data_2K3K # _entry.id 2K3K # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2K3K pdb_00002k3k 10.2210/pdb2k3k/pdb RCSB RCSB100631 ? ? WWPDB D_1000100631 ? ? # _pdbx_database_PDB_obs_spr.id SPRSDE _pdbx_database_PDB_obs_spr.date 2008-06-03 _pdbx_database_PDB_obs_spr.pdb_id 2K3K _pdbx_database_PDB_obs_spr.replace_pdb_id 2FJJ _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2K3K _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2008-05-12 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Liu, C.' 1 'Cui, G.' 2 'Hu, J.' 3 'Jin, C.' 4 'Xia, B.' 5 # _citation.id primary _citation.title 'Structural and Functional Studies of RNA Splicing Factor Sans-Fille by Multidimentional NMR Spectroscopy' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hu, J.' 1 ? primary 'Cui, G.' 2 ? primary 'Li, C.' 3 ? primary 'Liu, C.' 4 ? primary 'Jin, C.' 5 ? primary 'Wang, J.' 6 ? primary 'Xia, B.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'U1 small nuclear ribonucleoprotein A' _entity.formula_weight 11973.117 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'RRM1 domain (UNP residues 1-98)' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'U1 snRNP protein A, U1-A, Sex determination protein snf' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MEMLPNQTIYINNLNEKIKKEELKKSLYAIFSQFGQILDIVALKTLKMRGQAFVIFKEIGSASNALRTMQGFPFYDKPMQ IAYSKSDSDIVAKIKGTFKERPKK ; _entity_poly.pdbx_seq_one_letter_code_can ;MEMLPNQTIYINNLNEKIKKEELKKSLYAIFSQFGQILDIVALKTLKMRGQAFVIFKEIGSASNALRTMQGFPFYDKPMQ IAYSKSDSDIVAKIKGTFKERPKK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 MET n 1 4 LEU n 1 5 PRO n 1 6 ASN n 1 7 GLN n 1 8 THR n 1 9 ILE n 1 10 TYR n 1 11 ILE n 1 12 ASN n 1 13 ASN n 1 14 LEU n 1 15 ASN n 1 16 GLU n 1 17 LYS n 1 18 ILE n 1 19 LYS n 1 20 LYS n 1 21 GLU n 1 22 GLU n 1 23 LEU n 1 24 LYS n 1 25 LYS n 1 26 SER n 1 27 LEU n 1 28 TYR n 1 29 ALA n 1 30 ILE n 1 31 PHE n 1 32 SER n 1 33 GLN n 1 34 PHE n 1 35 GLY n 1 36 GLN n 1 37 ILE n 1 38 LEU n 1 39 ASP n 1 40 ILE n 1 41 VAL n 1 42 ALA n 1 43 LEU n 1 44 LYS n 1 45 THR n 1 46 LEU n 1 47 LYS n 1 48 MET n 1 49 ARG n 1 50 GLY n 1 51 GLN n 1 52 ALA n 1 53 PHE n 1 54 VAL n 1 55 ILE n 1 56 PHE n 1 57 LYS n 1 58 GLU n 1 59 ILE n 1 60 GLY n 1 61 SER n 1 62 ALA n 1 63 SER n 1 64 ASN n 1 65 ALA n 1 66 LEU n 1 67 ARG n 1 68 THR n 1 69 MET n 1 70 GLN n 1 71 GLY n 1 72 PHE n 1 73 PRO n 1 74 PHE n 1 75 TYR n 1 76 ASP n 1 77 LYS n 1 78 PRO n 1 79 MET n 1 80 GLN n 1 81 ILE n 1 82 ALA n 1 83 TYR n 1 84 SER n 1 85 LYS n 1 86 SER n 1 87 ASP n 1 88 SER n 1 89 ASP n 1 90 ILE n 1 91 VAL n 1 92 ALA n 1 93 LYS n 1 94 ILE n 1 95 LYS n 1 96 GLY n 1 97 THR n 1 98 PHE n 1 99 LYS n 1 100 GLU n 1 101 ARG n 1 102 PRO n 1 103 LYS n 1 104 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Drosophila melanogaster' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id ? _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'Rosetta(de3)plyss' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET-21d(+)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SNRPA_DROME _struct_ref.pdbx_db_accession P43332 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MEMLPNQTIYINNLNEKIKKEELKKSLYAIFSQFGQILDIVALKTLKMRGQAFVIFKEIGSASNALRTMQGFPFYDKPMQ IAYSKSDSDIVAKIKGTF ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2K3K _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 98 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P43332 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 98 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 98 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2K3K LYS A 99 ? UNP P43332 ? ? 'expression tag' 99 1 1 2K3K GLU A 100 ? UNP P43332 ? ? 'expression tag' 100 2 1 2K3K ARG A 101 ? UNP P43332 ? ? 'expression tag' 101 3 1 2K3K PRO A 102 ? UNP P43332 ? ? 'expression tag' 102 4 1 2K3K LYS A 103 ? UNP P43332 ? ? 'expression tag' 103 5 1 2K3K LYS A 104 ? UNP P43332 ? ? 'expression tag' 104 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D 1H-15N NOESY' 1 2 1 '3D 1H-13C NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100 _pdbx_nmr_exptl_sample_conditions.pH 7 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '0.4 mM [U-100% 13C; U-100% 15N] SNF RBD1, 50 mM potassium phosphate, 50 mM sodium chloride, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2K3K _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2K3K _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2K3K _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'David Case' refinement Amber 7.0 1 'Peter Guntert' 'structure solution' CYANA 1.06 2 'Bruce Johnson' 'data analysis' NMRView 5 3 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details 'Drosophila homolog of mammalian U1A and U2B' _exptl.entry_id 2K3K _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2K3K _struct.title 'Solution structure of Drosophila melanogaster SNF RBD1' _struct.pdbx_model_details 'Drosophila homolog of mammalian U1A and U2B' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2K3K _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN' _struct_keywords.text ;RNA BINDING PROTEIN, SNF RBD1, RNA binding, RNA splicing, solution structure, mRNA processing, mRNA splicing, Nucleus, Ribonucleoprotein, RNA-binding, Spliceosome ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 19 ? PHE A 31 ? LYS A 19 PHE A 31 1 ? 13 HELX_P HELX_P2 2 SER A 32 ? GLY A 35 ? SER A 32 GLY A 35 5 ? 4 HELX_P HELX_P3 3 THR A 45 ? ARG A 49 ? THR A 45 ARG A 49 5 ? 5 HELX_P HELX_P4 4 GLU A 58 ? GLN A 70 ? GLU A 58 GLN A 70 1 ? 13 HELX_P HELX_P5 5 ASP A 87 ? GLY A 96 ? ASP A 87 GLY A 96 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 37 ? VAL A 41 ? ILE A 37 VAL A 41 A 2 ALA A 52 ? PHE A 56 ? ALA A 52 PHE A 56 A 3 THR A 8 ? ILE A 11 ? THR A 8 ILE A 11 A 4 ILE A 81 ? TYR A 83 ? ILE A 81 TYR A 83 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 38 ? N LEU A 38 O ILE A 55 ? O ILE A 55 A 2 3 O ALA A 52 ? O ALA A 52 N ILE A 11 ? N ILE A 11 A 3 4 N TYR A 10 ? N TYR A 10 O ALA A 82 ? O ALA A 82 # _atom_sites.entry_id 2K3K _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 MET 3 3 3 MET MET A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 ASN 6 6 6 ASN ASN A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 TYR 10 10 10 TYR TYR A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 ASN 12 12 12 ASN ASN A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 TYR 28 28 28 TYR TYR A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 PHE 31 31 31 PHE PHE A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 ILE 37 37 37 ILE ILE A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 MET 48 48 48 MET MET A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 PHE 56 56 56 PHE PHE A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 MET 69 69 69 MET MET A . n A 1 70 GLN 70 70 70 GLN GLN A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 PHE 72 72 72 PHE PHE A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 PHE 74 74 74 PHE PHE A . n A 1 75 TYR 75 75 75 TYR TYR A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 PRO 78 78 78 PRO PRO A . n A 1 79 MET 79 79 79 MET MET A . n A 1 80 GLN 80 80 80 GLN GLN A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 TYR 83 83 83 TYR TYR A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 SER 86 86 86 SER SER A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 THR 97 97 97 THR THR A . n A 1 98 PHE 98 98 98 PHE PHE A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 ARG 101 101 101 ARG ARG A . n A 1 102 PRO 102 102 102 PRO PRO A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 LYS 104 104 104 LYS LYS A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-06-03 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'SNF RBD1' 0.4 mM '[U-100% 13C; U-100% 15N]' 1 'potassium phosphate' 50 mM ? 1 'sodium chloride' 50 mM ? 1 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 2 NE A ARG 101 ? ? CZ A ARG 101 ? ? NH2 A ARG 101 ? ? 117.14 120.30 -3.16 0.50 N 2 4 NE A ARG 67 ? ? CZ A ARG 67 ? ? NH2 A ARG 67 ? ? 117.30 120.30 -3.00 0.50 N 3 11 NE A ARG 49 ? ? CZ A ARG 49 ? ? NH2 A ARG 49 ? ? 116.83 120.30 -3.47 0.50 N 4 20 NE A ARG 101 ? ? CZ A ARG 101 ? ? NH2 A ARG 101 ? ? 117.25 120.30 -3.05 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 12 ? ? -144.12 17.76 2 1 ASN A 13 ? ? -142.35 40.16 3 1 GLN A 36 ? ? 57.57 111.42 4 1 ASP A 76 ? ? -66.97 19.14 5 1 SER A 86 ? ? -163.28 47.39 6 1 LYS A 99 ? ? -145.50 -20.58 7 2 GLN A 36 ? ? 49.70 109.92 8 2 TYR A 75 ? ? -145.28 -155.33 9 2 ASP A 76 ? ? -67.50 22.44 10 2 SER A 84 ? ? -64.14 3.94 11 2 SER A 86 ? ? 35.90 -119.73 12 2 LYS A 99 ? ? -138.14 -31.51 13 3 ASN A 12 ? ? -140.00 14.43 14 3 ILE A 30 ? ? -133.99 -43.73 15 3 GLN A 36 ? ? 36.49 106.94 16 3 ASP A 76 ? ? 65.90 -37.74 17 3 LYS A 95 ? ? -143.29 -66.36 18 3 THR A 97 ? ? 59.58 79.06 19 3 LYS A 103 ? ? -152.63 37.44 20 4 GLU A 2 ? ? 58.61 178.69 21 5 ASN A 13 ? ? -143.19 43.34 22 5 ILE A 30 ? ? -127.65 -51.07 23 5 TYR A 75 ? ? -145.31 -153.01 24 5 ASP A 76 ? ? -67.24 24.29 25 6 ILE A 30 ? ? -135.34 -41.62 26 6 GLN A 36 ? ? 59.37 109.39 27 6 TYR A 75 ? ? -145.64 -157.42 28 6 ASP A 76 ? ? -66.89 21.77 29 6 THR A 97 ? ? 69.34 161.39 30 7 TYR A 75 ? ? -145.95 -159.23 31 7 ASP A 76 ? ? -67.62 23.59 32 7 SER A 86 ? ? -143.93 10.48 33 7 ASP A 87 ? ? -142.48 -61.91 34 7 LYS A 99 ? ? -158.51 -25.35 35 7 LYS A 103 ? ? -159.01 48.40 36 8 GLN A 36 ? ? 61.43 109.73 37 8 TYR A 75 ? ? -155.24 83.66 38 8 SER A 86 ? ? -67.50 17.82 39 8 PHE A 98 ? ? -58.45 -9.99 40 9 GLU A 2 ? ? -138.32 -41.20 41 9 GLU A 16 ? ? -39.10 -35.79 42 9 GLN A 36 ? ? 37.84 100.49 43 9 TYR A 75 ? ? -138.33 -156.79 44 9 ASP A 76 ? ? -69.08 19.15 45 9 SER A 88 ? ? 66.72 -42.68 46 9 LYS A 99 ? ? -153.34 66.86 47 10 ILE A 30 ? ? -123.63 -55.89 48 10 GLN A 36 ? ? 37.37 103.09 49 10 TYR A 75 ? ? -142.23 -159.45 50 10 ASP A 76 ? ? -67.02 21.06 51 10 ASP A 89 ? ? -144.13 -48.07 52 10 THR A 97 ? ? -149.86 -84.73 53 11 ASN A 13 ? ? -144.37 41.62 54 11 TYR A 75 ? ? -146.95 -156.24 55 11 ASP A 76 ? ? -60.33 5.67 56 12 TYR A 75 ? ? -154.60 80.10 57 12 ASP A 87 ? ? -140.21 -41.85 58 12 LYS A 99 ? ? -150.37 -1.93 59 13 TYR A 75 ? ? -144.93 -157.30 60 13 ASP A 76 ? ? -65.97 18.02 61 13 LYS A 99 ? ? -133.67 -43.22 62 14 GLN A 36 ? ? 46.21 102.86 63 14 ASP A 76 ? ? -66.22 18.47 64 14 LYS A 95 ? ? 127.83 122.90 65 14 GLU A 100 ? ? -129.62 -54.04 66 15 GLN A 36 ? ? 57.33 111.38 67 15 ASP A 76 ? ? 66.87 -38.66 68 15 ARG A 101 ? ? 36.91 75.84 69 16 TYR A 75 ? ? -151.56 -63.73 70 16 LYS A 85 ? ? 59.90 16.24 71 16 SER A 88 ? ? 60.55 -69.94 72 17 MET A 3 ? ? -78.94 41.69 73 17 ILE A 30 ? ? -133.09 -43.42 74 17 GLN A 36 ? ? 35.99 101.61 75 17 TYR A 75 ? ? -145.39 -158.63 76 17 ASP A 76 ? ? -67.03 20.82 77 17 LYS A 85 ? ? -142.23 32.96 78 17 LYS A 95 ? ? -88.47 -143.10 79 17 PHE A 98 ? ? 166.55 -39.37 80 17 LYS A 99 ? ? -145.24 -5.60 81 18 PRO A 5 ? ? -50.41 109.37 82 18 GLN A 7 ? ? 84.35 -9.36 83 18 TYR A 75 ? ? -144.99 -157.22 84 18 ASP A 76 ? ? -67.09 20.66 85 18 LYS A 99 ? ? -136.73 -33.36 86 19 TYR A 75 ? ? -145.66 -159.63 87 19 ASP A 76 ? ? -66.46 20.46 88 19 LYS A 85 ? ? -153.29 -32.79 89 19 THR A 97 ? ? -135.07 -59.75 90 19 GLU A 100 ? ? -80.05 33.17 91 20 GLU A 2 ? ? -144.23 -55.91 92 20 ASN A 13 ? ? -145.60 44.58 93 20 GLN A 36 ? ? 38.45 102.64 94 20 ASP A 76 ? ? 65.71 -34.99 95 20 SER A 86 ? ? -76.26 44.57 96 20 LYS A 95 ? ? -123.51 -57.69 97 20 LYS A 103 ? ? -150.08 38.36 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 2 ARG A 67 ? ? 0.078 'SIDE CHAIN' 2 20 TYR A 10 ? ? 0.072 'SIDE CHAIN' #