data_2K1M # _entry.id 2K1M # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.323 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2K1M RCSB RCSB100561 WWPDB D_1000100561 BMRB 15679 # _pdbx_database_related.db_name BMRB _pdbx_database_related.db_id 15679 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2K1M _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2008-03-10 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ratti, J.' 1 'Gautel, M.' 2 'Pfuhl, M.' 3 # _citation.id primary _citation.title '3D NMR structure of domain cC0 of cardiac myosin binding protein C (MyBPC)' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ratti, J.' 1 ? primary 'Gautel, M.' 2 ? primary 'Pfuhl, M.' 3 ? # _cell.entry_id 2K1M _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2K1M _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Myosin-binding protein C, cardiac-type' _entity.formula_weight 10045.301 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Cardiac MyBP-C, C-protein, cardiac muscle isoform' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;PEPGKKPVSAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGSYAV IAGSSKVKFDLKVIE ; _entity_poly.pdbx_seq_one_letter_code_can ;PEPGKKPVSAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGSYAV IAGSSKVKFDLKVIE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PRO n 1 2 GLU n 1 3 PRO n 1 4 GLY n 1 5 LYS n 1 6 LYS n 1 7 PRO n 1 8 VAL n 1 9 SER n 1 10 ALA n 1 11 PHE n 1 12 SER n 1 13 LYS n 1 14 LYS n 1 15 PRO n 1 16 ARG n 1 17 SER n 1 18 VAL n 1 19 GLU n 1 20 VAL n 1 21 ALA n 1 22 ALA n 1 23 GLY n 1 24 SER n 1 25 PRO n 1 26 ALA n 1 27 VAL n 1 28 PHE n 1 29 GLU n 1 30 ALA n 1 31 GLU n 1 32 THR n 1 33 GLU n 1 34 ARG n 1 35 ALA n 1 36 GLY n 1 37 VAL n 1 38 LYS n 1 39 VAL n 1 40 ARG n 1 41 TRP n 1 42 GLN n 1 43 ARG n 1 44 GLY n 1 45 GLY n 1 46 SER n 1 47 ASP n 1 48 ILE n 1 49 SER n 1 50 ALA n 1 51 SER n 1 52 ASN n 1 53 LYS n 1 54 TYR n 1 55 GLY n 1 56 LEU n 1 57 ALA n 1 58 THR n 1 59 GLU n 1 60 GLY n 1 61 THR n 1 62 ARG n 1 63 HIS n 1 64 THR n 1 65 LEU n 1 66 THR n 1 67 VAL n 1 68 ARG n 1 69 GLU n 1 70 VAL n 1 71 GLY n 1 72 PRO n 1 73 ALA n 1 74 ASP n 1 75 GLN n 1 76 GLY n 1 77 SER n 1 78 TYR n 1 79 ALA n 1 80 VAL n 1 81 ILE n 1 82 ALA n 1 83 GLY n 1 84 SER n 1 85 SER n 1 86 LYS n 1 87 VAL n 1 88 LYS n 1 89 PHE n 1 90 ASP n 1 91 LEU n 1 92 LYS n 1 93 VAL n 1 94 ILE n 1 95 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene MYBPC3 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 star' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET-8C _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MYPC3_HUMAN _struct_ref.pdbx_db_accession Q14896 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;PEPGKKPVSAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGSYAV IAGSSKVKFDLKVIE ; _struct_ref.pdbx_align_begin 2 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2K1M _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 95 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q14896 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 96 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 95 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D 1H-13C NOESY' 1 2 2 '2D 1H-15N HSQC' 1 3 1 '3D HNCACB' 1 4 1 '3D CBCA(CO)NH' 1 5 1 '3D HNCO' 1 6 1 '3D HN(CO)CA' 1 7 3 '2D 1H-1H NOESY' 1 8 1 '2D 1H-13C HSQC' 1 9 1 '3D HCCH-TOCSY' 1 10 2 '3D 1H-15N NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 185 _pdbx_nmr_exptl_sample_conditions.pH 7 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;1-1.5 mM [U-95% 13C; U-95% 15N] cC0_MyBPC, 55.5 M [U-2H] D2O, 40 mM sodium phosphate, 50 mM sodium chloride, 2 mM DTT, 90% H2O/10% D2O ; 1 '90% H2O/10% D2O' '1-1.5 mM [U-95% 15N] cC0_MyBPC, 55.5 M H2O, 40 mM sodium phosphate, 50 mM sodium chloride, 2 mM DTT, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' '1-1.5 mM cC0_MyBPC, 55.5 M H2O, 40 mM sodium phosphate, 50 mM sodium chloride, 2 mM DTT, 90% H2O/10% D2O' 3 '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Bruker AVANCE 1 'Bruker Avance' 600 Bruker AVANCE 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2K1M _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation 2.82 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2K1M _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation 0.24 _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation 4.23 _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 0.32 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2K1M _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 1 'Cornilescu, Delaglio and Bax' 'dihedral angles' TALOS ? 2 'Wim F. Vranken, Wayne Boucher, Tim J. Stevens, Rasmus H. Fogh' 'chemical shift assignment' CCPNMR-_analysis '1.0 release 15' 3 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 2.1 4 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2K1M _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2K1M _struct.title '3D NMR structure of domain cC0 of cardiac myosin binding protein C (MyBPC)' _struct.pdbx_descriptor 'Myosin-binding protein C, cardiac-type' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2K1M _struct_keywords.pdbx_keywords 'STRUCTURAL PROTEIN' _struct_keywords.text ;Ig-I domain, Myosin Binding Protein C, Cardiac Muscle, Hypertrophic cardiomyopathy, Actin-binding, Cell adhesion, Disease mutation, Immunoglobulin domain, Muscle protein, Phosphoprotein, Polymorphism, Thick filament, STRUCTURAL PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 12 ? LYS A 13 ? SER A 12 LYS A 13 A 2 ALA A 26 ? THR A 32 ? ALA A 26 THR A 32 A 3 ARG A 62 ? VAL A 67 ? ARG A 62 VAL A 67 A 4 GLY A 55 ? GLU A 59 ? GLY A 55 GLU A 59 B 1 VAL A 18 ? ALA A 21 ? VAL A 18 ALA A 21 B 2 SER A 85 ? ILE A 94 ? SER A 85 ILE A 94 B 3 SER A 77 ? ALA A 82 ? SER A 77 ALA A 82 B 4 ARG A 40 ? ARG A 43 ? ARG A 40 ARG A 43 B 5 SER A 46 ? ILE A 48 ? SER A 46 ILE A 48 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LYS A 13 ? O LYS A 13 N GLU A 31 ? N GLU A 31 A 2 3 O ALA A 26 ? O ALA A 26 N VAL A 67 ? N VAL A 67 A 3 4 O GLU A 59 ? O GLU A 59 N ARG A 62 ? N ARG A 62 B 1 2 O VAL A 18 ? O VAL A 18 N LYS A 92 ? N LYS A 92 B 2 3 O PHE A 89 ? O PHE A 89 N TYR A 78 ? N TYR A 78 B 3 4 O ALA A 79 ? O ALA A 79 N GLN A 42 ? N GLN A 42 B 4 5 O TRP A 41 ? O TRP A 41 N ILE A 48 ? N ILE A 48 # _atom_sites.entry_id 2K1M _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PRO 1 1 1 PRO PRO A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 PRO 3 3 3 PRO PRO A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 TRP 41 41 41 TRP TRP A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 TYR 54 54 54 TYR TYR A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 HIS 63 63 63 HIS HIS A . n A 1 64 THR 64 64 64 THR THR A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 PRO 72 72 72 PRO PRO A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 GLN 75 75 75 GLN GLN A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 TYR 78 78 78 TYR TYR A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 PHE 89 89 89 PHE PHE A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 GLU 95 95 95 GLU GLU A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-03-17 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-19 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_spectrometer.model' # _pdbx_nmr_ensemble_rms.atom_type ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.chain_range_begin ? _pdbx_nmr_ensemble_rms.chain_range_end ? _pdbx_nmr_ensemble_rms.coord_average_rmsd_method ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error ? _pdbx_nmr_ensemble_rms.distance_rms_dev 0.40 _pdbx_nmr_ensemble_rms.distance_rms_dev_error 0.07 _pdbx_nmr_ensemble_rms.entry_id 2K1M _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev ? _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error ? _pdbx_nmr_ensemble_rms.residue_range_begin ? _pdbx_nmr_ensemble_rms.residue_range_end ? # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id cC0_MyBPC 1 mM '[U-95% 13C; U-95% 15N]' 1 D2O 55.5 M '[U-2H]' 1 'sodium phosphate' 40 mM ? 1 'sodium chloride' 50 mM ? 1 DTT 2 mM ? 1 cC0_MyBPC 1 mM '[U-95% 15N]' 2 H2O 55.5 M ? 2 'sodium phosphate' 40 mM ? 2 'sodium chloride' 50 mM ? 2 DTT 2 mM ? 2 cC0_MyBPC 1 mM ? 3 H2O 55.5 M ? 3 'sodium phosphate' 40 mM ? 3 'sodium chloride' 50 mM ? 3 DTT 2 mM ? 3 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2K1M _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 2066 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 0 _pdbx_nmr_constraints.NOE_long_range_total_count 701 _pdbx_nmr_constraints.NOE_medium_range_total_count 87 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 1278 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 90 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 90 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 3 ? ? -69.78 -176.98 2 1 VAL A 8 ? ? -52.49 108.32 3 1 PRO A 15 ? ? -69.79 84.33 4 1 ALA A 50 ? ? -63.33 91.89 5 1 LYS A 53 ? ? 74.97 -1.52 6 1 GLU A 59 ? ? -152.52 88.53 7 2 VAL A 8 ? ? -52.62 105.54 8 2 PRO A 15 ? ? -69.82 85.83 9 2 ALA A 50 ? ? -51.83 102.29 10 2 SER A 51 ? ? -170.05 -175.67 11 3 VAL A 8 ? ? -54.50 104.86 12 3 PRO A 15 ? ? -69.77 87.26 13 3 ALA A 50 ? ? -52.01 102.04 14 4 VAL A 8 ? ? -52.26 105.63 15 4 PRO A 15 ? ? -69.74 88.25 16 4 ALA A 50 ? ? -62.36 93.73 17 5 VAL A 8 ? ? -51.72 104.98 18 5 PRO A 15 ? ? -69.79 86.21 19 5 ALA A 50 ? ? -63.75 91.90 20 5 GLN A 75 ? ? -64.79 89.40 21 6 PRO A 3 ? ? -69.72 -173.25 22 6 VAL A 8 ? ? -56.14 104.88 23 6 PRO A 15 ? ? -69.75 85.13 24 6 ALA A 50 ? ? -63.94 91.73 25 6 GLU A 59 ? ? -165.44 90.07 26 7 VAL A 8 ? ? -51.73 104.94 27 7 PRO A 15 ? ? -69.79 85.41 28 7 ALA A 50 ? ? -63.97 91.98 29 8 PRO A 7 ? ? -69.73 -177.79 30 8 VAL A 8 ? ? -55.37 107.93 31 8 PRO A 15 ? ? -69.77 87.66 32 8 ALA A 50 ? ? -63.69 91.91 33 8 LYS A 53 ? ? 74.81 -1.46 34 9 VAL A 8 ? ? -51.66 107.03 35 9 PRO A 15 ? ? -69.74 88.26 36 9 ALA A 50 ? ? -63.44 91.86 37 9 LYS A 53 ? ? 74.50 -0.57 38 10 PRO A 7 ? ? -69.75 -174.75 39 10 VAL A 8 ? ? -52.27 109.30 40 10 PRO A 15 ? ? -69.80 95.71 41 10 ALA A 50 ? ? -64.08 91.78 42 10 LYS A 53 ? ? 76.54 -5.01 43 11 PRO A 3 ? ? -69.74 -175.46 44 11 VAL A 8 ? ? -57.36 105.13 45 11 ALA A 50 ? ? -63.72 91.96 46 11 GLN A 75 ? ? -63.18 91.94 47 12 VAL A 8 ? ? -53.61 107.29 48 12 PRO A 15 ? ? -69.79 92.51 49 12 ALA A 50 ? ? -63.36 91.88 50 12 LYS A 53 ? ? 74.26 -0.27 51 13 VAL A 8 ? ? -57.25 105.04 52 13 PRO A 15 ? ? -69.78 86.39 53 13 ALA A 50 ? ? -64.01 91.65 54 13 GLN A 75 ? ? -65.07 89.21 55 14 PRO A 3 ? ? -69.77 94.37 56 14 VAL A 8 ? ? -55.77 105.00 57 14 PRO A 15 ? ? -69.74 95.23 58 14 ALA A 50 ? ? -63.54 91.86 59 14 LYS A 53 ? ? 74.24 -0.74 60 15 PRO A 3 ? ? -69.80 -173.32 61 15 VAL A 8 ? ? -51.98 105.04 62 15 PRO A 15 ? ? -69.75 92.37 63 15 ALA A 50 ? ? -51.93 101.34 64 15 GLN A 75 ? ? -51.44 102.10 65 15 SER A 84 ? ? -104.19 -64.74 66 16 VAL A 8 ? ? -56.57 105.26 67 16 PRO A 15 ? ? -69.73 83.06 68 16 ALA A 50 ? ? -63.35 92.21 69 16 LYS A 53 ? ? 74.95 -2.97 70 17 VAL A 8 ? ? -51.77 105.26 71 17 PRO A 15 ? ? -69.82 80.77 72 17 ALA A 50 ? ? -63.86 91.79 73 17 LYS A 53 ? ? 76.63 -4.96 74 17 GLN A 75 ? ? -51.90 102.90 75 18 VAL A 8 ? ? -55.83 105.07 76 18 PRO A 15 ? ? -69.76 86.08 77 18 ALA A 50 ? ? -51.95 102.28 78 18 GLU A 59 ? ? -150.99 84.66 79 18 GLN A 75 ? ? -63.58 91.11 80 19 VAL A 8 ? ? -52.12 104.94 81 19 ALA A 50 ? ? -51.94 102.36 82 19 SER A 51 ? ? -170.93 -178.55 83 19 GLN A 75 ? ? -50.22 103.27 84 20 VAL A 8 ? ? -53.07 105.18 85 20 PRO A 15 ? ? -69.73 94.94 86 20 ALA A 50 ? ? -63.59 91.79 87 20 GLN A 75 ? ? -50.77 108.15 #