data_2JYT # _entry.id 2JYT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2JYT pdb_00002jyt 10.2210/pdb2jyt/pdb RCSB RCSB100460 ? ? WWPDB D_1000100460 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-04-22 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 4 'Structure model' 1 3 2024-10-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_ref_seq_dif 7 4 'Structure model' chem_comp_atom 8 4 'Structure model' chem_comp_bond 9 4 'Structure model' pdbx_entry_details 10 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2JYT _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2007-12-19 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.content_type 1QGM PDB 'Carp granulin-1 fragment' unspecified 1G26 PDB 'Human granulin A fragment' unspecified 1FWO PDB 'Oryzain beta fragment' unspecified 2JYE PDB . unspecified 2JYU PDB . unspecified 2JYV PDB . unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tolkatchev, D.' 1 'Wang, P.' 2 'Chen, Z.' 3 'Xu, P.' 4 'Ni, F.' 5 # _citation.id primary _citation.title 'Structure dissection of human progranulin identifies well-folded granulin/epithelin modules with unique functional activities.' _citation.journal_abbrev 'Protein Sci.' _citation.journal_volume 17 _citation.page_first 711 _citation.page_last 724 _citation.year 2008 _citation.journal_id_ASTM PRCIEI _citation.country US _citation.journal_id_ISSN 0961-8368 _citation.journal_id_CSD 0795 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18359860 _citation.pdbx_database_id_DOI 10.1110/ps.073295308 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tolkatchev, D.' 1 ? primary 'Malik, S.' 2 ? primary 'Vinogradova, A.' 3 ? primary 'Wang, P.' 4 ? primary 'Chen, Z.' 5 ? primary 'Xu, P.' 6 ? primary 'Bennett, H.P.' 7 ? primary 'Bateman, A.' 8 ? primary 'Ni, F.' 9 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Granulin-5 _entity.formula_weight 7402.308 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Granulin C' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code AMVPCDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTCVAEGQCQKLAAALEHHHHHH _entity_poly.pdbx_seq_one_letter_code_can AMVPCDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTCVAEGQCQKLAAALEHHHHHH _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 MET n 1 3 VAL n 1 4 PRO n 1 5 CYS n 1 6 ASP n 1 7 ASN n 1 8 VAL n 1 9 SER n 1 10 SER n 1 11 CYS n 1 12 PRO n 1 13 SER n 1 14 SER n 1 15 ASP n 1 16 THR n 1 17 CYS n 1 18 CYS n 1 19 GLN n 1 20 LEU n 1 21 THR n 1 22 SER n 1 23 GLY n 1 24 GLU n 1 25 TRP n 1 26 GLY n 1 27 CYS n 1 28 CYS n 1 29 PRO n 1 30 ILE n 1 31 PRO n 1 32 GLU n 1 33 ALA n 1 34 VAL n 1 35 CYS n 1 36 CYS n 1 37 SER n 1 38 ASP n 1 39 HIS n 1 40 GLN n 1 41 HIS n 1 42 CYS n 1 43 CYS n 1 44 PRO n 1 45 GLN n 1 46 GLY n 1 47 TYR n 1 48 THR n 1 49 CYS n 1 50 VAL n 1 51 ALA n 1 52 GLU n 1 53 GLY n 1 54 GLN n 1 55 CYS n 1 56 GLN n 1 57 LYS n 1 58 LEU n 1 59 ALA n 1 60 ALA n 1 61 ALA n 1 62 LEU n 1 63 GLU n 1 64 HIS n 1 65 HIS n 1 66 HIS n 1 67 HIS n 1 68 HIS n 1 69 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene GRN _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'Origami(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET-32 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 -1 ? ? ? A . n A 1 2 MET 2 0 ? ? ? A . n A 1 3 VAL 3 1 1 VAL VAL A . n A 1 4 PRO 4 2 2 PRO PRO A . n A 1 5 CYS 5 3 3 CYS CYS A . n A 1 6 ASP 6 4 4 ASP ASP A . n A 1 7 ASN 7 5 5 ASN ASN A . n A 1 8 VAL 8 6 6 VAL VAL A . n A 1 9 SER 9 7 7 SER SER A . n A 1 10 SER 10 8 8 SER SER A . n A 1 11 CYS 11 9 9 CYS CYS A . n A 1 12 PRO 12 10 10 PRO PRO A . n A 1 13 SER 13 11 11 SER SER A . n A 1 14 SER 14 12 12 SER SER A . n A 1 15 ASP 15 13 13 ASP ASP A . n A 1 16 THR 16 14 14 THR THR A . n A 1 17 CYS 17 15 15 CYS CYS A . n A 1 18 CYS 18 16 16 CYS CYS A . n A 1 19 GLN 19 17 17 GLN GLN A . n A 1 20 LEU 20 18 18 LEU LEU A . n A 1 21 THR 21 19 19 THR THR A . n A 1 22 SER 22 20 20 SER SER A . n A 1 23 GLY 23 21 21 GLY GLY A . n A 1 24 GLU 24 22 22 GLU GLU A . n A 1 25 TRP 25 23 23 TRP TRP A . n A 1 26 GLY 26 24 24 GLY GLY A . n A 1 27 CYS 27 25 25 CYS CYS A . n A 1 28 CYS 28 26 26 CYS CYS A . n A 1 29 PRO 29 27 27 PRO PRO A . n A 1 30 ILE 30 28 28 ILE ILE A . n A 1 31 PRO 31 29 29 PRO PRO A . n A 1 32 GLU 32 30 30 GLU GLU A . n A 1 33 ALA 33 31 31 ALA ALA A . n A 1 34 VAL 34 32 32 VAL VAL A . n A 1 35 CYS 35 33 33 CYS CYS A . n A 1 36 CYS 36 34 34 CYS CYS A . n A 1 37 SER 37 35 35 SER SER A . n A 1 38 ASP 38 36 36 ASP ASP A . n A 1 39 HIS 39 37 37 HIS HIS A . n A 1 40 GLN 40 38 38 GLN GLN A . n A 1 41 HIS 41 39 39 HIS HIS A . n A 1 42 CYS 42 40 40 CYS CYS A . n A 1 43 CYS 43 41 41 CYS CYS A . n A 1 44 PRO 44 42 42 PRO PRO A . n A 1 45 GLN 45 43 43 GLN GLN A . n A 1 46 GLY 46 44 44 GLY GLY A . n A 1 47 TYR 47 45 45 TYR TYR A . n A 1 48 THR 48 46 46 THR THR A . n A 1 49 CYS 49 47 47 CYS CYS A . n A 1 50 VAL 50 48 48 VAL VAL A . n A 1 51 ALA 51 49 49 ALA ALA A . n A 1 52 GLU 52 50 50 GLU GLU A . n A 1 53 GLY 53 51 51 GLY GLY A . n A 1 54 GLN 54 52 52 GLN GLN A . n A 1 55 CYS 55 53 53 CYS CYS A . n A 1 56 GLN 56 54 54 GLN GLN A . n A 1 57 LYS 57 55 55 LYS LYS A . n A 1 58 LEU 58 56 ? ? ? A . n A 1 59 ALA 59 57 ? ? ? A . n A 1 60 ALA 60 58 ? ? ? A . n A 1 61 ALA 61 59 ? ? ? A . n A 1 62 LEU 62 60 ? ? ? A . n A 1 63 GLU 63 61 ? ? ? A . n A 1 64 HIS 64 62 ? ? ? A . n A 1 65 HIS 65 63 ? ? ? A . n A 1 66 HIS 66 64 ? ? ? A . n A 1 67 HIS 67 65 ? ? ? A . n A 1 68 HIS 68 66 ? ? ? A . n A 1 69 HIS 69 67 ? ? ? A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2JYT _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2JYT _struct.title 'Human Granulin C, isomer 1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2JYT _struct_keywords.pdbx_keywords CYTOKINE _struct_keywords.text 'Granulin C, epithelin, human, stack of hairpins, Alternative splicing, Cytokine, Glycoprotein, Polymorphism, Secreted' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code GRN_HUMAN _struct_ref.pdbx_db_accession P28799 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code VPCDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTCVAEGQCQ _struct_ref.pdbx_align_begin 364 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2JYT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 56 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P28799 _struct_ref_seq.db_align_beg 364 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 417 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 54 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2JYT ALA A 1 ? UNP P28799 ? ? 'expression tag' -1 1 1 2JYT MET A 2 ? UNP P28799 ? ? 'expression tag' 0 2 1 2JYT LYS A 57 ? UNP P28799 ? ? 'expression tag' 55 3 1 2JYT LEU A 58 ? UNP P28799 ? ? 'expression tag' 56 4 1 2JYT ALA A 59 ? UNP P28799 ? ? 'expression tag' 57 5 1 2JYT ALA A 60 ? UNP P28799 ? ? 'expression tag' 58 6 1 2JYT ALA A 61 ? UNP P28799 ? ? 'expression tag' 59 7 1 2JYT LEU A 62 ? UNP P28799 ? ? 'expression tag' 60 8 1 2JYT GLU A 63 ? UNP P28799 ? ? 'expression tag' 61 9 1 2JYT HIS A 64 ? UNP P28799 ? ? 'expression tag' 62 10 1 2JYT HIS A 65 ? UNP P28799 ? ? 'expression tag' 63 11 1 2JYT HIS A 66 ? UNP P28799 ? ? 'expression tag' 64 12 1 2JYT HIS A 67 ? UNP P28799 ? ? 'expression tag' 65 13 1 2JYT HIS A 68 ? UNP P28799 ? ? 'expression tag' 66 14 1 2JYT HIS A 69 ? UNP P28799 ? ? 'expression tag' 67 15 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 5 SG ? ? ? 1_555 A CYS 17 SG ? ? A CYS 3 A CYS 15 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf2 disulf ? ? A CYS 11 SG ? ? ? 1_555 A CYS 27 SG ? ? A CYS 9 A CYS 25 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf3 disulf ? ? A CYS 36 SG ? ? ? 1_555 A CYS 49 SG ? ? A CYS 34 A CYS 47 1_555 ? ? ? ? ? ? ? 2.031 ? ? disulf4 disulf ? ? A CYS 43 SG ? ? ? 1_555 A CYS 55 SG ? ? A CYS 41 A CYS 53 1_555 ? ? ? ? ? ? ? 2.032 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 5 ? CYS A 17 ? CYS A 3 ? 1_555 CYS A 15 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 11 ? CYS A 27 ? CYS A 9 ? 1_555 CYS A 25 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 36 ? CYS A 49 ? CYS A 34 ? 1_555 CYS A 47 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 CYS A 43 ? CYS A 55 ? CYS A 41 ? 1_555 CYS A 53 ? 1_555 SG SG . . . None 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 16 ? GLN A 19 ? THR A 14 GLN A 17 A 2 TRP A 25 ? CYS A 28 ? TRP A 23 CYS A 26 B 1 THR A 48 ? VAL A 50 ? THR A 46 VAL A 48 B 2 GLN A 54 ? GLN A 56 ? GLN A 52 GLN A 54 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N THR A 16 ? N THR A 14 O CYS A 28 ? O CYS A 26 B 1 2 N THR A 48 ? N THR A 46 O GLN A 56 ? O GLN A 54 # _pdbx_entry_details.entry_id 2JYT _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 3 ? ? -163.89 58.36 2 1 ASP A 4 ? ? 60.15 -175.29 3 1 SER A 11 ? ? 56.49 -167.64 4 1 LEU A 18 ? ? -80.49 -142.20 5 1 SER A 20 ? ? 64.33 118.57 6 1 PRO A 29 ? ? -96.49 39.94 7 1 GLU A 30 ? ? 54.62 78.17 8 1 ALA A 49 ? ? 59.33 12.47 9 2 PRO A 2 ? ? -61.04 -87.36 10 2 CYS A 3 ? ? 55.48 -160.13 11 2 ASP A 4 ? ? -81.40 -96.81 12 2 ASN A 5 ? ? -170.98 -36.46 13 2 SER A 8 ? ? -162.32 105.15 14 2 SER A 11 ? ? 56.58 -162.00 15 2 SER A 12 ? ? -91.45 56.40 16 2 LEU A 18 ? ? -80.78 -149.49 17 2 SER A 20 ? ? -174.76 109.41 18 2 PRO A 29 ? ? -96.21 41.21 19 2 GLU A 30 ? ? 60.34 86.41 20 2 SER A 35 ? ? -161.18 -65.26 21 2 ASP A 36 ? ? -97.05 -85.98 22 2 CYS A 40 ? ? -61.63 85.14 23 2 GLU A 50 ? ? 59.16 105.41 24 3 ASP A 4 ? ? 62.89 167.03 25 3 LEU A 18 ? ? -107.44 -166.40 26 3 THR A 19 ? ? -96.50 59.34 27 3 SER A 20 ? ? -168.64 -48.30 28 3 PRO A 27 ? ? -68.30 11.33 29 3 ILE A 28 ? ? 65.70 146.46 30 3 PRO A 29 ? ? -94.13 -142.18 31 3 GLU A 30 ? ? -65.34 87.75 32 3 CYS A 33 ? ? -171.62 132.33 33 3 SER A 35 ? ? 56.67 -159.25 34 3 HIS A 39 ? ? -168.80 100.74 35 3 ALA A 49 ? ? 56.02 16.33 36 4 ASP A 4 ? ? 55.36 -162.93 37 4 ASN A 5 ? ? -106.90 -105.03 38 4 VAL A 6 ? ? 60.41 -77.15 39 4 THR A 19 ? ? -88.50 49.14 40 4 SER A 20 ? ? -145.95 -49.72 41 4 GLU A 30 ? ? 66.65 -80.19 42 4 ALA A 31 ? ? 176.67 -174.80 43 4 SER A 35 ? ? 56.29 -96.39 44 4 GLN A 38 ? ? -147.95 -33.05 45 4 PRO A 42 ? ? -62.50 -161.64 46 5 CYS A 3 ? ? 57.06 -93.54 47 5 ASP A 4 ? ? -127.04 -69.60 48 5 ASN A 5 ? ? -171.44 -32.85 49 5 SER A 11 ? ? 55.04 -160.70 50 5 HIS A 37 ? ? -164.39 -142.62 51 5 GLN A 38 ? ? -82.57 42.87 52 5 HIS A 39 ? ? 54.28 -124.63 53 6 PRO A 2 ? ? -66.19 -132.14 54 6 CYS A 3 ? ? 59.92 87.40 55 6 ASP A 4 ? ? 54.64 -157.24 56 6 ASN A 5 ? ? -141.57 19.65 57 6 SER A 11 ? ? 48.65 -148.75 58 6 SER A 12 ? ? -62.54 85.22 59 6 ASP A 13 ? ? -166.83 114.26 60 6 LEU A 18 ? ? -92.60 -155.13 61 6 PRO A 27 ? ? -46.19 -82.20 62 6 ILE A 28 ? ? 179.51 136.25 63 6 GLU A 30 ? ? 56.20 82.61 64 6 HIS A 37 ? ? 63.80 -80.16 65 6 GLU A 50 ? ? 53.20 76.33 66 7 CYS A 3 ? ? -169.26 -149.28 67 7 SER A 11 ? ? 46.22 -152.03 68 7 SER A 12 ? ? -52.04 97.88 69 7 ASP A 13 ? ? -166.79 106.36 70 7 ILE A 28 ? ? 62.09 162.12 71 7 PRO A 29 ? ? -88.39 -139.13 72 7 GLU A 30 ? ? -66.33 80.68 73 7 SER A 35 ? ? 58.28 -96.51 74 7 GLN A 38 ? ? -66.46 86.71 75 7 HIS A 39 ? ? -170.26 93.86 76 7 GLU A 50 ? ? 54.61 79.97 77 8 CYS A 3 ? ? 58.33 -169.69 78 8 ASP A 4 ? ? 57.93 -178.04 79 8 ASN A 5 ? ? -168.85 -27.39 80 8 SER A 12 ? ? -62.86 80.55 81 8 ASP A 13 ? ? 179.58 160.15 82 8 GLU A 30 ? ? 58.44 -107.06 83 8 ALA A 31 ? ? 173.67 -174.88 84 8 ASP A 36 ? ? -162.80 -164.51 85 8 HIS A 37 ? ? -102.78 -153.18 86 8 GLN A 38 ? ? 60.24 -103.67 87 9 PRO A 2 ? ? -51.69 171.06 88 9 CYS A 3 ? ? -107.53 -162.34 89 9 ASP A 4 ? ? 60.77 -156.91 90 9 SER A 11 ? ? 59.38 -179.07 91 9 SER A 12 ? ? -65.24 89.61 92 9 ILE A 28 ? ? 44.10 109.96 93 9 PRO A 29 ? ? -95.34 57.51 94 9 GLU A 30 ? ? 58.26 92.48 95 9 SER A 35 ? ? 52.99 -158.16 96 9 ASP A 36 ? ? -72.40 -137.23 97 9 HIS A 37 ? ? 61.99 -91.77 98 9 HIS A 39 ? ? -121.56 -57.59 99 9 GLU A 50 ? ? 51.27 82.69 100 10 PRO A 2 ? ? -52.57 -72.69 101 10 CYS A 3 ? ? 53.12 -98.20 102 10 ASP A 4 ? ? -125.43 -158.09 103 10 PRO A 29 ? ? -85.94 37.77 104 10 HIS A 37 ? ? -103.13 -164.74 105 10 GLU A 50 ? ? 57.52 83.47 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 60 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2JYT _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2JYT _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '10 mM sodium phosphate, 150 mM sodium chloride, 0.2 mM EDTA, 0.5-1.0 mM HgrnC1, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '10 mM sodium phosphate, 150 mM sodium chloride, 0.2 mM EDTA, 0.5-1.0 mM HgrnC1, 100% D2O' 2 '100% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'sodium phosphate' 10 mM ? 1 'sodium chloride' 150 mM ? 1 EDTA 0.2 mM ? 1 HgrnC1 0.5 mM ? 1 'sodium phosphate' 10 mM ? 2 'sodium chloride' 150 mM ? 2 EDTA 0.2 mM ? 2 HgrnC1 0.5 mM ? 2 # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.temperature_units 1 ? 6.8 ambient atm 298 K 2 ? 6.8 ambient atm 288 K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-1H TOCSY' 1 2 1 '2D 1H-1H NOESY' 1 3 1 'inphase COSY' 1 4 2 '2D 1H-1H TOCSY' 1 5 2 '2D 1H-1H NOESY' 1 6 2 '2D 1H-13C HSQC' # _pdbx_nmr_refine.entry_id 2JYT _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal ;Linge, O'Donoghue and Nilges ; 'structure solution' ARIA 1.0 1 'Johnson, One Moon Scientific' 'chemical shift assignment' NMRView ? 2 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 3 Tripos 'data analysis' SYBYL ? 4 'Accelrys Software Inc.' 'data analysis' 'Insight II' ? 5 'Koradi, Billeter and Wuthrich' 'data analysis' MOLMOL ? 6 ;Linge, O'Donoghue and Nilges ; refinement ARIA 1.0 7 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA -1 ? A ALA 1 2 1 Y 1 A MET 0 ? A MET 2 3 1 Y 1 A LEU 56 ? A LEU 58 4 1 Y 1 A ALA 57 ? A ALA 59 5 1 Y 1 A ALA 58 ? A ALA 60 6 1 Y 1 A ALA 59 ? A ALA 61 7 1 Y 1 A LEU 60 ? A LEU 62 8 1 Y 1 A GLU 61 ? A GLU 63 9 1 Y 1 A HIS 62 ? A HIS 64 10 1 Y 1 A HIS 63 ? A HIS 65 11 1 Y 1 A HIS 64 ? A HIS 66 12 1 Y 1 A HIS 65 ? A HIS 67 13 1 Y 1 A HIS 66 ? A HIS 68 14 1 Y 1 A HIS 67 ? A HIS 69 15 2 Y 1 A ALA -1 ? A ALA 1 16 2 Y 1 A MET 0 ? A MET 2 17 2 Y 1 A LEU 56 ? A LEU 58 18 2 Y 1 A ALA 57 ? A ALA 59 19 2 Y 1 A ALA 58 ? A ALA 60 20 2 Y 1 A ALA 59 ? A ALA 61 21 2 Y 1 A LEU 60 ? A LEU 62 22 2 Y 1 A GLU 61 ? A GLU 63 23 2 Y 1 A HIS 62 ? A HIS 64 24 2 Y 1 A HIS 63 ? A HIS 65 25 2 Y 1 A HIS 64 ? A HIS 66 26 2 Y 1 A HIS 65 ? A HIS 67 27 2 Y 1 A HIS 66 ? A HIS 68 28 2 Y 1 A HIS 67 ? A HIS 69 29 3 Y 1 A ALA -1 ? A ALA 1 30 3 Y 1 A MET 0 ? A MET 2 31 3 Y 1 A LEU 56 ? A LEU 58 32 3 Y 1 A ALA 57 ? A ALA 59 33 3 Y 1 A ALA 58 ? A ALA 60 34 3 Y 1 A ALA 59 ? A ALA 61 35 3 Y 1 A LEU 60 ? A LEU 62 36 3 Y 1 A GLU 61 ? A GLU 63 37 3 Y 1 A HIS 62 ? A HIS 64 38 3 Y 1 A HIS 63 ? A HIS 65 39 3 Y 1 A HIS 64 ? A HIS 66 40 3 Y 1 A HIS 65 ? A HIS 67 41 3 Y 1 A HIS 66 ? A HIS 68 42 3 Y 1 A HIS 67 ? A HIS 69 43 4 Y 1 A ALA -1 ? A ALA 1 44 4 Y 1 A MET 0 ? A MET 2 45 4 Y 1 A LEU 56 ? A LEU 58 46 4 Y 1 A ALA 57 ? A ALA 59 47 4 Y 1 A ALA 58 ? A ALA 60 48 4 Y 1 A ALA 59 ? A ALA 61 49 4 Y 1 A LEU 60 ? A LEU 62 50 4 Y 1 A GLU 61 ? A GLU 63 51 4 Y 1 A HIS 62 ? A HIS 64 52 4 Y 1 A HIS 63 ? A HIS 65 53 4 Y 1 A HIS 64 ? A HIS 66 54 4 Y 1 A HIS 65 ? A HIS 67 55 4 Y 1 A HIS 66 ? A HIS 68 56 4 Y 1 A HIS 67 ? A HIS 69 57 5 Y 1 A ALA -1 ? A ALA 1 58 5 Y 1 A MET 0 ? A MET 2 59 5 Y 1 A LEU 56 ? A LEU 58 60 5 Y 1 A ALA 57 ? A ALA 59 61 5 Y 1 A ALA 58 ? A ALA 60 62 5 Y 1 A ALA 59 ? A ALA 61 63 5 Y 1 A LEU 60 ? A LEU 62 64 5 Y 1 A GLU 61 ? A GLU 63 65 5 Y 1 A HIS 62 ? A HIS 64 66 5 Y 1 A HIS 63 ? A HIS 65 67 5 Y 1 A HIS 64 ? A HIS 66 68 5 Y 1 A HIS 65 ? A HIS 67 69 5 Y 1 A HIS 66 ? A HIS 68 70 5 Y 1 A HIS 67 ? A HIS 69 71 6 Y 1 A ALA -1 ? A ALA 1 72 6 Y 1 A MET 0 ? A MET 2 73 6 Y 1 A LEU 56 ? A LEU 58 74 6 Y 1 A ALA 57 ? A ALA 59 75 6 Y 1 A ALA 58 ? A ALA 60 76 6 Y 1 A ALA 59 ? A ALA 61 77 6 Y 1 A LEU 60 ? A LEU 62 78 6 Y 1 A GLU 61 ? A GLU 63 79 6 Y 1 A HIS 62 ? A HIS 64 80 6 Y 1 A HIS 63 ? A HIS 65 81 6 Y 1 A HIS 64 ? A HIS 66 82 6 Y 1 A HIS 65 ? A HIS 67 83 6 Y 1 A HIS 66 ? A HIS 68 84 6 Y 1 A HIS 67 ? A HIS 69 85 7 Y 1 A ALA -1 ? A ALA 1 86 7 Y 1 A MET 0 ? A MET 2 87 7 Y 1 A LEU 56 ? A LEU 58 88 7 Y 1 A ALA 57 ? A ALA 59 89 7 Y 1 A ALA 58 ? A ALA 60 90 7 Y 1 A ALA 59 ? A ALA 61 91 7 Y 1 A LEU 60 ? A LEU 62 92 7 Y 1 A GLU 61 ? A GLU 63 93 7 Y 1 A HIS 62 ? A HIS 64 94 7 Y 1 A HIS 63 ? A HIS 65 95 7 Y 1 A HIS 64 ? A HIS 66 96 7 Y 1 A HIS 65 ? A HIS 67 97 7 Y 1 A HIS 66 ? A HIS 68 98 7 Y 1 A HIS 67 ? A HIS 69 99 8 Y 1 A ALA -1 ? A ALA 1 100 8 Y 1 A MET 0 ? A MET 2 101 8 Y 1 A LEU 56 ? A LEU 58 102 8 Y 1 A ALA 57 ? A ALA 59 103 8 Y 1 A ALA 58 ? A ALA 60 104 8 Y 1 A ALA 59 ? A ALA 61 105 8 Y 1 A LEU 60 ? A LEU 62 106 8 Y 1 A GLU 61 ? A GLU 63 107 8 Y 1 A HIS 62 ? A HIS 64 108 8 Y 1 A HIS 63 ? A HIS 65 109 8 Y 1 A HIS 64 ? A HIS 66 110 8 Y 1 A HIS 65 ? A HIS 67 111 8 Y 1 A HIS 66 ? A HIS 68 112 8 Y 1 A HIS 67 ? A HIS 69 113 9 Y 1 A ALA -1 ? A ALA 1 114 9 Y 1 A MET 0 ? A MET 2 115 9 Y 1 A LEU 56 ? A LEU 58 116 9 Y 1 A ALA 57 ? A ALA 59 117 9 Y 1 A ALA 58 ? A ALA 60 118 9 Y 1 A ALA 59 ? A ALA 61 119 9 Y 1 A LEU 60 ? A LEU 62 120 9 Y 1 A GLU 61 ? A GLU 63 121 9 Y 1 A HIS 62 ? A HIS 64 122 9 Y 1 A HIS 63 ? A HIS 65 123 9 Y 1 A HIS 64 ? A HIS 66 124 9 Y 1 A HIS 65 ? A HIS 67 125 9 Y 1 A HIS 66 ? A HIS 68 126 9 Y 1 A HIS 67 ? A HIS 69 127 10 Y 1 A ALA -1 ? A ALA 1 128 10 Y 1 A MET 0 ? A MET 2 129 10 Y 1 A LEU 56 ? A LEU 58 130 10 Y 1 A ALA 57 ? A ALA 59 131 10 Y 1 A ALA 58 ? A ALA 60 132 10 Y 1 A ALA 59 ? A ALA 61 133 10 Y 1 A LEU 60 ? A LEU 62 134 10 Y 1 A GLU 61 ? A GLU 63 135 10 Y 1 A HIS 62 ? A HIS 64 136 10 Y 1 A HIS 63 ? A HIS 65 137 10 Y 1 A HIS 64 ? A HIS 66 138 10 Y 1 A HIS 65 ? A HIS 67 139 10 Y 1 A HIS 66 ? A HIS 68 140 10 Y 1 A HIS 67 ? A HIS 69 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 CYS N N N N 47 CYS CA C N R 48 CYS C C N N 49 CYS O O N N 50 CYS CB C N N 51 CYS SG S N N 52 CYS OXT O N N 53 CYS H H N N 54 CYS H2 H N N 55 CYS HA H N N 56 CYS HB2 H N N 57 CYS HB3 H N N 58 CYS HG H N N 59 CYS HXT H N N 60 GLN N N N N 61 GLN CA C N S 62 GLN C C N N 63 GLN O O N N 64 GLN CB C N N 65 GLN CG C N N 66 GLN CD C N N 67 GLN OE1 O N N 68 GLN NE2 N N N 69 GLN OXT O N N 70 GLN H H N N 71 GLN H2 H N N 72 GLN HA H N N 73 GLN HB2 H N N 74 GLN HB3 H N N 75 GLN HG2 H N N 76 GLN HG3 H N N 77 GLN HE21 H N N 78 GLN HE22 H N N 79 GLN HXT H N N 80 GLU N N N N 81 GLU CA C N S 82 GLU C C N N 83 GLU O O N N 84 GLU CB C N N 85 GLU CG C N N 86 GLU CD C N N 87 GLU OE1 O N N 88 GLU OE2 O N N 89 GLU OXT O N N 90 GLU H H N N 91 GLU H2 H N N 92 GLU HA H N N 93 GLU HB2 H N N 94 GLU HB3 H N N 95 GLU HG2 H N N 96 GLU HG3 H N N 97 GLU HE2 H N N 98 GLU HXT H N N 99 GLY N N N N 100 GLY CA C N N 101 GLY C C N N 102 GLY O O N N 103 GLY OXT O N N 104 GLY H H N N 105 GLY H2 H N N 106 GLY HA2 H N N 107 GLY HA3 H N N 108 GLY HXT H N N 109 HIS N N N N 110 HIS CA C N S 111 HIS C C N N 112 HIS O O N N 113 HIS CB C N N 114 HIS CG C Y N 115 HIS ND1 N Y N 116 HIS CD2 C Y N 117 HIS CE1 C Y N 118 HIS NE2 N Y N 119 HIS OXT O N N 120 HIS H H N N 121 HIS H2 H N N 122 HIS HA H N N 123 HIS HB2 H N N 124 HIS HB3 H N N 125 HIS HD1 H N N 126 HIS HD2 H N N 127 HIS HE1 H N N 128 HIS HE2 H N N 129 HIS HXT H N N 130 ILE N N N N 131 ILE CA C N S 132 ILE C C N N 133 ILE O O N N 134 ILE CB C N S 135 ILE CG1 C N N 136 ILE CG2 C N N 137 ILE CD1 C N N 138 ILE OXT O N N 139 ILE H H N N 140 ILE H2 H N N 141 ILE HA H N N 142 ILE HB H N N 143 ILE HG12 H N N 144 ILE HG13 H N N 145 ILE HG21 H N N 146 ILE HG22 H N N 147 ILE HG23 H N N 148 ILE HD11 H N N 149 ILE HD12 H N N 150 ILE HD13 H N N 151 ILE HXT H N N 152 LEU N N N N 153 LEU CA C N S 154 LEU C C N N 155 LEU O O N N 156 LEU CB C N N 157 LEU CG C N N 158 LEU CD1 C N N 159 LEU CD2 C N N 160 LEU OXT O N N 161 LEU H H N N 162 LEU H2 H N N 163 LEU HA H N N 164 LEU HB2 H N N 165 LEU HB3 H N N 166 LEU HG H N N 167 LEU HD11 H N N 168 LEU HD12 H N N 169 LEU HD13 H N N 170 LEU HD21 H N N 171 LEU HD22 H N N 172 LEU HD23 H N N 173 LEU HXT H N N 174 LYS N N N N 175 LYS CA C N S 176 LYS C C N N 177 LYS O O N N 178 LYS CB C N N 179 LYS CG C N N 180 LYS CD C N N 181 LYS CE C N N 182 LYS NZ N N N 183 LYS OXT O N N 184 LYS H H N N 185 LYS H2 H N N 186 LYS HA H N N 187 LYS HB2 H N N 188 LYS HB3 H N N 189 LYS HG2 H N N 190 LYS HG3 H N N 191 LYS HD2 H N N 192 LYS HD3 H N N 193 LYS HE2 H N N 194 LYS HE3 H N N 195 LYS HZ1 H N N 196 LYS HZ2 H N N 197 LYS HZ3 H N N 198 LYS HXT H N N 199 MET N N N N 200 MET CA C N S 201 MET C C N N 202 MET O O N N 203 MET CB C N N 204 MET CG C N N 205 MET SD S N N 206 MET CE C N N 207 MET OXT O N N 208 MET H H N N 209 MET H2 H N N 210 MET HA H N N 211 MET HB2 H N N 212 MET HB3 H N N 213 MET HG2 H N N 214 MET HG3 H N N 215 MET HE1 H N N 216 MET HE2 H N N 217 MET HE3 H N N 218 MET HXT H N N 219 PRO N N N N 220 PRO CA C N S 221 PRO C C N N 222 PRO O O N N 223 PRO CB C N N 224 PRO CG C N N 225 PRO CD C N N 226 PRO OXT O N N 227 PRO H H N N 228 PRO HA H N N 229 PRO HB2 H N N 230 PRO HB3 H N N 231 PRO HG2 H N N 232 PRO HG3 H N N 233 PRO HD2 H N N 234 PRO HD3 H N N 235 PRO HXT H N N 236 SER N N N N 237 SER CA C N S 238 SER C C N N 239 SER O O N N 240 SER CB C N N 241 SER OG O N N 242 SER OXT O N N 243 SER H H N N 244 SER H2 H N N 245 SER HA H N N 246 SER HB2 H N N 247 SER HB3 H N N 248 SER HG H N N 249 SER HXT H N N 250 THR N N N N 251 THR CA C N S 252 THR C C N N 253 THR O O N N 254 THR CB C N R 255 THR OG1 O N N 256 THR CG2 C N N 257 THR OXT O N N 258 THR H H N N 259 THR H2 H N N 260 THR HA H N N 261 THR HB H N N 262 THR HG1 H N N 263 THR HG21 H N N 264 THR HG22 H N N 265 THR HG23 H N N 266 THR HXT H N N 267 TRP N N N N 268 TRP CA C N S 269 TRP C C N N 270 TRP O O N N 271 TRP CB C N N 272 TRP CG C Y N 273 TRP CD1 C Y N 274 TRP CD2 C Y N 275 TRP NE1 N Y N 276 TRP CE2 C Y N 277 TRP CE3 C Y N 278 TRP CZ2 C Y N 279 TRP CZ3 C Y N 280 TRP CH2 C Y N 281 TRP OXT O N N 282 TRP H H N N 283 TRP H2 H N N 284 TRP HA H N N 285 TRP HB2 H N N 286 TRP HB3 H N N 287 TRP HD1 H N N 288 TRP HE1 H N N 289 TRP HE3 H N N 290 TRP HZ2 H N N 291 TRP HZ3 H N N 292 TRP HH2 H N N 293 TRP HXT H N N 294 TYR N N N N 295 TYR CA C N S 296 TYR C C N N 297 TYR O O N N 298 TYR CB C N N 299 TYR CG C Y N 300 TYR CD1 C Y N 301 TYR CD2 C Y N 302 TYR CE1 C Y N 303 TYR CE2 C Y N 304 TYR CZ C Y N 305 TYR OH O N N 306 TYR OXT O N N 307 TYR H H N N 308 TYR H2 H N N 309 TYR HA H N N 310 TYR HB2 H N N 311 TYR HB3 H N N 312 TYR HD1 H N N 313 TYR HD2 H N N 314 TYR HE1 H N N 315 TYR HE2 H N N 316 TYR HH H N N 317 TYR HXT H N N 318 VAL N N N N 319 VAL CA C N S 320 VAL C C N N 321 VAL O O N N 322 VAL CB C N N 323 VAL CG1 C N N 324 VAL CG2 C N N 325 VAL OXT O N N 326 VAL H H N N 327 VAL H2 H N N 328 VAL HA H N N 329 VAL HB H N N 330 VAL HG11 H N N 331 VAL HG12 H N N 332 VAL HG13 H N N 333 VAL HG21 H N N 334 VAL HG22 H N N 335 VAL HG23 H N N 336 VAL HXT H N N 337 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 CYS N CA sing N N 44 CYS N H sing N N 45 CYS N H2 sing N N 46 CYS CA C sing N N 47 CYS CA CB sing N N 48 CYS CA HA sing N N 49 CYS C O doub N N 50 CYS C OXT sing N N 51 CYS CB SG sing N N 52 CYS CB HB2 sing N N 53 CYS CB HB3 sing N N 54 CYS SG HG sing N N 55 CYS OXT HXT sing N N 56 GLN N CA sing N N 57 GLN N H sing N N 58 GLN N H2 sing N N 59 GLN CA C sing N N 60 GLN CA CB sing N N 61 GLN CA HA sing N N 62 GLN C O doub N N 63 GLN C OXT sing N N 64 GLN CB CG sing N N 65 GLN CB HB2 sing N N 66 GLN CB HB3 sing N N 67 GLN CG CD sing N N 68 GLN CG HG2 sing N N 69 GLN CG HG3 sing N N 70 GLN CD OE1 doub N N 71 GLN CD NE2 sing N N 72 GLN NE2 HE21 sing N N 73 GLN NE2 HE22 sing N N 74 GLN OXT HXT sing N N 75 GLU N CA sing N N 76 GLU N H sing N N 77 GLU N H2 sing N N 78 GLU CA C sing N N 79 GLU CA CB sing N N 80 GLU CA HA sing N N 81 GLU C O doub N N 82 GLU C OXT sing N N 83 GLU CB CG sing N N 84 GLU CB HB2 sing N N 85 GLU CB HB3 sing N N 86 GLU CG CD sing N N 87 GLU CG HG2 sing N N 88 GLU CG HG3 sing N N 89 GLU CD OE1 doub N N 90 GLU CD OE2 sing N N 91 GLU OE2 HE2 sing N N 92 GLU OXT HXT sing N N 93 GLY N CA sing N N 94 GLY N H sing N N 95 GLY N H2 sing N N 96 GLY CA C sing N N 97 GLY CA HA2 sing N N 98 GLY CA HA3 sing N N 99 GLY C O doub N N 100 GLY C OXT sing N N 101 GLY OXT HXT sing N N 102 HIS N CA sing N N 103 HIS N H sing N N 104 HIS N H2 sing N N 105 HIS CA C sing N N 106 HIS CA CB sing N N 107 HIS CA HA sing N N 108 HIS C O doub N N 109 HIS C OXT sing N N 110 HIS CB CG sing N N 111 HIS CB HB2 sing N N 112 HIS CB HB3 sing N N 113 HIS CG ND1 sing Y N 114 HIS CG CD2 doub Y N 115 HIS ND1 CE1 doub Y N 116 HIS ND1 HD1 sing N N 117 HIS CD2 NE2 sing Y N 118 HIS CD2 HD2 sing N N 119 HIS CE1 NE2 sing Y N 120 HIS CE1 HE1 sing N N 121 HIS NE2 HE2 sing N N 122 HIS OXT HXT sing N N 123 ILE N CA sing N N 124 ILE N H sing N N 125 ILE N H2 sing N N 126 ILE CA C sing N N 127 ILE CA CB sing N N 128 ILE CA HA sing N N 129 ILE C O doub N N 130 ILE C OXT sing N N 131 ILE CB CG1 sing N N 132 ILE CB CG2 sing N N 133 ILE CB HB sing N N 134 ILE CG1 CD1 sing N N 135 ILE CG1 HG12 sing N N 136 ILE CG1 HG13 sing N N 137 ILE CG2 HG21 sing N N 138 ILE CG2 HG22 sing N N 139 ILE CG2 HG23 sing N N 140 ILE CD1 HD11 sing N N 141 ILE CD1 HD12 sing N N 142 ILE CD1 HD13 sing N N 143 ILE OXT HXT sing N N 144 LEU N CA sing N N 145 LEU N H sing N N 146 LEU N H2 sing N N 147 LEU CA C sing N N 148 LEU CA CB sing N N 149 LEU CA HA sing N N 150 LEU C O doub N N 151 LEU C OXT sing N N 152 LEU CB CG sing N N 153 LEU CB HB2 sing N N 154 LEU CB HB3 sing N N 155 LEU CG CD1 sing N N 156 LEU CG CD2 sing N N 157 LEU CG HG sing N N 158 LEU CD1 HD11 sing N N 159 LEU CD1 HD12 sing N N 160 LEU CD1 HD13 sing N N 161 LEU CD2 HD21 sing N N 162 LEU CD2 HD22 sing N N 163 LEU CD2 HD23 sing N N 164 LEU OXT HXT sing N N 165 LYS N CA sing N N 166 LYS N H sing N N 167 LYS N H2 sing N N 168 LYS CA C sing N N 169 LYS CA CB sing N N 170 LYS CA HA sing N N 171 LYS C O doub N N 172 LYS C OXT sing N N 173 LYS CB CG sing N N 174 LYS CB HB2 sing N N 175 LYS CB HB3 sing N N 176 LYS CG CD sing N N 177 LYS CG HG2 sing N N 178 LYS CG HG3 sing N N 179 LYS CD CE sing N N 180 LYS CD HD2 sing N N 181 LYS CD HD3 sing N N 182 LYS CE NZ sing N N 183 LYS CE HE2 sing N N 184 LYS CE HE3 sing N N 185 LYS NZ HZ1 sing N N 186 LYS NZ HZ2 sing N N 187 LYS NZ HZ3 sing N N 188 LYS OXT HXT sing N N 189 MET N CA sing N N 190 MET N H sing N N 191 MET N H2 sing N N 192 MET CA C sing N N 193 MET CA CB sing N N 194 MET CA HA sing N N 195 MET C O doub N N 196 MET C OXT sing N N 197 MET CB CG sing N N 198 MET CB HB2 sing N N 199 MET CB HB3 sing N N 200 MET CG SD sing N N 201 MET CG HG2 sing N N 202 MET CG HG3 sing N N 203 MET SD CE sing N N 204 MET CE HE1 sing N N 205 MET CE HE2 sing N N 206 MET CE HE3 sing N N 207 MET OXT HXT sing N N 208 PRO N CA sing N N 209 PRO N CD sing N N 210 PRO N H sing N N 211 PRO CA C sing N N 212 PRO CA CB sing N N 213 PRO CA HA sing N N 214 PRO C O doub N N 215 PRO C OXT sing N N 216 PRO CB CG sing N N 217 PRO CB HB2 sing N N 218 PRO CB HB3 sing N N 219 PRO CG CD sing N N 220 PRO CG HG2 sing N N 221 PRO CG HG3 sing N N 222 PRO CD HD2 sing N N 223 PRO CD HD3 sing N N 224 PRO OXT HXT sing N N 225 SER N CA sing N N 226 SER N H sing N N 227 SER N H2 sing N N 228 SER CA C sing N N 229 SER CA CB sing N N 230 SER CA HA sing N N 231 SER C O doub N N 232 SER C OXT sing N N 233 SER CB OG sing N N 234 SER CB HB2 sing N N 235 SER CB HB3 sing N N 236 SER OG HG sing N N 237 SER OXT HXT sing N N 238 THR N CA sing N N 239 THR N H sing N N 240 THR N H2 sing N N 241 THR CA C sing N N 242 THR CA CB sing N N 243 THR CA HA sing N N 244 THR C O doub N N 245 THR C OXT sing N N 246 THR CB OG1 sing N N 247 THR CB CG2 sing N N 248 THR CB HB sing N N 249 THR OG1 HG1 sing N N 250 THR CG2 HG21 sing N N 251 THR CG2 HG22 sing N N 252 THR CG2 HG23 sing N N 253 THR OXT HXT sing N N 254 TRP N CA sing N N 255 TRP N H sing N N 256 TRP N H2 sing N N 257 TRP CA C sing N N 258 TRP CA CB sing N N 259 TRP CA HA sing N N 260 TRP C O doub N N 261 TRP C OXT sing N N 262 TRP CB CG sing N N 263 TRP CB HB2 sing N N 264 TRP CB HB3 sing N N 265 TRP CG CD1 doub Y N 266 TRP CG CD2 sing Y N 267 TRP CD1 NE1 sing Y N 268 TRP CD1 HD1 sing N N 269 TRP CD2 CE2 doub Y N 270 TRP CD2 CE3 sing Y N 271 TRP NE1 CE2 sing Y N 272 TRP NE1 HE1 sing N N 273 TRP CE2 CZ2 sing Y N 274 TRP CE3 CZ3 doub Y N 275 TRP CE3 HE3 sing N N 276 TRP CZ2 CH2 doub Y N 277 TRP CZ2 HZ2 sing N N 278 TRP CZ3 CH2 sing Y N 279 TRP CZ3 HZ3 sing N N 280 TRP CH2 HH2 sing N N 281 TRP OXT HXT sing N N 282 TYR N CA sing N N 283 TYR N H sing N N 284 TYR N H2 sing N N 285 TYR CA C sing N N 286 TYR CA CB sing N N 287 TYR CA HA sing N N 288 TYR C O doub N N 289 TYR C OXT sing N N 290 TYR CB CG sing N N 291 TYR CB HB2 sing N N 292 TYR CB HB3 sing N N 293 TYR CG CD1 doub Y N 294 TYR CG CD2 sing Y N 295 TYR CD1 CE1 sing Y N 296 TYR CD1 HD1 sing N N 297 TYR CD2 CE2 doub Y N 298 TYR CD2 HD2 sing N N 299 TYR CE1 CZ doub Y N 300 TYR CE1 HE1 sing N N 301 TYR CE2 CZ sing Y N 302 TYR CE2 HE2 sing N N 303 TYR CZ OH sing N N 304 TYR OH HH sing N N 305 TYR OXT HXT sing N N 306 VAL N CA sing N N 307 VAL N H sing N N 308 VAL N H2 sing N N 309 VAL CA C sing N N 310 VAL CA CB sing N N 311 VAL CA HA sing N N 312 VAL C O doub N N 313 VAL C OXT sing N N 314 VAL CB CG1 sing N N 315 VAL CB CG2 sing N N 316 VAL CB HB sing N N 317 VAL CG1 HG11 sing N N 318 VAL CG1 HG12 sing N N 319 VAL CG1 HG13 sing N N 320 VAL CG2 HG21 sing N N 321 VAL CG2 HG22 sing N N 322 VAL CG2 HG23 sing N N 323 VAL OXT HXT sing N N 324 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Bruker AVANCE 1 'Bruker Avance' 500 Bruker AVANCE 2 'Bruker Avance' # _atom_sites.entry_id 2JYT _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_