82.81 287 9 SER A 311 ? ? 35.97 -153.17 288 9 ARG A 313 ? ? -27.56 120.53 289 9 ILE A 321 ? ? -59.44 -81.64 290 9 LEU A 324 ? ? -107.43 -66.75 291 9 PRO A 326 ? ? -74.92 -88.65 292 9 GLU A 339 ? ? -68.17 66.56 293 9 ALA A 340 ? ? -139.42 -68.37 294 9 ASN A 342 ? ? 59.91 80.57 295 9 ASP A 349 ? ? 55.15 -151.84 296 9 ASP A 350 ? ? -86.09 41.77 297 9 GLU A 361 ? ? -38.36 123.01 298 9 ASN A 363 ? ? 64.67 60.76 299 9 PHE A 371 ? ? -162.91 53.20 300 9 PRO A 374 ? ? -74.96 -163.14 301 9 PHE A 376 ? ? -168.99 83.69 302 9 LYS A 378 ? ? -178.22 -35.87 303 9 ASP A 397 ? ? 69.84 -70.09 304 9 ASN A 398 ? ? -148.53 58.29 305 9 ARG A 407 ? ? -131.13 -44.69 306 9 GLN A 408 ? ? 80.93 54.31 307 9 ILE A 425 ? ? -73.37 -76.48 308 9 ASP A 430 ? ? -107.38 -63.34 309 9 LYS A 436 ? ? -69.33 -166.99 310 9 LYS A 438 ? ? -161.64 50.42 311 9 LEU A 455 ? ? -167.43 31.95 312 9 ASN A 465 ? ? -100.25 58.85 313 9 TRP A 467 ? ? -138.96 -59.87 314 10 PRO A 279 ? ? -74.98 -76.33 315 10 ALA A 280 ? ? 168.65 119.31 316 10 LEU A 281 ? ? -101.73 77.43 317 10 CYS A 282 ? ? 174.94 -76.12 318 10 ASN A 285 ? ? -154.18 34.35 319 10 ASP A 303 ? ? 67.41 -68.70 320 10 ARG A 304 ? ? -133.08 -32.92 321 10 LYS A 309 ? ? -171.47 102.21 322 10 SER A 311 ? ? 68.71 -74.52 323 10 GLU A 312 ? ? -157.55 78.25 324 10 LEU A 324 ? ? -94.61 -83.94 325 10 PRO A 326 ? ? -75.02 -90.16 326 10 GLU A 339 ? ? -65.98 86.15 327 10 ALA A 340 ? ? -159.28 -52.00 328 10 ASP A 349 ? ? 44.56 -95.31 329 10 ASP A 350 ? ? -141.59 15.82 330 10 ASN A 357 ? ? 71.08 50.97 331 10 ASN A 363 ? ? 78.68 91.33 332 10 PHE A 371 ? ? 175.08 66.74 333 10 PHE A 373 ? ? -35.17 95.79 334 10 ASN A 375 ? ? 84.10 29.40 335 10 PHE A 376 ? ? -151.94 -59.92 336 10 VAL A 377 ? ? -49.68 166.31 337 10 LYS A 378 ? ? -175.22 -39.19 338 10 ASP A 397 ? ? 51.08 -152.67 339 10 GLN A 408 ? ? 70.26 46.71 340 10 ILE A 418 ? ? -70.21 -71.56 341 10 ILE A 425 ? ? -147.99 -47.88 342 10 LYS A 436 ? ? -67.93 -168.55 343 10 LYS A 438 ? ? -176.22 51.78 344 10 GLN A 444 ? ? -114.68 78.69 345 10 SER A 446 ? ? -141.70 38.33 346 10 GLU A 450 ? ? -104.48 76.17 347 10 LEU A 455 ? ? -168.72 32.15 348 10 LYS A 463 ? ? -149.35 58.66 349 10 ASN A 465 ? ? -173.59 44.28 350 10 TRP A 467 ? ? -165.31 -43.12 351 11 ALA A 280 ? ? -36.26 -34.75 352 11 CYS A 282 ? ? -157.14 51.01 353 11 ASN A 285 ? ? -169.59 40.81 354 11 ASP A 303 ? ? -169.82 -61.89 355 11 GLU A 312 ? ? -149.33 23.36 356 11 ILE A 321 ? ? -68.17 -70.10 357 11 SER A 330 ? ? 58.68 111.90 358 11 ILE A 332 ? ? -49.25 102.12 359 11 ASP A 349 ? ? 50.32 -150.50 360 11 ASP A 350 ? ? -88.26 44.11 361 11 GLU A 361 ? ? -39.04 128.29 362 11 ASN A 363 ? ? 77.99 54.99 363 11 PHE A 371 ? ? -170.84 57.22 364 11 PHE A 373 ? ? -19.56 92.09 365 11 ASN A 375 ? ? -134.62 -55.84 366 11 PHE A 376 ? ? -160.44 33.00 367 11 LYS A 378 ? ? -160.84 29.75 368 11 LYS A 379 ? ? -170.91 122.10 369 11 ASP A 397 ? ? 55.89 -151.94 370 11 ASN A 398 ? ? -89.08 48.65 371 11 GLN A 408 ? ? 81.89 39.76 372 11 PHE A 422 ? ? -81.30 -70.99 373 11 GLN A 423 ? ? 75.89 96.72 374 11 LYS A 436 ? ? 176.53 -163.25 375 11 LYS A 438 ? ? -178.54 62.02 376 11 GLN A 444 ? ? -159.28 67.45 377 11 SER A 446 ? ? -150.66 36.10 378 11 LEU A 455 ? ? -177.03 44.96 379 11 GLN A 456 ? ? 38.47 45.74 380 11 THR A 459 ? ? -102.23 43.31 381 11 PHE A 468 ? ? -39.34 -29.61 382 12 PRO A 279 ? ? -75.04 -75.74 383 12 ALA A 280 ? ? 162.87 -33.41 384 12 ASN A 296 ? ? -141.37 25.39 385 12 LYS A 302 ? ? -162.26 74.05 386 12 ASP A 303 ? ? 49.65 88.36 387 12 ARG A 304 ? ? 69.15 -57.60 388 12 LEU A 324 ? ? -97.20 -73.45 389 12 PRO A 326 ? ? -75.04 -74.56 390 12 ASP A 349 ? ? 51.09 -151.91 391 12 ASP A 350 ? ? -85.93 44.69 392 12 PHE A 373 ? ? 59.14 82.14 393 12 PRO A 374 ? ? -75.09 -162.20 394 12 ASN A 375 ? ? -107.68 64.60 395 12 PHE A 376 ? ? 172.85 38.69 396 12 LYS A 378 ? ? 174.26 -36.92 397 12 TYR A 390 ? ? 53.32 19.13 398 12 ASP A 397 ? ? 69.23 -65.32 399 12 ASN A 398 ? ? -152.87 55.82 400 12 GLN A 408 ? ? 83.75 31.31 401 12 THR A 419 ? ? -38.92 -31.15 402 12 ILE A 425 ? ? -151.27 -44.53 403 12 LYS A 436 ? ? 174.24 -161.83 404 12 LYS A 438 ? ? -174.82 57.14 405 12 GLN A 444 ? ? -117.46 79.71 406 12 LEU A 455 ? ? -166.29 32.72 407 12 LYS A 460 ? ? -160.51 102.89 408 12 ASN A 465 ? ? -92.10 59.98 409 13 CYS A 282 ? ? -156.89 38.86 410 13 ASN A 285 ? ? -174.43 49.70 411 13 ASP A 289 ? ? -120.36 -52.45 412 13 ASP A 303 ? ? -166.33 -60.12 413 13 VAL A 310 ? ? -175.65 -179.54 414 13 SER A 311 ? ? 40.28 90.13 415 13 GLU A 312 ? ? 37.36 70.79 416 13 LEU A 324 ? ? -103.07 -79.05 417 13 TRP A 325 ? ? -49.05 154.01 418 13 PRO A 326 ? ? -74.99 -80.07 419 13 ILE A 332 ? ? -42.31 151.38 420 13 ALA A 340 ? ? -157.57 -52.75 421 13 ASP A 349 ? ? 32.00 49.82 422 13 ASP A 350 ? ? 162.40 -72.62 423 13 ASN A 363 ? ? 60.04 61.49 424 13 PRO A 365 ? ? -74.95 43.98 425 13 PHE A 373 ? ? 55.23 94.24 426 13 PRO A 374 ? ? -75.09 -161.00 427 13 ASN A 375 ? ? -53.02 89.87 428 13 PHE A 376 ? ? 32.68 74.97 429 13 PRO A 387 ? ? -75.02 49.60 430 13 ARG A 388 ? ? -155.78 -39.52 431 13 ASP A 397 ? ? 59.00 -88.06 432 13 GLN A 408 ? ? 75.97 42.80 433 13 LYS A 420 ? ? -58.35 -74.70 434 13 LYS A 436 ? ? -65.13 -168.45 435 13 LYS A 438 ? ? -163.74 61.45 436 13 SER A 446 ? ? -109.72 43.83 437 13 LEU A 455 ? ? -161.29 27.29 438 13 GLN A 456 ? ? 39.24 61.15 439 13 ASN A 465 ? ? -96.46 58.18 440 14 PRO A 279 ? ? -74.97 -161.83 441 14 ALA A 280 ? ? -104.71 -67.84 442 14 CYS A 282 ? ? 159.28 51.15 443 14 ASP A 283 ? ? -178.79 123.78 444 14 ASN A 285 ? ? 178.96 45.85 445 14 ASN A 296 ? ? 80.17 4.51 446 14 LYS A 302 ? ? -109.42 -60.49 447 14 ASP A 303 ? ? -166.15 -60.04 448 14 VAL A 310 ? ? -170.65 -73.30 449 14 SER A 311 ? ? -36.15 -76.96 450 14 GLU A 312 ? ? -157.03 76.15 451 14 VAL A 318 ? ? -103.57 70.58 452 14 LEU A 324 ? ? -102.23 -79.83 453 14 TRP A 325 ? ? -47.45 151.71 454 14 PRO A 326 ? ? -75.00 -76.28 455 14 ILE A 332 ? ? -41.84 152.97 456 14 ALA A 340 ? ? -163.01 -59.82 457 14 LYS A 348 ? ? -161.40 114.91 458 14 ASP A 349 ? ? 55.49 -149.35 459 14 ASP A 350 ? ? -88.71 41.05 460 14 GLU A 361 ? ? -36.96 126.79 461 14 ASN A 363 ? ? 62.55 60.49 462 14 PHE A 371 ? ? 175.52 59.14 463 14 PHE A 373 ? ? -44.42 102.94 464 14 ASN A 375 ? ? 169.66 43.28 465 14 PHE A 376 ? ? -166.18 -54.86 466 14 VAL A 377 ? ? -42.87 164.79 467 14 LYS A 378 ? ? -177.38 -38.38 468 14 PHE A 389 ? ? -151.87 -37.01 469 14 TYR A 390 ? ? 73.51 46.11 470 14 ASP A 397 ? ? 47.18 -149.95 471 14 GLN A 408 ? ? 74.09 46.77 472 14 ILE A 418 ? ? -70.25 -72.59 473 14 ASP A 430 ? ? -109.63 -69.44 474 14 LYS A 436 ? ? -66.60 -169.16 475 14 LYS A 438 ? ? -153.61 63.14 476 14 SER A 446 ? ? -162.08 41.65 477 14 LEU A 455 ? ? -170.71 33.17 478 14 THR A 459 ? ? -107.53 51.30 479 14 LYS A 460 ? ? -160.50 114.34 480 15 ALA A 280 ? ? -169.87 44.63 481 15 ASN A 285 ? ? -164.71 34.74 482 15 ASP A 303 ? ? 66.90 -78.56 483 15 SER A 311 ? ? 45.05 90.61 484 15 GLU A 312 ? ? 35.74 73.35 485 15 SER A 323 ? ? -39.79 -38.45 486 15 LEU A 324 ? ? -97.21 -85.60 487 15 GLU A 339 ? ? -65.65 76.03 488 15 ALA A 340 ? ? -158.90 -53.66 489 15 ASP A 349 ? ? 54.32 -150.31 490 15 ASP A 350 ? ? -88.25 41.62 491 15 ASN A 357 ? ? 70.29 -58.14 492 15 LEU A 358 ? ? -147.87 -52.53 493 15 PRO A 360 ? ? -75.05 -162.03 494 15 ASN A 363 ? ? 79.90 104.70 495 15 PHE A 371 ? ? -167.40 56.28 496 15 PHE A 373 ? ? 35.85 62.30 497 15 PRO A 374 ? ? -74.97 -164.89 498 15 PHE A 376 ? ? -172.24 78.51 499 15 LYS A 378 ? ? -172.79 -41.37 500 15 ASP A 397 ? ? 52.90 -149.97 501 15 ASN A 398 ? ? -89.87 49.65 502 15 GLN A 408 ? ? 74.14 54.28 503 15 LYS A 420 ? ? -63.44 -75.81 504 15 ILE A 425 ? ? -68.65 -81.53 505 15 ASN A 437 ? ? -63.72 -73.54 506 15 SER A 446 ? ? 165.75 41.89 507 15 LEU A 455 ? ? -174.35 33.93 508 15 GLN A 456 ? ? 35.93 63.98 509 15 TRP A 467 ? ? -132.46 -49.97 510 16 ALA A 280 ? ? 169.25 104.32 511 16 CYS A 282 ? ? -178.44 -51.57 512 16 ASN A 285 ? ? -156.80 30.64 513 16 LYS A 302 ? ? -160.24 -50.30 514 16 ASP A 303 ? ? 172.42 100.69 515 16 ARG A 304 ? ? 67.37 -58.61 516 16 SER A 311 ? ? 38.30 -148.04 517 16 LEU A 324 ? ? -108.98 -65.91 518 16 PRO A 326 ? ? -75.00 -82.80 519 16 GLU A 339 ? ? -68.17 78.83 520 16 ALA A 340 ? ? -159.99 -53.52 521 16 ASN A 342 ? ? 59.17 70.84 522 16 ASP A 349 ? ? 53.76 -150.41 523 16 ASP A 350 ? ? -87.95 41.47 524 16 GLU A 361 ? ? -34.24 123.64 525 16 ASN A 363 ? ? 65.44 62.54 526 16 PHE A 371 ? ? 174.29 61.84 527 16 PHE A 373 ? ? -32.59 95.43 528 16 ASN A 375 ? ? 160.74 45.66 529 16 PHE A 376 ? ? -178.99 -48.90 530 16 VAL A 377 ? ? -40.07 153.37 531 16 LYS A 378 ? ? -177.54 -38.52 532 16 ASP A 397 ? ? 52.30 -152.98 533 16 ASN A 398 ? ? -88.08 49.66 534 16 GLN A 408 ? ? 74.02 30.62 535 16 MET A 410 ? ? -39.31 142.03 536 16 ILE A 418 ? ? -69.04 -77.54 537 16 ASP A 430 ? ? -93.55 -60.33 538 16 LYS A 436 ? ? -73.27 -167.12 539 16 LYS A 438 ? ? -145.78 50.20 540 16 LEU A 455 ? ? -173.55 37.51 541 16 GLN A 456 ? ? 36.66 64.69 542 16 TRP A 467 ? ? -175.08 -42.42 543 17 ASN A 285 ? ? -173.67 41.67 544 17 LYS A 302 ? ? -145.59 -113.98 545 17 ASP A 303 ? ? -77.62 -79.26 546 17 VAL A 310 ? ? -176.81 -178.97 547 17 SER A 311 ? ? 45.81 87.56 548 17 GLU A 312 ? ? 32.33 77.31 549 17 LEU A 324 ? ? -93.10 -74.73 550 17 PRO A 326 ? ? -74.90 -79.04 551 17 LYS A 348 ? ? -161.05 114.90 552 17 ASP A 349 ? ? 61.13 -144.77 553 17 ASP A 350 ? ? -89.20 36.45 554 17 ASN A 357 ? ? 78.11 -56.99 555 17 LEU A 358 ? ? -162.77 -49.10 556 17 ASN A 363 ? ? 61.06 62.33 557 17 PRO A 365 ? ? -75.03 46.82 558 17 LYS A 366 ? ? -49.04 151.45 559 17 PHE A 371 ? ? 175.48 58.19 560 17 PHE A 373 ? ? -30.96 94.49 561 17 ASN A 375 ? ? -119.74 -70.81 562 17 LYS A 378 ? ? -178.90 -36.36 563 17 ASP A 397 ? ? 54.58 -151.95 564 17 ASN A 398 ? ? -88.62 42.73 565 17 GLN A 408 ? ? 77.05 40.12 566 17 LYS A 436 ? ? 75.64 -141.41 567 17 LYS A 438 ? ? 38.83 41.09 568 17 LEU A 455 ? ? -169.56 37.98 569 17 GLN A 456 ? ? 39.26 57.47 570 17 SER A 464 ? ? -35.96 -38.96 571 17 ASN A 465 ? ? -101.73 56.06 572 17 TRP A 467 ? ? -171.57 -42.69 573 18 GLU A 278 ? ? 39.68 80.30 574 18 ALA A 280 ? ? -179.90 -37.39 575 18 CYS A 282 ? ? -173.65 44.94 576 18 ASP A 283 ? ? -170.03 134.41 577 18 ASP A 289 ? ? -141.89 -51.08 578 18 ASP A 303 ? ? 63.76 -85.18 579 18 LYS A 309 ? ? -170.19 136.52 580 18 VAL A 310 ? ? -176.98 -77.47 581 18 SER A 311 ? ? -29.07 -90.13 582 18 ARG A 313 ? ? -39.06 101.08 583 18 ILE A 321 ? ? -60.38 -71.45 584 18 SER A 323 ? ? -39.77 -36.64 585 18 LEU A 324 ? ? -102.97 -87.06 586 18 TRP A 325 ? ? -43.10 153.23 587 18 ALA A 334 ? ? -177.60 143.87 588 18 ASN A 342 ? ? 70.20 39.43 589 18 ASP A 349 ? ? 53.65 -151.88 590 18 ASP A 350 ? ? -88.15 42.32 591 18 PHE A 371 ? ? 173.72 54.25 592 18 PHE A 373 ? ? -35.01 96.25 593 18 ASN A 375 ? ? -122.32 -74.10 594 18 PHE A 376 ? ? -141.93 53.52 595 18 LYS A 379 ? ? -174.57 110.85 596 18 TYR A 390 ? ? 39.86 44.49 597 18 ASP A 397 ? ? 52.83 -152.53 598 18 ASN A 398 ? ? -87.16 46.56 599 18 GLN A 408 ? ? 82.00 30.90 600 18 LYS A 436 ? ? 176.18 -160.32 601 18 LYS A 438 ? ? -173.47 54.08 602 18 GLN A 448 ? ? -101.25 77.25 603 18 LEU A 455 ? ? -170.16 43.25 604 18 GLN A 456 ? ? 37.85 64.08 605 18 THR A 459 ? ? -107.17 45.51 606 18 LYS A 460 ? ? -155.39 74.94 607 18 THR A 461 ? ? -106.52 75.96 608 18 ASN A 465 ? ? -38.44 -34.35 609 18 TRP A 467 ? ? -93.23 45.89 610 18 PHE A 468 ? ? -159.35 -41.37 611 19 ALA A 280 ? ? 178.48 100.92 612 19 LEU A 281 ? ? -100.40 77.23 613 19 CYS A 282 ? ? 174.10 -75.02 614 19 ASN A 285 ? ? -155.09 26.20 615 19 LYS A 302 ? ? -153.92 71.57 616 19 ASP A 303 ? ? 43.81 85.06 617 19 ARG A 304 ? ? 75.89 -56.29 618 19 GLU A 312 ? ? 70.39 33.13 619 19 SER A 322 ? ? -38.20 -37.61 620 19 LEU A 324 ? ? -113.45 -73.45 621 19 PRO A 326 ? ? -74.98 -87.58 622 19 SER A 330 ? ? 80.07 1.10 623 19 ASN A 342 ? ? 79.37 52.25 624 19 LYS A 348 ? ? -160.48 111.11 625 19 ASP A 349 ? ? 57.51 -150.40 626 19 ASP A 350 ? ? -84.78 41.26 627 19 ASN A 357 ? ? 73.93 -63.68 628 19 LEU A 358 ? ? -165.97 30.09 629 19 ASN A 363 ? ? 62.73 61.40 630 19 PRO A 365 ? ? -74.98 49.40 631 19 PHE A 371 ? ? -99.64 36.32 632 19 PHE A 373 ? ? 58.16 102.72 633 19 PRO A 374 ? ? -74.97 -78.86 634 19 ASN A 375 ? ? -122.61 -75.19 635 19 ARG A 388 ? ? -84.39 44.06 636 19 PHE A 389 ? ? -171.07 -36.07 637 19 TYR A 390 ? ? 73.01 30.07 638 19 ASP A 397 ? ? 55.70 -152.64 639 19 GLN A 408 ? ? 70.50 49.77 640 19 MET A 410 ? ? -37.17 140.04 641 19 PRO A 427 ? ? -75.07 40.97 642 19 LYS A 436 ? ? -62.00 -169.08 643 19 LYS A 438 ? ? -146.67 58.08 644 19 GLN A 444 ? ? -153.84 85.61 645 19 SER A 446 ? ? -149.80 43.99 646 19 LEU A 455 ? ? -171.88 37.88 647 19 GLN A 456 ? ? 46.85 74.00 648 19 ASN A 465 ? ? -175.93 54.64 649 19 PHE A 468 ? ? -162.35 -66.96 650 20 ALA A 280 ? ? 169.63 103.84 651 20 ASP A 283 ? ? -178.94 111.43 652 20 ASN A 285 ? ? -170.57 48.75 653 20 ASP A 289 ? ? -132.46 -48.74 654 20 ARG A 304 ? ? 68.86 -72.14 655 20 LEU A 324 ? ? -102.24 -83.18 656 20 PRO A 326 ? ? -74.98 -82.32 657 20 SER A 330 ? ? 50.19 -155.23 658 20 LYS A 348 ? ? -165.04 114.46 659 20 ASP A 349 ? ? 58.81 -150.63 660 20 ASP A 350 ? ? -87.65 40.56 661 20 ASN A 357 ? ? 69.49 -62.38 662 20 LEU A 358 ? ? -172.11 73.32 663 20 ARG A 359 ? ? 175.16 106.54 664 20 ASN A 363 ? ? 61.02 62.81 665 20 PHE A 371 ? ? -152.03 29.53 666 20 PHE A 373 ? ? 27.33 59.27 667 20 PHE A 376 ? ? 178.61 50.26 668 20 LYS A 378 ? ? -179.54 -39.15 669 20 TYR A 390 ? ? 38.84 45.97 670 20 ASP A 397 ? ? 56.15 -149.87 671 20 ASN A 398 ? ? -88.20 40.00 672 20 GLN A 408 ? ? 83.50 22.63 673 20 THR A 419 ? ? -39.64 -31.56 674 20 LYS A 436 ? ? 82.78 -128.64 675 20 LYS A 438 ? ? -157.87 34.30 676 20 GLN A 444 ? ? -113.61 78.47 677 20 SER A 446 ? ? -95.42 36.51 678 20 LEU A 455 ? ? -148.74 22.06 679 20 ASN A 465 ? ? -90.74 50.11 680 20 PHE A 468 ? ? -38.55 -35.75 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'CALCIUM ION' _pdbx_entity_nonpoly.comp_id CA #