data_2JYO # _entry.id 2JYO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2JYO pdb_00002jyo 10.2210/pdb2jyo/pdb RCSB RCSB100455 ? ? BMRB 15596 ? ? WWPDB D_1000100455 ? ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.content_type 1HA6 PDB 'Mouse MIP-3alpha/CCL20' unspecified 1M8A PDB 'Human MIP-3alpha X-ray structure' unspecified 2HCI PDB 'Human MIP-3alpha X-ray structure' unspecified 15596 BMRB . unspecified # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2JYO _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2007-12-14 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Chan, D.I.' 1 'Hunter, H.N.' 2 'Tack, B.F.' 3 'Vogel, H.J.' 4 # _citation.id primary _citation.title ;Human macrophage inflammatory protein 3alpha: protein and peptide nuclear magnetic resonance solution structures, dimerization, dynamics, and anti-infective properties. ; _citation.journal_abbrev 'Antimicrob.Agents Chemother.' _citation.journal_volume 52 _citation.page_first 883 _citation.page_last 894 _citation.year 2008 _citation.journal_id_ASTM AMACCQ _citation.country US _citation.journal_id_ISSN 0066-4804 _citation.journal_id_CSD 0788 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18086840 _citation.pdbx_database_id_DOI 10.1128/AAC.00805-07 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Chan, D.I.' 1 ? primary 'Hunter, H.N.' 2 ? primary 'Tack, B.F.' 3 ? primary 'Vogel, H.J.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description ;C-C motif chemokine 20 (Small-inducible cytokine A20) (Macrophage inflammatory protein 3 alpha) (MIP-3-alpha) (Liver and activation-regulated chemokine) (CC chemokine LARC) (Beta chemokine exodus-1) ; _entity.formula_weight 8043.568 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM _entity_poly.pdbx_seq_one_letter_code_can ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 SER n 1 3 ASN n 1 4 PHE n 1 5 ASP n 1 6 CYS n 1 7 CYS n 1 8 LEU n 1 9 GLY n 1 10 TYR n 1 11 THR n 1 12 ASP n 1 13 ARG n 1 14 ILE n 1 15 LEU n 1 16 HIS n 1 17 PRO n 1 18 LYS n 1 19 PHE n 1 20 ILE n 1 21 VAL n 1 22 GLY n 1 23 PHE n 1 24 THR n 1 25 ARG n 1 26 GLN n 1 27 LEU n 1 28 ALA n 1 29 ASN n 1 30 GLU n 1 31 GLY n 1 32 CYS n 1 33 ASP n 1 34 ILE n 1 35 ASN n 1 36 ALA n 1 37 ILE n 1 38 ILE n 1 39 PHE n 1 40 HIS n 1 41 THR n 1 42 LYS n 1 43 LYS n 1 44 LYS n 1 45 LEU n 1 46 SER n 1 47 VAL n 1 48 CYS n 1 49 ALA n 1 50 ASN n 1 51 PRO n 1 52 LYS n 1 53 GLN n 1 54 THR n 1 55 TRP n 1 56 VAL n 1 57 LYS n 1 58 TYR n 1 59 ILE n 1 60 VAL n 1 61 ARG n 1 62 LEU n 1 63 LEU n 1 64 SER n 1 65 LYS n 1 66 LYS n 1 67 VAL n 1 68 LYS n 1 69 ASN n 1 70 MET n # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CCL20_HUMAN _struct_ref.pdbx_db_accession P78556 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM _struct_ref.pdbx_align_begin 27 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2JYO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 70 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P78556 _struct_ref_seq.db_align_beg 27 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 96 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 70 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-1H NOESY' 1 2 1 '2D 1H-1H TOCSY' 1 3 1 '2D DQF-COSY' 1 4 2 '2D 1H-1H NOESY' 1 5 2 '2D 1H-1H TOCSY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 4.2 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '0.9 mM Protein, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '0.9 mM Protein, 100% D2O' 2 '100% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 700 Bruker AVANCE 1 'Bruker Avance' 500 Bruker AVANCE 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2JYO _pdbx_nmr_refine.method 'DGSA-distance geometry simulated annealing' _pdbx_nmr_refine.details ;In total, 2362 restraints were used: 1827 unambiguous NOE restraints, 455 ambiguous restraints, 64 broad dihedral restraints and 16 hydrogen bonding restraints. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2JYO _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2JYO _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Linge, J.P. et al.' 'structure solution' ARIA ? 1 'Brunger, A.T. et al.' refinement CNS 1.1 2 'Johnson, B. et al.' 'data analysis' NMRView 5.0.4 3 'Bruker Biospin' collection XwinNMR '3.0, 3.5' 4 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2JYO _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2JYO _struct.title 'NMR Solution structure of Human MIP-3alpha/CCL20' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2JYO _struct_keywords.pdbx_keywords CYTOKINE _struct_keywords.text ;Protein, Chemokine, Cytokine, Alternative splicing, Antibiotic, Antimicrobial, Chemotaxis, Inflammatory response, Polymorphism, Secreted ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id GLN _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 53 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LYS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 65 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLN _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 53 _struct_conf.end_auth_comp_id LYS _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 65 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 32 SG ? ? A CYS 6 A CYS 32 1_555 ? ? ? ? ? ? ? 2.025 ? ? disulf2 disulf ? ? A CYS 7 SG ? ? ? 1_555 A CYS 48 SG ? ? A CYS 7 A CYS 48 1_555 ? ? ? ? ? ? ? 2.024 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 20 ? GLN A 26 ? ILE A 20 GLN A 26 A 2 ALA A 36 ? THR A 41 ? ALA A 36 THR A 41 A 3 SER A 46 ? ALA A 49 ? SER A 46 ALA A 49 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N THR A 24 ? N THR A 24 O ILE A 38 ? O ILE A 38 A 2 3 N PHE A 39 ? N PHE A 39 O VAL A 47 ? O VAL A 47 # _atom_sites.entry_id 2JYO _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 CYS 7 7 7 CYS CYS A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 TYR 10 10 10 TYR TYR A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 HIS 16 16 16 HIS HIS A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 CYS 32 32 32 CYS CYS A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 PHE 39 39 39 PHE PHE A . n A 1 40 HIS 40 40 40 HIS HIS A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 CYS 48 48 48 CYS CYS A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 TRP 55 55 55 TRP TRP A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 TYR 58 58 58 TYR TYR A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 ASN 69 69 69 ASN ASN A . n A 1 70 MET 70 70 70 MET MET A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-01-01 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-19 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Derived calculations' 4 3 'Structure model' Other 5 4 'Structure model' 'Database references' 6 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' pdbx_database_status 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_software.name' 3 3 'Structure model' '_pdbx_nmr_spectrometer.model' 4 4 'Structure model' '_database_2.pdbx_DOI' 5 4 'Structure model' '_database_2.pdbx_database_accession' 6 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id Protein 0.9 mM ? 1 Protein 0.9 mM ? 2 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 HD1 A HIS 16 ? ? HD2 A LYS 18 ? ? 1.12 2 2 HZ2 A LYS 68 ? ? OXT A MET 70 ? ? 1.58 3 6 HD1 A HIS 16 ? ? HD2 A LYS 18 ? ? 1.20 4 7 HD1 A HIS 16 ? ? HD2 A LYS 18 ? ? 1.21 5 7 HB A ILE 37 ? ? HB3 A ALA 49 ? ? 1.28 6 8 HZ A PHE 4 ? ? H A LEU 27 ? ? 1.32 7 9 HZ3 A LYS 68 ? ? O A MET 70 ? ? 1.59 8 13 HZ A PHE 4 ? ? H A LEU 27 ? ? 1.23 9 14 HD1 A HIS 16 ? ? HD2 A LYS 18 ? ? 1.22 10 15 HD21 A ASN 3 ? ? HD1 A PHE 4 ? ? 1.21 11 15 OD1 A ASP 12 ? ? HZ3 A LYS 52 ? ? 1.57 12 16 HB2 A TYR 10 ? ? HD21 A ASN 50 ? ? 1.26 13 17 HD1 A HIS 16 ? ? HD2 A LYS 18 ? ? 1.16 14 19 HD1 A HIS 16 ? ? HD3 A LYS 18 ? ? 1.33 15 20 HD1 A HIS 16 ? ? HD2 A LYS 18 ? ? 1.07 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 10 ? ? -79.92 -167.49 2 2 CYS A 6 ? ? -46.37 150.80 3 2 ASP A 12 ? ? -118.54 74.23 4 3 ASP A 12 ? ? -108.02 68.90 5 3 ALA A 28 ? ? -83.58 35.03 6 3 ASN A 29 ? ? -132.73 -52.62 7 3 PRO A 51 ? ? -72.01 21.33 8 4 ASP A 5 ? ? -112.03 -104.44 9 4 TYR A 10 ? ? -100.58 -160.12 10 4 ASP A 12 ? ? -118.55 69.23 11 4 ASN A 29 ? ? -100.26 -64.61 12 4 PRO A 51 ? ? -57.33 -8.19 13 4 SER A 64 ? ? -108.35 -63.38 14 4 LYS A 65 ? ? -101.72 78.33 15 4 ASN A 69 ? ? -112.65 -80.97 16 5 ASP A 12 ? ? -147.27 14.19 17 5 CYS A 32 ? ? -120.06 -153.69 18 6 ASN A 69 ? ? -132.01 -82.95 19 7 ASP A 12 ? ? -95.19 59.53 20 7 ALA A 28 ? ? -78.04 32.82 21 7 PRO A 51 ? ? -89.76 39.16 22 7 LYS A 52 ? ? -131.97 -80.79 23 7 SER A 64 ? ? -96.23 52.43 24 7 LYS A 65 ? ? -56.18 103.27 25 7 ASN A 69 ? ? -130.92 -51.62 26 8 CYS A 6 ? ? -36.35 142.09 27 8 THR A 11 ? ? -107.38 -166.26 28 8 ASP A 12 ? ? -160.22 81.42 29 9 ASN A 3 ? ? -74.46 -72.14 30 9 PHE A 4 ? ? -130.77 -42.85 31 9 ASP A 5 ? ? -141.05 -34.91 32 9 LEU A 8 ? ? -77.34 25.70 33 9 ALA A 28 ? ? -77.83 46.84 34 9 PRO A 51 ? ? -88.91 32.16 35 9 LYS A 52 ? ? -132.25 -61.43 36 10 CYS A 6 ? ? -38.60 142.31 37 10 ASP A 12 ? ? -144.83 23.37 38 10 ILE A 14 ? ? -117.71 77.69 39 11 CYS A 6 ? ? -60.43 -179.85 40 11 ASP A 12 ? ? -141.23 16.57 41 12 CYS A 6 ? ? -38.08 150.84 42 12 ASP A 12 ? ? -101.97 56.65 43 12 PRO A 51 ? ? -73.20 23.47 44 13 CYS A 6 ? ? -35.62 142.55 45 13 LEU A 8 ? ? -81.93 45.34 46 13 ASP A 12 ? ? -144.78 31.18 47 13 LYS A 66 ? ? -68.77 97.89 48 14 ASP A 5 ? ? -128.79 -93.10 49 14 ASN A 29 ? ? -99.41 -73.42 50 14 LYS A 65 ? ? -60.12 86.67 51 15 CYS A 6 ? ? -58.36 174.65 52 15 CYS A 7 ? ? -41.26 98.60 53 15 ASP A 12 ? ? -104.58 74.57 54 15 ILE A 34 ? ? -95.75 -156.58 55 15 LYS A 65 ? ? -105.20 54.41 56 15 LYS A 66 ? ? -58.22 108.58 57 15 ASN A 69 ? ? -96.07 -65.23 58 16 CYS A 6 ? ? -37.48 146.43 59 16 ASN A 29 ? ? -127.25 -53.90 60 16 GLU A 30 ? ? -83.82 36.38 61 17 ASP A 12 ? ? -147.60 17.38 62 17 ASN A 29 ? ? -135.42 -66.13 63 17 GLU A 30 ? ? -105.90 51.48 64 17 ILE A 34 ? ? -105.55 -152.61 65 17 LYS A 44 ? ? 77.87 -20.92 66 17 PRO A 51 ? ? -69.24 14.52 67 18 ASP A 5 ? ? -114.29 -99.42 68 18 CYS A 6 ? ? -142.26 -142.71 69 18 TYR A 10 ? ? -119.39 -168.56 70 18 ASP A 12 ? ? -107.15 62.69 71 18 ASN A 29 ? ? -126.83 -58.33 72 18 LYS A 44 ? ? 76.53 -24.17 73 19 TYR A 10 ? ? -107.07 -163.12 74 19 ASP A 12 ? ? -116.60 73.51 75 19 LYS A 44 ? ? 78.64 -1.31 76 19 PRO A 51 ? ? -69.79 6.55 77 19 SER A 64 ? ? -94.08 57.90 78 19 LYS A 66 ? ? -82.14 37.62 79 20 ASP A 12 ? ? -150.30 72.63 80 20 ASN A 29 ? ? -127.23 -64.42 81 20 LYS A 44 ? ? 75.17 -21.44 82 20 PRO A 51 ? ? -64.75 3.18 83 20 SER A 64 ? ? -90.03 -63.03 84 20 LYS A 68 ? ? -139.24 -63.45 #