data_2K13 # _entry.id 2K13 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2K13 pdb_00002k13 10.2210/pdb2k13/pdb RCSB RCSB100542 ? ? WWPDB D_1000100542 ? ? # _pdbx_database_related.db_id 4973 _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'resonance line assignment of saratin' _pdbx_database_related.content_type unspecified # _pdbx_database_status.entry_id 2K13 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.deposit_site BMRB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2008-02-20 _pdbx_database_status.SG_entry N _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Gronwald, W.' 1 'Bomke, J.' 2 'Maurer, T.' 3 'Wisotzki, B.' 4 'Huber, F.' 5 'Schumann, F.' 6 'Kremer, W.' 7 'Frech, M.' 8 'Kalbitzer, H.R.' 9 # _citation.id primary _citation.title 'Structure of the leech protein saratin and characterization of its binding to collagen' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 381 _citation.page_first 913 _citation.page_last 927 _citation.year 2008 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18585393 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2008.06.034 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gronwald, W.' 1 ? primary 'Bomke, J.' 2 ? primary 'Maurer, T.' 3 ? primary 'Domogalla, B.' 4 ? primary 'Huber, F.' 5 ? primary 'Schumann, F.' 6 ? primary 'Kremer, W.' 7 ? primary 'Fink, F.' 8 ? primary 'Rysiok, T.' 9 ? primary 'Frech, M.' 10 ? primary 'Kalbitzer, H.R.' 11 ? # _entity.id 1 _entity.type polymer _entity.src_method nat _entity.pdbx_description Saratin _entity.formula_weight 12079.843 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;EEREDCWTFYANRKYTDFDKSFKKSSDLDECKKTCFKTEYCYIVFEDTVNKECYYNVVDGEELDQEKFVVDENFTENYLT DCEGKDAGNAAGTGDESDEVDED ; _entity_poly.pdbx_seq_one_letter_code_can ;EEREDCWTFYANRKYTDFDKSFKKSSDLDECKKTCFKTEYCYIVFEDTVNKECYYNVVDGEELDQEKFVVDENFTENYLT DCEGKDAGNAAGTGDESDEVDED ; _entity_poly.pdbx_strand_id X _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 GLU n 1 3 ARG n 1 4 GLU n 1 5 ASP n 1 6 CYS n 1 7 TRP n 1 8 THR n 1 9 PHE n 1 10 TYR n 1 11 ALA n 1 12 ASN n 1 13 ARG n 1 14 LYS n 1 15 TYR n 1 16 THR n 1 17 ASP n 1 18 PHE n 1 19 ASP n 1 20 LYS n 1 21 SER n 1 22 PHE n 1 23 LYS n 1 24 LYS n 1 25 SER n 1 26 SER n 1 27 ASP n 1 28 LEU n 1 29 ASP n 1 30 GLU n 1 31 CYS n 1 32 LYS n 1 33 LYS n 1 34 THR n 1 35 CYS n 1 36 PHE n 1 37 LYS n 1 38 THR n 1 39 GLU n 1 40 TYR n 1 41 CYS n 1 42 TYR n 1 43 ILE n 1 44 VAL n 1 45 PHE n 1 46 GLU n 1 47 ASP n 1 48 THR n 1 49 VAL n 1 50 ASN n 1 51 LYS n 1 52 GLU n 1 53 CYS n 1 54 TYR n 1 55 TYR n 1 56 ASN n 1 57 VAL n 1 58 VAL n 1 59 ASP n 1 60 GLY n 1 61 GLU n 1 62 GLU n 1 63 LEU n 1 64 ASP n 1 65 GLN n 1 66 GLU n 1 67 LYS n 1 68 PHE n 1 69 VAL n 1 70 VAL n 1 71 ASP n 1 72 GLU n 1 73 ASN n 1 74 PHE n 1 75 THR n 1 76 GLU n 1 77 ASN n 1 78 TYR n 1 79 LEU n 1 80 THR n 1 81 ASP n 1 82 CYS n 1 83 GLU n 1 84 GLY n 1 85 LYS n 1 86 ASP n 1 87 ALA n 1 88 GLY n 1 89 ASN n 1 90 ALA n 1 91 ALA n 1 92 GLY n 1 93 THR n 1 94 GLY n 1 95 ASP n 1 96 GLU n 1 97 SER n 1 98 ASP n 1 99 GLU n 1 100 VAL n 1 101 ASP n 1 102 GLU n 1 103 ASP n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name 'Mexican leech' _entity_src_nat.pdbx_organism_scientific 'Haementeria officinalis' _entity_src_nat.pdbx_ncbi_taxonomy_id 6410 _entity_src_nat.genus ? _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 2K13 _struct_ref.pdbx_db_accession 2K13 _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2K13 _struct_ref_seq.pdbx_strand_id X _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 103 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 2K13 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 103 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 103 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 2D_1H_NOESY 1 2 2 3D_15N-separated_NOESY 1 3 4 3D_13C-separated_NOESY 1 4 2 '2D 1H-15N HSQC' 1 5 3 2D_1H_NOESY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength '10 mM sodium phosphate buffer' _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units bar _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1.4-1.7 mM Saratin, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '1.4-1.7 mM [U-15N] Saratin, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' '1.4-1.7 mM Saratin, 100% D2O' 3 '100% D2O' '1.4-1.7 mM [U-13C; U-15N] Saratin, 90% H2O/10% D2O' 4 '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker DRX' # _pdbx_nmr_refine.entry_id 2K13 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details 'refinement in explicit solvent (H2O)' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria '10 structure of lowest total and NOE energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 1000 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2K13 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2K13 _pdbx_nmr_representative.selection_criteria 'lowest total and noe energy' # _pdbx_nmr_software.authors 'Brunger A. T. et.al.' _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name CNS _pdbx_nmr_software.version ? _pdbx_nmr_software.ordinal 1 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2K13 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2K13 _struct.title 'Solution NMR Structure of the Leech Protein Saratin, a Novel Inhibitor of Haemostasis' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag N _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2K13 _struct_keywords.pdbx_keywords TOXIN _struct_keywords.text 'collagen binding, mixed alpha/beta structure, fold typical for PAN domains, TOXIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ASP _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 27 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id THR _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 38 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASP _struct_conf.beg_auth_asym_id X _struct_conf.beg_auth_seq_id 27 _struct_conf.end_auth_comp_id THR _struct_conf.end_auth_asym_id X _struct_conf.end_auth_seq_id 38 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 82 SG ? ? X CYS 6 X CYS 82 1_555 ? ? ? ? ? ? ? 2.035 ? ? disulf2 disulf ? ? A CYS 31 SG ? ? ? 1_555 A CYS 53 SG ? ? X CYS 31 X CYS 53 1_555 ? ? ? ? ? ? ? 2.053 ? ? disulf3 disulf ? ? A CYS 35 SG ? ? ? 1_555 A CYS 41 SG ? ? X CYS 35 X CYS 41 1_555 ? ? ? ? ? ? ? 2.070 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TRP A 7 ? ALA A 11 ? TRP X 7 ALA X 11 A 2 PHE A 74 ? LEU A 79 ? PHE X 74 LEU X 79 A 3 ILE A 43 ? ASP A 47 ? ILE X 43 ASP X 47 A 4 GLU A 52 ? ASN A 56 ? GLU X 52 ASN X 56 A 5 PHE A 22 ? LYS A 24 ? PHE X 22 LYS X 24 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N THR A 8 ? N THR X 8 O TYR A 78 ? O TYR X 78 A 2 3 O THR A 75 ? O THR X 75 N GLU A 46 ? N GLU X 46 A 3 4 N ILE A 43 ? N ILE X 43 O ASN A 56 ? O ASN X 56 A 4 5 O TYR A 55 ? O TYR X 55 N LYS A 23 ? N LYS X 23 # _atom_sites.entry_id 2K13 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 1 1 GLU GLU X . n A 1 2 GLU 2 2 2 GLU GLU X . n A 1 3 ARG 3 3 3 ARG ARG X . n A 1 4 GLU 4 4 4 GLU GLU X . n A 1 5 ASP 5 5 5 ASP ASP X . n A 1 6 CYS 6 6 6 CYS CYS X . n A 1 7 TRP 7 7 7 TRP TRP X . n A 1 8 THR 8 8 8 THR THR X . n A 1 9 PHE 9 9 9 PHE PHE X . n A 1 10 TYR 10 10 10 TYR TYR X . n A 1 11 ALA 11 11 11 ALA ALA X . n A 1 12 ASN 12 12 12 ASN ASN X . n A 1 13 ARG 13 13 13 ARG ARG X . n A 1 14 LYS 14 14 14 LYS LYS X . n A 1 15 TYR 15 15 15 TYR TYR X . n A 1 16 THR 16 16 16 THR THR X . n A 1 17 ASP 17 17 17 ASP ASP X . n A 1 18 PHE 18 18 18 PHE PHE X . n A 1 19 ASP 19 19 19 ASP ASP X . n A 1 20 LYS 20 20 20 LYS LYS X . n A 1 21 SER 21 21 21 SER SER X . n A 1 22 PHE 22 22 22 PHE PHE X . n A 1 23 LYS 23 23 23 LYS LYS X . n A 1 24 LYS 24 24 24 LYS LYS X . n A 1 25 SER 25 25 25 SER SER X . n A 1 26 SER 26 26 26 SER SER X . n A 1 27 ASP 27 27 27 ASP ASP X . n A 1 28 LEU 28 28 28 LEU LEU X . n A 1 29 ASP 29 29 29 ASP ASP X . n A 1 30 GLU 30 30 30 GLU GLU X . n A 1 31 CYS 31 31 31 CYS CYS X . n A 1 32 LYS 32 32 32 LYS LYS X . n A 1 33 LYS 33 33 33 LYS LYS X . n A 1 34 THR 34 34 34 THR THR X . n A 1 35 CYS 35 35 35 CYS CYS X . n A 1 36 PHE 36 36 36 PHE PHE X . n A 1 37 LYS 37 37 37 LYS LYS X . n A 1 38 THR 38 38 38 THR THR X . n A 1 39 GLU 39 39 39 GLU GLU X . n A 1 40 TYR 40 40 40 TYR TYR X . n A 1 41 CYS 41 41 41 CYS CYS X . n A 1 42 TYR 42 42 42 TYR TYR X . n A 1 43 ILE 43 43 43 ILE ILE X . n A 1 44 VAL 44 44 44 VAL VAL X . n A 1 45 PHE 45 45 45 PHE PHE X . n A 1 46 GLU 46 46 46 GLU GLU X . n A 1 47 ASP 47 47 47 ASP ASP X . n A 1 48 THR 48 48 48 THR THR X . n A 1 49 VAL 49 49 49 VAL VAL X . n A 1 50 ASN 50 50 50 ASN ASN X . n A 1 51 LYS 51 51 51 LYS LYS X . n A 1 52 GLU 52 52 52 GLU GLU X . n A 1 53 CYS 53 53 53 CYS CYS X . n A 1 54 TYR 54 54 54 TYR TYR X . n A 1 55 TYR 55 55 55 TYR TYR X . n A 1 56 ASN 56 56 56 ASN ASN X . n A 1 57 VAL 57 57 57 VAL VAL X . n A 1 58 VAL 58 58 58 VAL VAL X . n A 1 59 ASP 59 59 59 ASP ASP X . n A 1 60 GLY 60 60 60 GLY GLY X . n A 1 61 GLU 61 61 61 GLU GLU X . n A 1 62 GLU 62 62 62 GLU GLU X . n A 1 63 LEU 63 63 63 LEU LEU X . n A 1 64 ASP 64 64 64 ASP ASP X . n A 1 65 GLN 65 65 65 GLN GLN X . n A 1 66 GLU 66 66 66 GLU GLU X . n A 1 67 LYS 67 67 67 LYS LYS X . n A 1 68 PHE 68 68 68 PHE PHE X . n A 1 69 VAL 69 69 69 VAL VAL X . n A 1 70 VAL 70 70 70 VAL VAL X . n A 1 71 ASP 71 71 71 ASP ASP X . n A 1 72 GLU 72 72 72 GLU GLU X . n A 1 73 ASN 73 73 73 ASN ASN X . n A 1 74 PHE 74 74 74 PHE PHE X . n A 1 75 THR 75 75 75 THR THR X . n A 1 76 GLU 76 76 76 GLU GLU X . n A 1 77 ASN 77 77 77 ASN ASN X . n A 1 78 TYR 78 78 78 TYR TYR X . n A 1 79 LEU 79 79 79 LEU LEU X . n A 1 80 THR 80 80 80 THR THR X . n A 1 81 ASP 81 81 81 ASP ASP X . n A 1 82 CYS 82 82 82 CYS CYS X . n A 1 83 GLU 83 83 83 GLU GLU X . n A 1 84 GLY 84 84 84 GLY GLY X . n A 1 85 LYS 85 85 85 LYS LYS X . n A 1 86 ASP 86 86 86 ASP ASP X . n A 1 87 ALA 87 87 87 ALA ALA X . n A 1 88 GLY 88 88 88 GLY GLY X . n A 1 89 ASN 89 89 89 ASN ASN X . n A 1 90 ALA 90 90 90 ALA ALA X . n A 1 91 ALA 91 91 91 ALA ALA X . n A 1 92 GLY 92 92 92 GLY GLY X . n A 1 93 THR 93 93 93 THR THR X . n A 1 94 GLY 94 94 94 GLY GLY X . n A 1 95 ASP 95 95 95 ASP ASP X . n A 1 96 GLU 96 96 96 GLU GLU X . n A 1 97 SER 97 97 97 SER SER X . n A 1 98 ASP 98 98 98 ASP ASP X . n A 1 99 GLU 99 99 99 GLU GLU X . n A 1 100 VAL 100 100 100 VAL VAL X . n A 1 101 ASP 101 101 101 ASP ASP X . n A 1 102 GLU 102 102 102 GLU GLU X . n A 1 103 ASP 103 103 103 ASP ASP X . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-10-21 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Database references' 3 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_struct_assembly 3 3 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id Saratin 1.4 mM ? 1 Saratin 1.4 mM '[U-15N]' 2 Saratin 1.4 mM ? 3 Saratin 1.4 mM '[U-13C; U-15N]' 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 H X LYS 14 ? ? O X VAL 69 ? ? 1.55 2 3 HZ1 X LYS 14 ? ? OE2 X GLU 76 ? ? 1.59 3 4 OD2 X ASP 5 ? ? HZ3 X LYS 85 ? ? 1.52 4 4 HZ3 X LYS 24 ? ? OE2 X GLU 52 ? ? 1.56 5 4 HZ3 X LYS 14 ? ? OE1 X GLU 76 ? ? 1.60 6 5 OD1 X ASP 47 ? ? H X ASN 50 ? ? 1.60 7 6 HG1 X THR 93 ? ? OE1 X GLU 96 ? ? 1.58 8 6 OD2 X ASP 64 ? ? HZ1 X LYS 67 ? ? 1.60 9 7 OD1 X ASP 5 ? ? HZ2 X LYS 85 ? ? 1.59 10 7 OD1 X ASP 17 ? ? HZ1 X LYS 20 ? ? 1.60 11 9 H X LYS 14 ? ? O X VAL 69 ? ? 1.53 12 9 OD1 X ASP 5 ? ? HZ3 X LYS 85 ? ? 1.60 13 10 H X LYS 14 ? ? O X VAL 69 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP X 17 ? ? -173.90 140.18 2 1 SER X 21 ? ? 70.83 102.66 3 1 THR X 38 ? ? -73.07 -148.26 4 1 CYS X 41 ? ? 16.48 83.76 5 1 TYR X 42 ? ? -159.48 -35.59 6 1 ASP X 81 ? ? 62.60 64.28 7 1 CYS X 82 ? ? -135.31 -70.71 8 1 GLU X 83 ? ? 48.06 20.99 9 1 LYS X 85 ? ? -109.30 -85.03 10 1 ASP X 86 ? ? 59.58 -81.17 11 1 SER X 97 ? ? 76.97 91.13 12 1 GLU X 99 ? ? -109.40 -66.28 13 1 ASP X 101 ? ? -113.55 -85.80 14 2 ARG X 3 ? ? 71.50 122.64 15 2 ASP X 5 ? ? -64.80 -173.73 16 2 ASP X 17 ? ? -174.44 131.80 17 2 LYS X 20 ? ? -58.78 -1.73 18 2 SER X 21 ? ? 77.16 88.25 19 2 THR X 38 ? ? -73.64 -149.44 20 2 ASP X 59 ? ? -67.92 96.76 21 2 ASP X 81 ? ? 80.11 -55.69 22 2 CYS X 82 ? ? -62.01 -74.94 23 2 GLU X 83 ? ? 38.59 61.11 24 2 LYS X 85 ? ? -45.69 107.28 25 2 ASP X 86 ? ? -133.45 -53.31 26 2 ALA X 87 ? ? -91.56 32.25 27 2 ALA X 91 ? ? 65.18 -78.87 28 2 ASP X 98 ? ? 176.32 -169.01 29 2 ASP X 101 ? ? 66.29 78.35 30 2 GLU X 102 ? ? -162.96 -49.12 31 3 GLU X 2 ? ? -73.81 25.15 32 3 ARG X 3 ? ? -93.68 -65.10 33 3 TYR X 15 ? ? -95.58 40.78 34 3 THR X 16 ? ? 54.85 7.83 35 3 PHE X 18 ? ? -141.59 28.74 36 3 SER X 21 ? ? 78.12 97.31 37 3 THR X 38 ? ? -71.47 -149.10 38 3 CYS X 41 ? ? -4.40 97.99 39 3 TYR X 42 ? ? -160.93 -33.52 40 3 ASP X 81 ? ? 167.69 -69.86 41 3 LYS X 85 ? ? -50.06 97.71 42 3 THR X 93 ? ? 171.33 158.20 43 3 ASP X 95 ? ? -156.61 -60.88 44 3 GLU X 96 ? ? 53.90 86.17 45 3 VAL X 100 ? ? 52.09 -72.47 46 4 ASP X 5 ? ? -64.90 -174.62 47 4 TYR X 10 ? ? -91.54 -62.70 48 4 TYR X 15 ? ? -88.19 43.83 49 4 THR X 16 ? ? 61.91 -38.59 50 4 SER X 21 ? ? 75.81 96.17 51 4 THR X 38 ? ? -72.92 -149.05 52 4 CYS X 41 ? ? -10.41 98.77 53 4 TYR X 42 ? ? -162.14 -14.18 54 4 ASP X 81 ? ? 35.72 35.00 55 4 GLU X 83 ? ? -172.12 -178.71 56 4 ASP X 86 ? ? -106.51 -64.37 57 4 ALA X 87 ? ? -133.42 -33.08 58 4 ALA X 91 ? ? 66.46 86.10 59 4 ASP X 101 ? ? 63.64 -72.43 60 5 ARG X 3 ? ? 72.25 152.06 61 5 GLU X 4 ? ? 60.36 175.97 62 5 TYR X 10 ? ? -100.01 -63.77 63 5 THR X 16 ? ? -34.69 78.43 64 5 ASP X 17 ? ? 179.03 150.45 65 5 SER X 21 ? ? 80.80 94.84 66 5 THR X 38 ? ? -73.97 -149.92 67 5 ASP X 59 ? ? -59.67 99.86 68 5 ASP X 81 ? ? 80.72 -67.34 69 5 GLU X 83 ? ? 56.36 97.14 70 5 ALA X 87 ? ? 61.85 -57.98 71 5 THR X 93 ? ? 70.25 81.15 72 5 ASP X 95 ? ? -163.66 110.82 73 5 GLU X 96 ? ? 162.48 -42.12 74 5 ASP X 101 ? ? 176.75 -55.04 75 6 GLU X 2 ? ? -152.29 19.63 76 6 TYR X 10 ? ? -101.61 -61.20 77 6 THR X 16 ? ? -55.44 29.90 78 6 SER X 21 ? ? 68.75 90.20 79 6 THR X 38 ? ? -74.74 -149.42 80 6 ASP X 81 ? ? 59.64 90.49 81 6 CYS X 82 ? ? -139.72 -58.24 82 6 GLU X 83 ? ? 37.17 78.70 83 6 ASP X 86 ? ? -161.14 -50.17 84 6 ASP X 95 ? ? -99.65 -74.98 85 6 ASP X 101 ? ? 58.40 97.47 86 7 GLU X 2 ? ? -98.51 59.99 87 7 THR X 16 ? ? -54.03 70.03 88 7 SER X 21 ? ? 83.34 91.05 89 7 THR X 38 ? ? -71.67 -149.78 90 7 CYS X 41 ? ? 4.00 89.90 91 7 TYR X 42 ? ? -166.77 -20.70 92 7 LYS X 51 ? ? 61.79 67.39 93 7 GLU X 83 ? ? 59.18 -30.07 94 7 ASP X 86 ? ? -179.96 -53.68 95 7 ASN X 89 ? ? -161.33 85.73 96 7 VAL X 100 ? ? 68.41 83.76 97 7 ASP X 101 ? ? 72.14 -32.09 98 8 GLU X 2 ? ? -167.41 99.99 99 8 TYR X 10 ? ? -96.13 -62.85 100 8 THR X 16 ? ? 68.15 -47.24 101 8 PHE X 18 ? ? -85.86 34.29 102 8 SER X 21 ? ? 77.10 89.22 103 8 THR X 38 ? ? -74.63 -148.71 104 8 ASP X 59 ? ? -66.44 98.47 105 8 ASP X 81 ? ? 81.40 -71.80 106 8 ASN X 89 ? ? -176.44 146.40 107 8 ALA X 90 ? ? -166.89 92.18 108 9 GLU X 2 ? ? -110.67 61.23 109 9 THR X 16 ? ? -60.81 66.93 110 9 SER X 21 ? ? 80.33 96.91 111 9 THR X 38 ? ? -73.41 -149.53 112 9 ASP X 81 ? ? 52.58 73.28 113 9 CYS X 82 ? ? -165.67 35.08 114 9 ALA X 91 ? ? -119.51 -84.50 115 9 ASP X 95 ? ? 56.07 -96.33 116 9 GLU X 96 ? ? 53.49 -95.25 117 9 ASP X 101 ? ? 75.62 -43.33 118 9 GLU X 102 ? ? -136.55 -45.77 119 10 TYR X 15 ? ? -94.10 50.98 120 10 THR X 16 ? ? 64.91 -48.25 121 10 SER X 21 ? ? 62.83 100.70 122 10 THR X 38 ? ? -73.57 -149.82 123 10 ASP X 81 ? ? 54.05 -20.84 124 10 SER X 97 ? ? -147.64 26.17 125 10 VAL X 100 ? ? -130.01 -80.69 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 8 THR X 38 ? ? GLU X 39 ? ? 144.95 2 10 THR X 38 ? ? GLU X 39 ? ? 148.89 #