data_2K29 # _entry.id 2K29 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2K29 pdb_00002k29 10.2210/pdb2k29/pdb RCSB RCSB100584 ? ? WWPDB D_1000100584 ? ? BMRB 15691 ? 10.13018/BMR15691 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-04-22 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-19 4 'Structure model' 1 3 2023-06-14 5 'Structure model' 1 4 2024-05-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Database references' 3 3 'Structure model' 'Derived calculations' 4 3 'Structure model' Other 5 4 'Structure model' 'Database references' 6 4 'Structure model' Other 7 5 'Structure model' 'Data collection' 8 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' struct_ref_seq_dif 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_database_status 8 5 'Structure model' chem_comp_atom 9 5 'Structure model' chem_comp_bond 10 5 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_struct_ref_seq_dif.details' 3 4 'Structure model' '_database_2.pdbx_DOI' 4 4 'Structure model' '_database_2.pdbx_database_accession' 5 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 6 5 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2K29 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2008-03-28 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.content_type unspecified _pdbx_database_related.db_id 15691 _pdbx_database_related.db_name BMRB _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Li, G.' 1 'Zhang, Y.' 2 'Inouye, M.' 3 'Ikura, M.' 4 # _citation.id primary _citation.title 'Structural mechanism of transcriptional autorepression of the Escherichia coli RelB/RelE antitoxin/toxin module.' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume 380 _citation.page_first 107 _citation.page_last 119 _citation.year 2008 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 0022-2836 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18501926 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2008.04.039 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Li, G.Y.' 1 ? primary 'Zhang, Y.' 2 ? primary 'Inouye, M.' 3 ? primary 'Ikura, M.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Antitoxin RelB' _entity.formula_weight 6001.910 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'DNA binding domain, UNP residues 4-53' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSHMGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTL _entity_poly.pdbx_seq_one_letter_code_can GSHMGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTL _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 GLY n 1 6 SER n 1 7 ILE n 1 8 ASN n 1 9 LEU n 1 10 ARG n 1 11 ILE n 1 12 ASP n 1 13 ASP n 1 14 GLU n 1 15 LEU n 1 16 LYS n 1 17 ALA n 1 18 ARG n 1 19 SER n 1 20 TYR n 1 21 ALA n 1 22 ALA n 1 23 LEU n 1 24 GLU n 1 25 LYS n 1 26 MET n 1 27 GLY n 1 28 VAL n 1 29 THR n 1 30 PRO n 1 31 SER n 1 32 GLU n 1 33 ALA n 1 34 LEU n 1 35 ARG n 1 36 LEU n 1 37 MET n 1 38 LEU n 1 39 GLU n 1 40 TYR n 1 41 ILE n 1 42 ALA n 1 43 ASP n 1 44 ASN n 1 45 GLU n 1 46 ARG n 1 47 LEU n 1 48 PRO n 1 49 PHE n 1 50 LYS n 1 51 GLN n 1 52 THR n 1 53 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Escherichia _entity_src_gen.pdbx_gene_src_gene relB _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant DE3 _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector pET28a _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -2 ? ? ? A . n A 1 2 SER 2 -1 ? ? ? A . n A 1 3 HIS 3 0 ? ? ? A . n A 1 4 MET 4 1 1 MET MET A . n A 1 5 GLY 5 2 2 GLY GLY A . n A 1 6 SER 6 3 3 SER SER A . n A 1 7 ILE 7 4 4 ILE ILE A . n A 1 8 ASN 8 5 5 ASN ASN A . n A 1 9 LEU 9 6 6 LEU LEU A . n A 1 10 ARG 10 7 7 ARG ARG A . n A 1 11 ILE 11 8 8 ILE ILE A . n A 1 12 ASP 12 9 9 ASP ASP A . n A 1 13 ASP 13 10 10 ASP ASP A . n A 1 14 GLU 14 11 11 GLU GLU A . n A 1 15 LEU 15 12 12 LEU LEU A . n A 1 16 LYS 16 13 13 LYS LYS A . n A 1 17 ALA 17 14 14 ALA ALA A . n A 1 18 ARG 18 15 15 ARG ARG A . n A 1 19 SER 19 16 16 SER SER A . n A 1 20 TYR 20 17 17 TYR TYR A . n A 1 21 ALA 21 18 18 ALA ALA A . n A 1 22 ALA 22 19 19 ALA ALA A . n A 1 23 LEU 23 20 20 LEU LEU A . n A 1 24 GLU 24 21 21 GLU GLU A . n A 1 25 LYS 25 22 22 LYS LYS A . n A 1 26 MET 26 23 23 MET MET A . n A 1 27 GLY 27 24 24 GLY GLY A . n A 1 28 VAL 28 25 25 VAL VAL A . n A 1 29 THR 29 26 26 THR THR A . n A 1 30 PRO 30 27 27 PRO PRO A . n A 1 31 SER 31 28 28 SER SER A . n A 1 32 GLU 32 29 29 GLU GLU A . n A 1 33 ALA 33 30 30 ALA ALA A . n A 1 34 LEU 34 31 31 LEU LEU A . n A 1 35 ARG 35 32 32 ARG ARG A . n A 1 36 LEU 36 33 33 LEU LEU A . n A 1 37 MET 37 34 34 MET MET A . n A 1 38 LEU 38 35 35 LEU LEU A . n A 1 39 GLU 39 36 36 GLU GLU A . n A 1 40 TYR 40 37 37 TYR TYR A . n A 1 41 ILE 41 38 38 ILE ILE A . n A 1 42 ALA 42 39 39 ALA ALA A . n A 1 43 ASP 43 40 40 ASP ASP A . n A 1 44 ASN 44 41 41 ASN ASN A . n A 1 45 GLU 45 42 42 GLU GLU A . n A 1 46 ARG 46 43 43 ARG ARG A . n A 1 47 LEU 47 44 44 LEU LEU A . n A 1 48 PRO 48 45 45 PRO PRO A . n A 1 49 PHE 49 46 46 PHE PHE A . n A 1 50 LYS 50 47 47 LYS LYS A . n A 1 51 GLN 51 48 48 GLN GLN A . n A 1 52 THR 52 49 49 THR THR A . n A 1 53 LEU 53 50 50 LEU LEU A . n B 1 1 GLY 1 98 ? ? ? B . n B 1 2 SER 2 99 ? ? ? B . n B 1 3 HIS 3 100 ? ? ? B . n B 1 4 MET 4 101 101 MET MET B . n B 1 5 GLY 5 102 102 GLY GLY B . n B 1 6 SER 6 103 103 SER SER B . n B 1 7 ILE 7 104 104 ILE ILE B . n B 1 8 ASN 8 105 105 ASN ASN B . n B 1 9 LEU 9 106 106 LEU LEU B . n B 1 10 ARG 10 107 107 ARG ARG B . n B 1 11 ILE 11 108 108 ILE ILE B . n B 1 12 ASP 12 109 109 ASP ASP B . n B 1 13 ASP 13 110 110 ASP ASP B . n B 1 14 GLU 14 111 111 GLU GLU B . n B 1 15 LEU 15 112 112 LEU LEU B . n B 1 16 LYS 16 113 113 LYS LYS B . n B 1 17 ALA 17 114 114 ALA ALA B . n B 1 18 ARG 18 115 115 ARG ARG B . n B 1 19 SER 19 116 116 SER SER B . n B 1 20 TYR 20 117 117 TYR TYR B . n B 1 21 ALA 21 118 118 ALA ALA B . n B 1 22 ALA 22 119 119 ALA ALA B . n B 1 23 LEU 23 120 120 LEU LEU B . n B 1 24 GLU 24 121 121 GLU GLU B . n B 1 25 LYS 25 122 122 LYS LYS B . n B 1 26 MET 26 123 123 MET MET B . n B 1 27 GLY 27 124 124 GLY GLY B . n B 1 28 VAL 28 125 125 VAL VAL B . n B 1 29 THR 29 126 126 THR THR B . n B 1 30 PRO 30 127 127 PRO PRO B . n B 1 31 SER 31 128 128 SER SER B . n B 1 32 GLU 32 129 129 GLU GLU B . n B 1 33 ALA 33 130 130 ALA ALA B . n B 1 34 LEU 34 131 131 LEU LEU B . n B 1 35 ARG 35 132 132 ARG ARG B . n B 1 36 LEU 36 133 133 LEU LEU B . n B 1 37 MET 37 134 134 MET MET B . n B 1 38 LEU 38 135 135 LEU LEU B . n B 1 39 GLU 39 136 136 GLU GLU B . n B 1 40 TYR 40 137 137 TYR TYR B . n B 1 41 ILE 41 138 138 ILE ILE B . n B 1 42 ALA 42 139 139 ALA ALA B . n B 1 43 ASP 43 140 140 ASP ASP B . n B 1 44 ASN 44 141 141 ASN ASN B . n B 1 45 GLU 45 142 142 GLU GLU B . n B 1 46 ARG 46 143 143 ARG ARG B . n B 1 47 LEU 47 144 144 LEU LEU B . n B 1 48 PRO 48 145 145 PRO PRO B . n B 1 49 PHE 49 146 146 PHE PHE B . n B 1 50 LYS 50 147 147 LYS LYS B . n B 1 51 GLN 51 148 148 GLN GLN B . n B 1 52 THR 52 149 149 THR THR B . n B 1 53 LEU 53 150 150 LEU LEU B . n # _cell.entry_id 2K29 _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2K29 _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ;Ribbon-helix-helix family transcriptional repressor ; _exptl.entry_id 2K29 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2K29 _struct.title 'Structure of the DBD domain of E. coli antitoxin RelB' _struct.pdbx_model_details ;Ribbon-helix-helix family transcriptional repressor ; _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2K29 _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text 'RelB, Ribbon-Helix-Helix, antitoxin, Repressor, Stress response, Transcription, Transcription regulation' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RELB_ECOLI _struct_ref.pdbx_db_accession P0C079 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTL _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2K29 A 4 ? 53 ? P0C079 1 ? 50 ? 1 50 2 1 2K29 B 4 ? 53 ? P0C079 1 ? 50 ? 101 150 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2K29 GLY A 1 ? UNP P0C079 ? ? 'expression tag' -2 1 1 2K29 SER A 2 ? UNP P0C079 ? ? 'expression tag' -1 2 1 2K29 HIS A 3 ? UNP P0C079 ? ? 'expression tag' 0 3 2 2K29 GLY B 1 ? UNP P0C079 ? ? 'expression tag' 98 4 2 2K29 SER B 2 ? UNP P0C079 ? ? 'expression tag' 99 5 2 2K29 HIS B 3 ? UNP P0C079 ? ? 'expression tag' 100 6 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 12 ? MET A 26 ? ASP A 9 MET A 23 1 ? 15 HELX_P HELX_P2 2 THR A 29 ? GLU A 45 ? THR A 26 GLU A 42 1 ? 17 HELX_P HELX_P3 3 ASP B 12 ? MET B 26 ? ASP B 109 MET B 123 1 ? 15 HELX_P HELX_P4 4 THR B 29 ? GLU B 45 ? THR B 126 GLU B 142 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLY A 5 ? ILE A 11 ? GLY A 2 ILE A 8 A 2 GLY B 5 ? ILE B 11 ? GLY B 102 ILE B 108 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ILE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 11 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 8 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id GLY _pdbx_struct_sheet_hbond.range_2_label_asym_id B _pdbx_struct_sheet_hbond.range_2_label_seq_id 5 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id GLY _pdbx_struct_sheet_hbond.range_2_auth_asym_id B _pdbx_struct_sheet_hbond.range_2_auth_seq_id 102 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 43 ? ? -151.17 -40.95 2 1 LEU A 44 ? ? 70.23 144.01 3 1 LYS A 47 ? ? -93.38 30.46 4 1 ARG B 143 ? ? -138.22 -38.35 5 1 LEU B 144 ? ? 65.80 162.79 6 1 LYS B 147 ? ? -106.70 49.17 7 2 ARG A 43 ? ? -149.08 -37.19 8 2 LEU A 44 ? ? 71.31 142.37 9 2 PHE A 46 ? ? -102.04 -67.27 10 2 LYS A 47 ? ? 69.94 -28.52 11 2 ARG B 143 ? ? -150.07 -38.08 12 2 LEU B 144 ? ? 66.84 146.66 13 3 ARG A 43 ? ? -133.59 -47.09 14 3 LEU A 44 ? ? 67.21 141.88 15 3 THR A 49 ? ? -151.85 15.35 16 3 ARG B 143 ? ? -134.18 -31.34 17 3 LEU B 144 ? ? 65.17 162.00 18 3 PHE B 146 ? ? -123.23 -69.79 19 3 LYS B 147 ? ? 72.05 -30.94 20 3 GLN B 148 ? ? 67.06 -83.31 21 4 LEU A 44 ? ? 72.76 150.59 22 4 PHE A 46 ? ? -104.46 -74.14 23 4 LYS A 47 ? ? 73.09 -18.02 24 4 GLN A 48 ? ? 53.97 -157.11 25 4 ARG B 143 ? ? -152.97 -29.73 26 4 LEU B 144 ? ? 66.92 160.92 27 4 LYS B 147 ? ? -61.18 99.91 28 5 ARG A 43 ? ? -146.80 -37.39 29 5 LEU A 44 ? ? 70.32 137.38 30 5 LYS A 47 ? ? -82.06 47.56 31 5 THR A 49 ? ? 53.06 16.34 32 5 ARG B 143 ? ? -143.67 -33.17 33 5 LEU B 144 ? ? 73.31 150.12 34 5 GLN B 148 ? ? 52.40 -96.39 35 6 ARG A 43 ? ? -146.91 -42.23 36 6 LEU A 44 ? ? 68.84 149.19 37 6 PHE A 46 ? ? -138.44 -45.82 38 6 ARG B 143 ? ? -145.76 -35.54 39 6 LEU B 144 ? ? 65.91 143.37 40 6 GLN B 148 ? ? -72.84 -166.29 41 6 THR B 149 ? ? -142.32 28.36 42 7 ARG A 43 ? ? -152.38 -33.06 43 7 LEU A 44 ? ? 69.00 158.30 44 7 ARG B 143 ? ? -149.89 -39.65 45 7 LEU B 144 ? ? 67.33 145.16 46 7 GLN B 148 ? ? 45.38 175.15 47 8 ARG A 43 ? ? -154.04 -33.76 48 8 LEU A 44 ? ? 71.76 148.09 49 8 LYS A 47 ? ? 47.23 24.99 50 8 GLN A 48 ? ? 54.83 -161.79 51 8 THR A 49 ? ? -94.69 44.61 52 8 ARG B 143 ? ? -153.77 -32.70 53 8 LEU B 144 ? ? 72.84 151.41 54 8 PHE B 146 ? ? -125.14 -76.19 55 8 LYS B 147 ? ? 77.62 -18.91 56 8 GLN B 148 ? ? 61.25 -98.12 57 8 THR B 149 ? ? -161.68 -41.20 58 9 ARG A 43 ? ? -154.56 -33.36 59 9 LEU A 44 ? ? 72.61 152.15 60 9 PHE A 46 ? ? -138.36 -52.16 61 9 ARG B 143 ? ? -155.75 -37.08 62 9 LEU B 144 ? ? 66.99 158.94 63 9 GLN B 148 ? ? 53.23 -165.13 64 9 THR B 149 ? ? -141.84 27.55 65 10 ARG A 43 ? ? -148.31 -31.04 66 10 LEU A 44 ? ? 64.16 170.37 67 10 PHE A 46 ? ? -138.59 -41.56 68 10 LYS A 47 ? ? 49.24 27.80 69 10 ARG B 143 ? ? -153.68 -29.72 70 10 LEU B 144 ? ? 70.69 167.00 71 10 PHE B 146 ? ? -141.39 -50.11 72 10 LYS B 147 ? ? 80.93 -28.60 73 10 GLN B 148 ? ? 56.07 -99.51 74 10 THR B 149 ? ? -172.21 -45.70 75 11 ARG A 43 ? ? -142.28 -43.81 76 11 LEU A 44 ? ? 69.36 139.24 77 11 LYS A 47 ? ? -79.67 48.44 78 11 ARG B 143 ? ? -148.02 -32.85 79 11 LEU B 144 ? ? 66.42 155.51 80 11 PHE B 146 ? ? -144.91 -38.28 81 11 LYS B 147 ? ? 65.87 -90.50 82 11 GLN B 148 ? ? 150.69 -176.71 83 12 ARG A 43 ? ? -142.50 -41.21 84 12 LEU A 44 ? ? 65.87 149.82 85 12 LYS A 47 ? ? 46.80 28.82 86 12 ARG B 143 ? ? -151.79 -26.86 87 12 LEU B 144 ? ? 66.77 158.22 88 12 PHE B 146 ? ? -141.91 -52.67 89 12 GLN B 148 ? ? 60.47 -163.81 90 13 ARG A 43 ? ? -143.64 -39.50 91 13 LEU A 44 ? ? 67.50 145.78 92 13 ARG B 143 ? ? -153.87 -37.99 93 13 LEU B 144 ? ? 65.47 149.26 94 13 PHE B 146 ? ? -137.96 -54.56 95 13 THR B 149 ? ? -144.97 20.51 96 14 ARG A 43 ? ? -147.46 -36.15 97 14 LEU A 44 ? ? 68.00 148.99 98 14 LYS A 47 ? ? -98.99 31.51 99 14 THR A 49 ? ? -119.19 65.56 100 14 ARG B 143 ? ? -145.09 -36.09 101 14 LEU B 144 ? ? 69.77 148.61 102 14 GLN B 148 ? ? 52.43 -162.29 103 15 ARG A 43 ? ? -147.68 -35.32 104 15 LEU A 44 ? ? 73.76 148.89 105 15 LYS A 47 ? ? 39.16 40.15 106 15 GLN A 48 ? ? -58.97 -170.92 107 15 THR A 49 ? ? -160.83 27.90 108 15 ARG B 143 ? ? -145.61 -25.62 109 15 LEU B 144 ? ? 74.26 153.06 110 15 PHE B 146 ? ? -136.97 -64.77 111 16 ARG A 43 ? ? -145.16 -46.02 112 16 LEU A 44 ? ? 66.81 152.16 113 16 ARG B 143 ? ? -145.76 -39.18 114 16 LEU B 144 ? ? 64.87 163.59 115 17 ARG A 43 ? ? -149.92 -33.19 116 17 LEU A 44 ? ? 69.65 152.78 117 17 PHE A 46 ? ? -128.01 -66.28 118 17 ARG B 143 ? ? -154.70 -33.07 119 17 LEU B 144 ? ? 69.37 128.00 120 17 GLN B 148 ? ? 56.83 167.36 121 17 THR B 149 ? ? -152.76 71.56 122 18 LEU A 44 ? ? 66.73 152.11 123 18 PHE A 46 ? ? -127.35 -65.89 124 18 LYS A 47 ? ? 72.13 61.56 125 18 THR A 49 ? ? -143.50 -24.52 126 18 ARG B 143 ? ? -137.05 -41.95 127 18 LEU B 144 ? ? 65.51 153.44 128 18 LYS B 147 ? ? 61.69 -27.12 129 18 GLN B 148 ? ? 56.11 -75.49 130 19 ARG A 43 ? ? -148.31 -33.05 131 19 LEU A 44 ? ? 64.73 164.38 132 19 LYS A 47 ? ? 39.19 35.62 133 19 ARG B 143 ? ? -131.34 -45.62 134 19 LEU B 144 ? ? 64.16 147.19 135 19 PHE B 146 ? ? -147.49 -41.40 136 19 LYS B 147 ? ? 66.95 -83.90 137 19 GLN B 148 ? ? -126.68 -76.31 138 19 THR B 149 ? ? -151.97 28.86 139 20 ARG A 43 ? ? -147.87 -28.85 140 20 LEU A 44 ? ? 68.69 141.17 141 20 PHE A 46 ? ? -130.78 -64.81 142 20 GLN A 48 ? ? 43.24 -76.03 143 20 THR A 49 ? ? 175.50 -24.44 144 20 ARG B 143 ? ? -149.73 -35.05 145 20 LEU B 144 ? ? 67.30 148.67 146 20 THR B 149 ? ? -160.49 74.02 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2K29 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2K29 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;0.5-1.0 mM [U-100% 13C; U-100% 15N] RelBN, 20 mM sodium phosphate, 100 mM sodium chloride, 1 mM DTT, 1 uM sodium azide, 90% H2O/10% D2O ; 1 '90% H2O/10% D2O' '0.5-1.0 mM [U-100% 13C; U-100% 15N] RelBN, 20 mM sodium phosphate, 100 mM sodium chloride, 1 mM DTT, 1 uM sodium azide, 100% D2O' 2 '100% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id RelBN 0.5 mM '[U-100% 13C; U-100% 15N]' 1 'sodium phosphate' 20 mM ? 1 'sodium chloride' 100 mM ? 1 DTT 1 mM ? 1 'sodium azide' 1 uM ? 1 RelBN 0.5 mM '[U-100% 13C; U-100% 15N]' 2 'sodium phosphate' 20 mM ? 2 'sodium chloride' 100 mM ? 2 DTT 1 mM ? 2 'sodium azide' 1 uM ? 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.12 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D HNCACB' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D C(CO)NH' 1 5 1 '3D H(CCO)NH' 1 6 1 '3D HNCO' 1 7 2 '2D 1H-13C HSQC' 1 8 2 '3D HCCH-TOCSY' 1 9 1 '3D 1H-15N NOESY' 1 10 1 '3D 1H-13C NOESY' # _pdbx_nmr_details.entry_id 2K29 _pdbx_nmr_details.text 'The structure was determined using a combination of NOE and residual dipolar coupling data.' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2K29 _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count 104 _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 2994 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 708 _pdbx_nmr_constraints.NOE_long_range_total_count 712 _pdbx_nmr_constraints.NOE_medium_range_total_count 754 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 820 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # _pdbx_nmr_refine.entry_id 2K29 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 1 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS 1.1 2 Varian collection VNMR 6.1C 3 'Bartels et al.' 'chemical shift assignment' XEASY ? 4 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -2 ? A GLY 1 2 1 Y 1 A SER -1 ? A SER 2 3 1 Y 1 A HIS 0 ? A HIS 3 4 1 Y 1 B GLY 98 ? B GLY 1 5 1 Y 1 B SER 99 ? B SER 2 6 1 Y 1 B HIS 100 ? B HIS 3 7 2 Y 1 A GLY -2 ? A GLY 1 8 2 Y 1 A SER -1 ? A SER 2 9 2 Y 1 A HIS 0 ? A HIS 3 10 2 Y 1 B GLY 98 ? B GLY 1 11 2 Y 1 B SER 99 ? B SER 2 12 2 Y 1 B HIS 100 ? B HIS 3 13 3 Y 1 A GLY -2 ? A GLY 1 14 3 Y 1 A SER -1 ? A SER 2 15 3 Y 1 A HIS 0 ? A HIS 3 16 3 Y 1 B GLY 98 ? B GLY 1 17 3 Y 1 B SER 99 ? B SER 2 18 3 Y 1 B HIS 100 ? B HIS 3 19 4 Y 1 A GLY -2 ? A GLY 1 20 4 Y 1 A SER -1 ? A SER 2 21 4 Y 1 A HIS 0 ? A HIS 3 22 4 Y 1 B GLY 98 ? B GLY 1 23 4 Y 1 B SER 99 ? B SER 2 24 4 Y 1 B HIS 100 ? B HIS 3 25 5 Y 1 A GLY -2 ? A GLY 1 26 5 Y 1 A SER -1 ? A SER 2 27 5 Y 1 A HIS 0 ? A HIS 3 28 5 Y 1 B GLY 98 ? B GLY 1 29 5 Y 1 B SER 99 ? B SER 2 30 5 Y 1 B HIS 100 ? B HIS 3 31 6 Y 1 A GLY -2 ? A GLY 1 32 6 Y 1 A SER -1 ? A SER 2 33 6 Y 1 A HIS 0 ? A HIS 3 34 6 Y 1 B GLY 98 ? B GLY 1 35 6 Y 1 B SER 99 ? B SER 2 36 6 Y 1 B HIS 100 ? B HIS 3 37 7 Y 1 A GLY -2 ? A GLY 1 38 7 Y 1 A SER -1 ? A SER 2 39 7 Y 1 A HIS 0 ? A HIS 3 40 7 Y 1 B GLY 98 ? B GLY 1 41 7 Y 1 B SER 99 ? B SER 2 42 7 Y 1 B HIS 100 ? B HIS 3 43 8 Y 1 A GLY -2 ? A GLY 1 44 8 Y 1 A SER -1 ? A SER 2 45 8 Y 1 A HIS 0 ? A HIS 3 46 8 Y 1 B GLY 98 ? B GLY 1 47 8 Y 1 B SER 99 ? B SER 2 48 8 Y 1 B HIS 100 ? B HIS 3 49 9 Y 1 A GLY -2 ? A GLY 1 50 9 Y 1 A SER -1 ? A SER 2 51 9 Y 1 A HIS 0 ? A HIS 3 52 9 Y 1 B GLY 98 ? B GLY 1 53 9 Y 1 B SER 99 ? B SER 2 54 9 Y 1 B HIS 100 ? B HIS 3 55 10 Y 1 A GLY -2 ? A GLY 1 56 10 Y 1 A SER -1 ? A SER 2 57 10 Y 1 A HIS 0 ? A HIS 3 58 10 Y 1 B GLY 98 ? B GLY 1 59 10 Y 1 B SER 99 ? B SER 2 60 10 Y 1 B HIS 100 ? B HIS 3 61 11 Y 1 A GLY -2 ? A GLY 1 62 11 Y 1 A SER -1 ? A SER 2 63 11 Y 1 A HIS 0 ? A HIS 3 64 11 Y 1 B GLY 98 ? B GLY 1 65 11 Y 1 B SER 99 ? B SER 2 66 11 Y 1 B HIS 100 ? B HIS 3 67 12 Y 1 A GLY -2 ? A GLY 1 68 12 Y 1 A SER -1 ? A SER 2 69 12 Y 1 A HIS 0 ? A HIS 3 70 12 Y 1 B GLY 98 ? B GLY 1 71 12 Y 1 B SER 99 ? B SER 2 72 12 Y 1 B HIS 100 ? B HIS 3 73 13 Y 1 A GLY -2 ? A GLY 1 74 13 Y 1 A SER -1 ? A SER 2 75 13 Y 1 A HIS 0 ? A HIS 3 76 13 Y 1 B GLY 98 ? B GLY 1 77 13 Y 1 B SER 99 ? B SER 2 78 13 Y 1 B HIS 100 ? B HIS 3 79 14 Y 1 A GLY -2 ? A GLY 1 80 14 Y 1 A SER -1 ? A SER 2 81 14 Y 1 A HIS 0 ? A HIS 3 82 14 Y 1 B GLY 98 ? B GLY 1 83 14 Y 1 B SER 99 ? B SER 2 84 14 Y 1 B HIS 100 ? B HIS 3 85 15 Y 1 A GLY -2 ? A GLY 1 86 15 Y 1 A SER -1 ? A SER 2 87 15 Y 1 A HIS 0 ? A HIS 3 88 15 Y 1 B GLY 98 ? B GLY 1 89 15 Y 1 B SER 99 ? B SER 2 90 15 Y 1 B HIS 100 ? B HIS 3 91 16 Y 1 A GLY -2 ? A GLY 1 92 16 Y 1 A SER -1 ? A SER 2 93 16 Y 1 A HIS 0 ? A HIS 3 94 16 Y 1 B GLY 98 ? B GLY 1 95 16 Y 1 B SER 99 ? B SER 2 96 16 Y 1 B HIS 100 ? B HIS 3 97 17 Y 1 A GLY -2 ? A GLY 1 98 17 Y 1 A SER -1 ? A SER 2 99 17 Y 1 A HIS 0 ? A HIS 3 100 17 Y 1 B GLY 98 ? B GLY 1 101 17 Y 1 B SER 99 ? B SER 2 102 17 Y 1 B HIS 100 ? B HIS 3 103 18 Y 1 A GLY -2 ? A GLY 1 104 18 Y 1 A SER -1 ? A SER 2 105 18 Y 1 A HIS 0 ? A HIS 3 106 18 Y 1 B GLY 98 ? B GLY 1 107 18 Y 1 B SER 99 ? B SER 2 108 18 Y 1 B HIS 100 ? B HIS 3 109 19 Y 1 A GLY -2 ? A GLY 1 110 19 Y 1 A SER -1 ? A SER 2 111 19 Y 1 A HIS 0 ? A HIS 3 112 19 Y 1 B GLY 98 ? B GLY 1 113 19 Y 1 B SER 99 ? B SER 2 114 19 Y 1 B HIS 100 ? B HIS 3 115 20 Y 1 A GLY -2 ? A GLY 1 116 20 Y 1 A SER -1 ? A SER 2 117 20 Y 1 A HIS 0 ? A HIS 3 118 20 Y 1 B GLY 98 ? B GLY 1 119 20 Y 1 B SER 99 ? B SER 2 120 20 Y 1 B HIS 100 ? B HIS 3 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TYR N N N N 304 TYR CA C N S 305 TYR C C N N 306 TYR O O N N 307 TYR CB C N N 308 TYR CG C Y N 309 TYR CD1 C Y N 310 TYR CD2 C Y N 311 TYR CE1 C Y N 312 TYR CE2 C Y N 313 TYR CZ C Y N 314 TYR OH O N N 315 TYR OXT O N N 316 TYR H H N N 317 TYR H2 H N N 318 TYR HA H N N 319 TYR HB2 H N N 320 TYR HB3 H N N 321 TYR HD1 H N N 322 TYR HD2 H N N 323 TYR HE1 H N N 324 TYR HE2 H N N 325 TYR HH H N N 326 TYR HXT H N N 327 VAL N N N N 328 VAL CA C N S 329 VAL C C N N 330 VAL O O N N 331 VAL CB C N N 332 VAL CG1 C N N 333 VAL CG2 C N N 334 VAL OXT O N N 335 VAL H H N N 336 VAL H2 H N N 337 VAL HA H N N 338 VAL HB H N N 339 VAL HG11 H N N 340 VAL HG12 H N N 341 VAL HG13 H N N 342 VAL HG21 H N N 343 VAL HG22 H N N 344 VAL HG23 H N N 345 VAL HXT H N N 346 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TYR N CA sing N N 291 TYR N H sing N N 292 TYR N H2 sing N N 293 TYR CA C sing N N 294 TYR CA CB sing N N 295 TYR CA HA sing N N 296 TYR C O doub N N 297 TYR C OXT sing N N 298 TYR CB CG sing N N 299 TYR CB HB2 sing N N 300 TYR CB HB3 sing N N 301 TYR CG CD1 doub Y N 302 TYR CG CD2 sing Y N 303 TYR CD1 CE1 sing Y N 304 TYR CD1 HD1 sing N N 305 TYR CD2 CE2 doub Y N 306 TYR CD2 HD2 sing N N 307 TYR CE1 CZ doub Y N 308 TYR CE1 HE1 sing N N 309 TYR CE2 CZ sing Y N 310 TYR CE2 HE2 sing N N 311 TYR CZ OH sing N N 312 TYR OH HH sing N N 313 TYR OXT HXT sing N N 314 VAL N CA sing N N 315 VAL N H sing N N 316 VAL N H2 sing N N 317 VAL CA C sing N N 318 VAL CA CB sing N N 319 VAL CA HA sing N N 320 VAL C O doub N N 321 VAL C OXT sing N N 322 VAL CB CG1 sing N N 323 VAL CB CG2 sing N N 324 VAL CB HB sing N N 325 VAL CG1 HG11 sing N N 326 VAL CG1 HG12 sing N N 327 VAL CG1 HG13 sing N N 328 VAL CG2 HG21 sing N N 329 VAL CG2 HG22 sing N N 330 VAL CG2 HG23 sing N N 331 VAL OXT HXT sing N N 332 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Varian INOVA 1 'Varian INOVA' 500 Varian INOVA 2 'Varian INOVA' # _atom_sites.entry_id 2K29 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_