data_2K47 # _entry.id 2K47 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2K47 pdb_00002k47 10.2210/pdb2k47/pdb RCSB RCSB100654 ? ? WWPDB D_1000100654 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-09-09 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 4 'Structure model' 1 3 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Database references' 3 3 'Structure model' 'Derived calculations' 4 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_struct_assembly 3 3 'Structure model' pdbx_struct_oper_list 4 3 'Structure model' struct_ref_seq_dif 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2K47 _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2008-05-28 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ribeiro, E.A.' 1 'Favier, A.' 2 'Gerard, F.C.' 3 'Leyrat, C.' 4 'Brutscher, B.' 5 'Blondel, D.' 6 'Ruigrok, R.W.' 7 'Blackledge, M.' 8 'Jamin, M.' 9 # _citation.id primary _citation.title 'Solution Structure of the C-Terminal Nucleoprotein-RNA Binding Domain of the Vesicular Stomatitis Virus Phosphoprotein.' _citation.journal_abbrev J.Mol.Biol. _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year 2008 _citation.journal_id_ASTM JMOBAK _citation.country UK _citation.journal_id_ISSN 1089-8638 _citation.journal_id_CSD 0070 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18657547 _citation.pdbx_database_id_DOI 10.1016/j.jmb.2008.07.028 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ribeiro, E.A.' 1 ? primary 'Favier, A.' 2 ? primary 'Gerard, F.C.' 3 ? primary 'Leyrat, C.' 4 ? primary 'Brutscher, B.' 5 ? primary 'Blondel, D.' 6 ? primary 'Ruigrok, R.W.' 7 ? primary 'Blackledge, M.' 8 ? primary 'Jamin, M.' 9 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Phosphoprotein _entity.formula_weight 9093.418 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'C-terminal domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'P protein, M1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code SDVWSLSKTSMTFQPKKASLQPLTISLDELFSSRGEFISVGGDGRMSHKEAILLGLRYKKLYNQARVKYSLLEHHHHHH _entity_poly.pdbx_seq_one_letter_code_can SDVWSLSKTSMTFQPKKASLQPLTISLDELFSSRGEFISVGGDGRMSHKEAILLGLRYKKLYNQARVKYSLLEHHHHHH _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ASP n 1 3 VAL n 1 4 TRP n 1 5 SER n 1 6 LEU n 1 7 SER n 1 8 LYS n 1 9 THR n 1 10 SER n 1 11 MET n 1 12 THR n 1 13 PHE n 1 14 GLN n 1 15 PRO n 1 16 LYS n 1 17 LYS n 1 18 ALA n 1 19 SER n 1 20 LEU n 1 21 GLN n 1 22 PRO n 1 23 LEU n 1 24 THR n 1 25 ILE n 1 26 SER n 1 27 LEU n 1 28 ASP n 1 29 GLU n 1 30 LEU n 1 31 PHE n 1 32 SER n 1 33 SER n 1 34 ARG n 1 35 GLY n 1 36 GLU n 1 37 PHE n 1 38 ILE n 1 39 SER n 1 40 VAL n 1 41 GLY n 1 42 GLY n 1 43 ASP n 1 44 GLY n 1 45 ARG n 1 46 MET n 1 47 SER n 1 48 HIS n 1 49 LYS n 1 50 GLU n 1 51 ALA n 1 52 ILE n 1 53 LEU n 1 54 LEU n 1 55 GLY n 1 56 LEU n 1 57 ARG n 1 58 TYR n 1 59 LYS n 1 60 LYS n 1 61 LEU n 1 62 TYR n 1 63 ASN n 1 64 GLN n 1 65 ALA n 1 66 ARG n 1 67 VAL n 1 68 LYS n 1 69 TYR n 1 70 SER n 1 71 LEU n 1 72 LEU n 1 73 GLU n 1 74 HIS n 1 75 HIS n 1 76 HIS n 1 77 HIS n 1 78 HIS n 1 79 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name VSIV _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene P _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Vesicular stomatitis Indiana virus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 11285 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pET22b _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 TRP 4 4 4 TRP TRP A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 MET 11 11 11 MET MET A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 PHE 13 13 13 PHE PHE A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 SER 19 19 19 SER SER A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 PRO 22 22 22 PRO PRO A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 PHE 31 31 31 PHE PHE A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 PHE 37 37 37 PHE PHE A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 MET 46 46 46 MET MET A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 HIS 48 48 48 HIS HIS A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 TYR 58 58 58 TYR TYR A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 TYR 62 62 62 TYR TYR A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 GLN 64 64 64 GLN GLN A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 TYR 69 69 69 TYR TYR A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 HIS 74 74 ? ? ? A . n A 1 75 HIS 75 75 ? ? ? A . n A 1 76 HIS 76 76 ? ? ? A . n A 1 77 HIS 77 77 ? ? ? A . n A 1 78 HIS 78 78 ? ? ? A . n A 1 79 HIS 79 79 ? ? ? A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2K47 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2K47 _struct.title 'Solution structure of the C-terminal N-RNA binding domain of the Vesicular Stomatitis Virus Phosphoprotein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2K47 _struct_keywords.pdbx_keywords REPLICATION _struct_keywords.text 'flexible tail, Chaperone, Cytoplasm, Phosphoprotein, RNA replication, Virion, REPLICATION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PHOSP_VSIVA _struct_ref.pdbx_db_accession P03520 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code SDVWSLSKTSMTFQPKKASLQPLTISLDELFSSRGEFISVGGDGRMSHKEAILLGLRYKKLYNQARVKYSL _struct_ref.pdbx_align_begin 195 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2K47 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 71 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P03520 _struct_ref_seq.db_align_beg 195 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 265 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 71 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2K47 LEU A 72 ? UNP P03520 ? ? 'expression tag' 72 1 1 2K47 GLU A 73 ? UNP P03520 ? ? 'expression tag' 73 2 1 2K47 HIS A 74 ? UNP P03520 ? ? 'expression tag' 74 3 1 2K47 HIS A 75 ? UNP P03520 ? ? 'expression tag' 75 4 1 2K47 HIS A 76 ? UNP P03520 ? ? 'expression tag' 76 5 1 2K47 HIS A 77 ? UNP P03520 ? ? 'expression tag' 77 6 1 2K47 HIS A 78 ? UNP P03520 ? ? 'expression tag' 78 7 1 2K47 HIS A 79 ? UNP P03520 ? ? 'expression tag' 79 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 28 ? PHE A 31 ? ASP A 28 PHE A 31 5 ? 4 HELX_P HELX_P2 2 SER A 33 ? GLY A 42 ? SER A 33 GLY A 42 1 ? 10 HELX_P HELX_P3 3 HIS A 48 ? LYS A 60 ? HIS A 48 LYS A 60 1 ? 13 HELX_P HELX_P4 4 LEU A 61 ? LYS A 68 ? LEU A 61 LYS A 68 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 23 ? SER A 26 ? LEU A 23 SER A 26 A 2 SER A 10 ? PRO A 15 ? SER A 10 PRO A 15 A 3 TYR A 69 ? SER A 70 ? TYR A 69 SER A 70 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LEU A 23 ? O LEU A 23 N PHE A 13 ? N PHE A 13 A 2 3 N GLN A 14 ? N GLN A 14 O SER A 70 ? O SER A 70 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 24 ? ? -155.55 88.52 2 1 VAL A 40 ? ? -35.45 -37.10 3 1 ASP A 43 ? ? -83.94 -77.86 4 1 SER A 47 ? ? -86.77 -71.11 5 1 HIS A 48 ? ? 178.56 -60.36 6 1 LYS A 60 ? ? 64.64 69.82 7 1 LEU A 61 ? ? -168.28 30.37 8 1 LEU A 71 ? ? -116.11 -72.13 9 2 VAL A 40 ? ? -34.22 -38.18 10 2 ASP A 43 ? ? -92.25 -83.19 11 2 SER A 47 ? ? -91.93 -72.65 12 2 HIS A 48 ? ? 176.65 -52.28 13 2 LYS A 60 ? ? 68.84 67.24 14 2 LEU A 61 ? ? -168.30 30.69 15 2 LEU A 71 ? ? -96.85 -62.78 16 3 PRO A 22 ? ? -56.34 172.51 17 3 ASP A 43 ? ? -91.65 -80.38 18 3 HIS A 48 ? ? 170.61 -51.03 19 3 LYS A 60 ? ? 68.09 68.73 20 3 LEU A 61 ? ? -167.14 30.50 21 3 LEU A 71 ? ? -125.14 -69.74 22 4 VAL A 40 ? ? -33.95 -37.59 23 4 SER A 47 ? ? -86.94 -71.96 24 4 HIS A 48 ? ? -177.58 -63.76 25 4 LYS A 60 ? ? 69.51 62.71 26 4 LEU A 61 ? ? -166.77 30.49 27 4 LEU A 71 ? ? -118.70 -71.47 28 5 THR A 24 ? ? -152.64 85.26 29 5 SER A 33 ? ? -177.66 137.19 30 5 VAL A 40 ? ? -34.27 -38.23 31 5 ASP A 43 ? ? -91.44 -79.82 32 5 SER A 47 ? ? -88.92 -70.06 33 5 HIS A 48 ? ? 178.23 -54.00 34 5 LYS A 60 ? ? 64.40 68.87 35 5 LEU A 61 ? ? -168.92 31.66 36 5 LEU A 71 ? ? -121.25 -75.79 37 6 VAL A 40 ? ? -34.28 -36.31 38 6 ASP A 43 ? ? -88.52 -77.19 39 6 SER A 47 ? ? -89.85 -70.36 40 6 HIS A 48 ? ? 174.47 -59.78 41 6 LYS A 60 ? ? 69.09 64.11 42 6 LEU A 61 ? ? -167.37 31.08 43 6 LEU A 71 ? ? -120.77 -84.25 44 7 VAL A 40 ? ? -34.44 -36.13 45 7 ASP A 43 ? ? -82.56 -76.33 46 7 SER A 47 ? ? -89.67 -71.10 47 7 HIS A 48 ? ? 177.24 -68.99 48 7 LYS A 60 ? ? 67.12 62.36 49 7 LEU A 61 ? ? -165.56 29.90 50 7 LEU A 72 ? ? -130.91 -56.37 51 8 VAL A 40 ? ? -33.51 -37.52 52 8 ASP A 43 ? ? -85.26 -77.08 53 8 SER A 47 ? ? -90.58 -77.63 54 8 HIS A 48 ? ? -174.47 -64.59 55 8 LYS A 60 ? ? 63.41 65.92 56 8 LEU A 61 ? ? -166.73 29.48 57 8 LEU A 71 ? ? -119.41 -74.54 58 9 ASP A 43 ? ? -87.30 -78.15 59 9 SER A 47 ? ? -90.85 -71.95 60 9 HIS A 48 ? ? 178.30 -57.99 61 9 LYS A 60 ? ? 71.87 65.26 62 9 LEU A 61 ? ? -168.48 30.87 63 10 ASP A 43 ? ? -93.88 -82.02 64 10 SER A 47 ? ? -89.87 -72.85 65 10 HIS A 48 ? ? 178.40 -55.01 66 10 LYS A 60 ? ? 65.63 69.94 67 10 LEU A 61 ? ? -167.38 29.71 68 10 LEU A 71 ? ? -125.28 -74.64 69 10 LEU A 72 ? ? -128.01 -79.03 70 11 THR A 24 ? ? -152.55 85.09 71 11 VAL A 40 ? ? -33.97 -39.01 72 11 ASP A 43 ? ? -91.44 -80.90 73 11 SER A 47 ? ? -89.67 -72.97 74 11 HIS A 48 ? ? 177.59 -51.57 75 11 LYS A 60 ? ? 67.50 67.47 76 11 LEU A 61 ? ? -167.45 29.98 77 11 LEU A 71 ? ? -103.10 -63.24 78 12 SER A 33 ? ? 177.91 139.73 79 12 VAL A 40 ? ? -34.57 -38.23 80 12 ASP A 43 ? ? -89.53 -80.43 81 12 SER A 47 ? ? -91.72 -77.89 82 12 HIS A 48 ? ? -171.74 -66.07 83 12 LYS A 60 ? ? 65.00 67.16 84 12 LEU A 61 ? ? -165.81 29.75 85 12 LEU A 71 ? ? -117.00 -71.24 86 13 THR A 24 ? ? -154.40 83.55 87 13 SER A 33 ? ? -170.50 136.81 88 13 VAL A 40 ? ? -33.65 -38.27 89 13 ASP A 43 ? ? -84.97 -75.80 90 13 SER A 47 ? ? -91.31 -78.89 91 13 HIS A 48 ? ? -175.21 -67.74 92 13 LYS A 60 ? ? 69.10 66.90 93 13 LEU A 61 ? ? -166.23 30.02 94 14 THR A 24 ? ? -151.31 87.44 95 14 VAL A 40 ? ? -35.25 -37.11 96 14 ASP A 43 ? ? -99.77 -88.73 97 14 SER A 47 ? ? -91.64 -67.80 98 14 HIS A 48 ? ? 171.49 -54.39 99 14 LYS A 60 ? ? 64.83 68.80 100 14 LEU A 61 ? ? -167.98 29.91 101 14 LEU A 71 ? ? -109.83 -66.55 102 15 SER A 33 ? ? -172.07 138.23 103 15 VAL A 40 ? ? -33.77 -37.86 104 15 ASP A 43 ? ? -80.32 -73.96 105 15 SER A 47 ? ? -86.92 -71.02 106 15 HIS A 48 ? ? -179.29 -70.39 107 15 LYS A 60 ? ? 71.36 73.79 108 15 LEU A 61 ? ? -167.51 30.77 109 15 ASN A 63 ? ? -71.72 -70.74 110 15 LEU A 71 ? ? -119.12 -77.02 111 16 THR A 24 ? ? -152.76 84.69 112 16 VAL A 40 ? ? -33.89 -38.49 113 16 ASP A 43 ? ? -92.44 -79.88 114 16 SER A 47 ? ? -90.08 -71.96 115 16 HIS A 48 ? ? 178.70 -54.23 116 16 LYS A 60 ? ? 72.20 65.29 117 16 LEU A 61 ? ? -167.58 30.51 118 16 LEU A 71 ? ? -130.28 -74.63 119 17 PRO A 22 ? ? -58.29 170.60 120 17 THR A 24 ? ? -152.35 82.21 121 17 VAL A 40 ? ? -35.30 -36.84 122 17 ASP A 43 ? ? -86.20 -81.51 123 17 SER A 47 ? ? -86.26 -76.78 124 17 HIS A 48 ? ? -171.11 -70.90 125 17 LYS A 60 ? ? 64.97 68.10 126 17 LEU A 61 ? ? -166.52 29.49 127 17 LEU A 71 ? ? -117.72 -76.53 128 18 VAL A 40 ? ? -32.72 -39.36 129 18 ASP A 43 ? ? -83.75 -78.49 130 18 SER A 47 ? ? -89.00 -72.75 131 18 HIS A 48 ? ? -179.07 -64.49 132 18 LYS A 60 ? ? 67.01 69.96 133 18 LEU A 61 ? ? -167.15 28.56 134 19 VAL A 40 ? ? -33.70 -38.53 135 19 ASP A 43 ? ? -83.08 -78.43 136 19 SER A 47 ? ? -90.74 -79.63 137 19 HIS A 48 ? ? -170.88 -68.69 138 19 LYS A 60 ? ? 66.80 66.41 139 19 LEU A 61 ? ? -169.49 28.91 140 19 LEU A 71 ? ? -109.12 -72.51 141 20 ASP A 43 ? ? -93.27 -81.88 142 20 SER A 47 ? ? -93.07 -79.29 143 20 HIS A 48 ? ? -173.20 -48.41 144 20 LYS A 60 ? ? 66.30 66.05 145 20 LEU A 61 ? ? -166.29 31.00 146 20 LEU A 71 ? ? -121.55 -77.86 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria '20 structures for lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 500 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2K47 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2K47 _pdbx_nmr_representative.selection_criteria 'fewest violations' # _pdbx_nmr_sample_details.contents '1.2 mM [U-100% 13C; U-100% 15N] protein, 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample.component protein _pdbx_nmr_exptl_sample.concentration 1.2 _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-100% 13C; U-100% 15N]' _pdbx_nmr_exptl_sample.solution_id 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 7.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D HNCACB' 1 2 1 '4D HC(CCO)NH' 1 3 1 '2D (HB)CB(CGCDCE)HE/(HB)CB(CGCD)HD' 1 4 1 '3D 15N NOESY-HSQC' 1 5 1 '3D aliphatic/aromatic 13C NOESY-HSQC' 1 6 1 '3D methyl selective 13C NOESY-HSQC' 1 7 1 '3D BEST HNCO/HNCOCA' 1 8 1 'R1, R2(CPMG 1H-15N Het NOE' 1 9 1 '3D BEST HNCO/HNCOCA' # _pdbx_nmr_refine.entry_id 2K47 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details 'Atnos-candid using CYANA, then CNS interfaced to the program Sculptor for rdc refinement' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_software.authors ? _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name CNS _pdbx_nmr_software.version ? _pdbx_nmr_software.ordinal 1 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 74 ? A HIS 74 2 1 Y 1 A HIS 75 ? A HIS 75 3 1 Y 1 A HIS 76 ? A HIS 76 4 1 Y 1 A HIS 77 ? A HIS 77 5 1 Y 1 A HIS 78 ? A HIS 78 6 1 Y 1 A HIS 79 ? A HIS 79 7 2 Y 1 A HIS 74 ? A HIS 74 8 2 Y 1 A HIS 75 ? A HIS 75 9 2 Y 1 A HIS 76 ? A HIS 76 10 2 Y 1 A HIS 77 ? A HIS 77 11 2 Y 1 A HIS 78 ? A HIS 78 12 2 Y 1 A HIS 79 ? A HIS 79 13 3 Y 1 A HIS 74 ? A HIS 74 14 3 Y 1 A HIS 75 ? A HIS 75 15 3 Y 1 A HIS 76 ? A HIS 76 16 3 Y 1 A HIS 77 ? A HIS 77 17 3 Y 1 A HIS 78 ? A HIS 78 18 3 Y 1 A HIS 79 ? A HIS 79 19 4 Y 1 A HIS 74 ? A HIS 74 20 4 Y 1 A HIS 75 ? A HIS 75 21 4 Y 1 A HIS 76 ? A HIS 76 22 4 Y 1 A HIS 77 ? A HIS 77 23 4 Y 1 A HIS 78 ? A HIS 78 24 4 Y 1 A HIS 79 ? A HIS 79 25 5 Y 1 A HIS 74 ? A HIS 74 26 5 Y 1 A HIS 75 ? A HIS 75 27 5 Y 1 A HIS 76 ? A HIS 76 28 5 Y 1 A HIS 77 ? A HIS 77 29 5 Y 1 A HIS 78 ? A HIS 78 30 5 Y 1 A HIS 79 ? A HIS 79 31 6 Y 1 A HIS 74 ? A HIS 74 32 6 Y 1 A HIS 75 ? A HIS 75 33 6 Y 1 A HIS 76 ? A HIS 76 34 6 Y 1 A HIS 77 ? A HIS 77 35 6 Y 1 A HIS 78 ? A HIS 78 36 6 Y 1 A HIS 79 ? A HIS 79 37 7 Y 1 A HIS 74 ? A HIS 74 38 7 Y 1 A HIS 75 ? A HIS 75 39 7 Y 1 A HIS 76 ? A HIS 76 40 7 Y 1 A HIS 77 ? A HIS 77 41 7 Y 1 A HIS 78 ? A HIS 78 42 7 Y 1 A HIS 79 ? A HIS 79 43 8 Y 1 A HIS 74 ? A HIS 74 44 8 Y 1 A HIS 75 ? A HIS 75 45 8 Y 1 A HIS 76 ? A HIS 76 46 8 Y 1 A HIS 77 ? A HIS 77 47 8 Y 1 A HIS 78 ? A HIS 78 48 8 Y 1 A HIS 79 ? A HIS 79 49 9 Y 1 A HIS 74 ? A HIS 74 50 9 Y 1 A HIS 75 ? A HIS 75 51 9 Y 1 A HIS 76 ? A HIS 76 52 9 Y 1 A HIS 77 ? A HIS 77 53 9 Y 1 A HIS 78 ? A HIS 78 54 9 Y 1 A HIS 79 ? A HIS 79 55 10 Y 1 A HIS 74 ? A HIS 74 56 10 Y 1 A HIS 75 ? A HIS 75 57 10 Y 1 A HIS 76 ? A HIS 76 58 10 Y 1 A HIS 77 ? A HIS 77 59 10 Y 1 A HIS 78 ? A HIS 78 60 10 Y 1 A HIS 79 ? A HIS 79 61 11 Y 1 A HIS 74 ? A HIS 74 62 11 Y 1 A HIS 75 ? A HIS 75 63 11 Y 1 A HIS 76 ? A HIS 76 64 11 Y 1 A HIS 77 ? A HIS 77 65 11 Y 1 A HIS 78 ? A HIS 78 66 11 Y 1 A HIS 79 ? A HIS 79 67 12 Y 1 A HIS 74 ? A HIS 74 68 12 Y 1 A HIS 75 ? A HIS 75 69 12 Y 1 A HIS 76 ? A HIS 76 70 12 Y 1 A HIS 77 ? A HIS 77 71 12 Y 1 A HIS 78 ? A HIS 78 72 12 Y 1 A HIS 79 ? A HIS 79 73 13 Y 1 A HIS 74 ? A HIS 74 74 13 Y 1 A HIS 75 ? A HIS 75 75 13 Y 1 A HIS 76 ? A HIS 76 76 13 Y 1 A HIS 77 ? A HIS 77 77 13 Y 1 A HIS 78 ? A HIS 78 78 13 Y 1 A HIS 79 ? A HIS 79 79 14 Y 1 A HIS 74 ? A HIS 74 80 14 Y 1 A HIS 75 ? A HIS 75 81 14 Y 1 A HIS 76 ? A HIS 76 82 14 Y 1 A HIS 77 ? A HIS 77 83 14 Y 1 A HIS 78 ? A HIS 78 84 14 Y 1 A HIS 79 ? A HIS 79 85 15 Y 1 A HIS 74 ? A HIS 74 86 15 Y 1 A HIS 75 ? A HIS 75 87 15 Y 1 A HIS 76 ? A HIS 76 88 15 Y 1 A HIS 77 ? A HIS 77 89 15 Y 1 A HIS 78 ? A HIS 78 90 15 Y 1 A HIS 79 ? A HIS 79 91 16 Y 1 A HIS 74 ? A HIS 74 92 16 Y 1 A HIS 75 ? A HIS 75 93 16 Y 1 A HIS 76 ? A HIS 76 94 16 Y 1 A HIS 77 ? A HIS 77 95 16 Y 1 A HIS 78 ? A HIS 78 96 16 Y 1 A HIS 79 ? A HIS 79 97 17 Y 1 A HIS 74 ? A HIS 74 98 17 Y 1 A HIS 75 ? A HIS 75 99 17 Y 1 A HIS 76 ? A HIS 76 100 17 Y 1 A HIS 77 ? A HIS 77 101 17 Y 1 A HIS 78 ? A HIS 78 102 17 Y 1 A HIS 79 ? A HIS 79 103 18 Y 1 A HIS 74 ? A HIS 74 104 18 Y 1 A HIS 75 ? A HIS 75 105 18 Y 1 A HIS 76 ? A HIS 76 106 18 Y 1 A HIS 77 ? A HIS 77 107 18 Y 1 A HIS 78 ? A HIS 78 108 18 Y 1 A HIS 79 ? A HIS 79 109 19 Y 1 A HIS 74 ? A HIS 74 110 19 Y 1 A HIS 75 ? A HIS 75 111 19 Y 1 A HIS 76 ? A HIS 76 112 19 Y 1 A HIS 77 ? A HIS 77 113 19 Y 1 A HIS 78 ? A HIS 78 114 19 Y 1 A HIS 79 ? A HIS 79 115 20 Y 1 A HIS 74 ? A HIS 74 116 20 Y 1 A HIS 75 ? A HIS 75 117 20 Y 1 A HIS 76 ? A HIS 76 118 20 Y 1 A HIS 77 ? A HIS 77 119 20 Y 1 A HIS 78 ? A HIS 78 120 20 Y 1 A HIS 79 ? A HIS 79 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TRP N N N N 304 TRP CA C N S 305 TRP C C N N 306 TRP O O N N 307 TRP CB C N N 308 TRP CG C Y N 309 TRP CD1 C Y N 310 TRP CD2 C Y N 311 TRP NE1 N Y N 312 TRP CE2 C Y N 313 TRP CE3 C Y N 314 TRP CZ2 C Y N 315 TRP CZ3 C Y N 316 TRP CH2 C Y N 317 TRP OXT O N N 318 TRP H H N N 319 TRP H2 H N N 320 TRP HA H N N 321 TRP HB2 H N N 322 TRP HB3 H N N 323 TRP HD1 H N N 324 TRP HE1 H N N 325 TRP HE3 H N N 326 TRP HZ2 H N N 327 TRP HZ3 H N N 328 TRP HH2 H N N 329 TRP HXT H N N 330 TYR N N N N 331 TYR CA C N S 332 TYR C C N N 333 TYR O O N N 334 TYR CB C N N 335 TYR CG C Y N 336 TYR CD1 C Y N 337 TYR CD2 C Y N 338 TYR CE1 C Y N 339 TYR CE2 C Y N 340 TYR CZ C Y N 341 TYR OH O N N 342 TYR OXT O N N 343 TYR H H N N 344 TYR H2 H N N 345 TYR HA H N N 346 TYR HB2 H N N 347 TYR HB3 H N N 348 TYR HD1 H N N 349 TYR HD2 H N N 350 TYR HE1 H N N 351 TYR HE2 H N N 352 TYR HH H N N 353 TYR HXT H N N 354 VAL N N N N 355 VAL CA C N S 356 VAL C C N N 357 VAL O O N N 358 VAL CB C N N 359 VAL CG1 C N N 360 VAL CG2 C N N 361 VAL OXT O N N 362 VAL H H N N 363 VAL H2 H N N 364 VAL HA H N N 365 VAL HB H N N 366 VAL HG11 H N N 367 VAL HG12 H N N 368 VAL HG13 H N N 369 VAL HG21 H N N 370 VAL HG22 H N N 371 VAL HG23 H N N 372 VAL HXT H N N 373 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TRP N CA sing N N 291 TRP N H sing N N 292 TRP N H2 sing N N 293 TRP CA C sing N N 294 TRP CA CB sing N N 295 TRP CA HA sing N N 296 TRP C O doub N N 297 TRP C OXT sing N N 298 TRP CB CG sing N N 299 TRP CB HB2 sing N N 300 TRP CB HB3 sing N N 301 TRP CG CD1 doub Y N 302 TRP CG CD2 sing Y N 303 TRP CD1 NE1 sing Y N 304 TRP CD1 HD1 sing N N 305 TRP CD2 CE2 doub Y N 306 TRP CD2 CE3 sing Y N 307 TRP NE1 CE2 sing Y N 308 TRP NE1 HE1 sing N N 309 TRP CE2 CZ2 sing Y N 310 TRP CE3 CZ3 doub Y N 311 TRP CE3 HE3 sing N N 312 TRP CZ2 CH2 doub Y N 313 TRP CZ2 HZ2 sing N N 314 TRP CZ3 CH2 sing Y N 315 TRP CZ3 HZ3 sing N N 316 TRP CH2 HH2 sing N N 317 TRP OXT HXT sing N N 318 TYR N CA sing N N 319 TYR N H sing N N 320 TYR N H2 sing N N 321 TYR CA C sing N N 322 TYR CA CB sing N N 323 TYR CA HA sing N N 324 TYR C O doub N N 325 TYR C OXT sing N N 326 TYR CB CG sing N N 327 TYR CB HB2 sing N N 328 TYR CB HB3 sing N N 329 TYR CG CD1 doub Y N 330 TYR CG CD2 sing Y N 331 TYR CD1 CE1 sing Y N 332 TYR CD1 HD1 sing N N 333 TYR CD2 CE2 doub Y N 334 TYR CD2 HD2 sing N N 335 TYR CE1 CZ doub Y N 336 TYR CE1 HE1 sing N N 337 TYR CE2 CZ sing Y N 338 TYR CE2 HE2 sing N N 339 TYR CZ OH sing N N 340 TYR OH HH sing N N 341 TYR OXT HXT sing N N 342 VAL N CA sing N N 343 VAL N H sing N N 344 VAL N H2 sing N N 345 VAL CA C sing N N 346 VAL CA CB sing N N 347 VAL CA HA sing N N 348 VAL C O doub N N 349 VAL C OXT sing N N 350 VAL CB CG1 sing N N 351 VAL CB CG2 sing N N 352 VAL CB HB sing N N 353 VAL CG1 HG11 sing N N 354 VAL CG1 HG12 sing N N 355 VAL CG1 HG13 sing N N 356 VAL CG2 HG21 sing N N 357 VAL CG2 HG22 sing N N 358 VAL CG2 HG23 sing N N 359 VAL OXT HXT sing N N 360 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Varian INOVA 1 'Varian Inova' 800 Varian INOVA 2 'Varian INOVA' # _atom_sites.entry_id 2K47 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_