data_2K4N # _entry.id 2K4N # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2K4N pdb_00002k4n 10.2210/pdb2k4n/pdb RCSB RCSB100670 ? ? BMRB 15805 ? 10.13018/BMR15805 WWPDB D_1000100670 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-08-12 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-19 4 'Structure model' 1 3 2023-06-14 5 'Structure model' 1 4 2024-05-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Derived calculations' 4 3 'Structure model' Other 5 4 'Structure model' 'Database references' 6 4 'Structure model' Other 7 5 'Structure model' 'Data collection' 8 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' pdbx_database_status 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' database_2 6 4 'Structure model' pdbx_database_status 7 5 'Structure model' chem_comp_atom 8 5 'Structure model' chem_comp_bond 9 5 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_software.name' 3 4 'Structure model' '_database_2.pdbx_DOI' 4 4 'Structure model' '_database_2.pdbx_database_accession' 5 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 6 5 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2K4N _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2008-06-13 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 15805 BMRB unspecified . PfR75 TargetDB unspecified . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Cort, J.R.' 1 'Ho, C.K.' 2 'Shetty, K.' 3 'Cunningham, K.' 4 'Ma, L.' 5 'Xiao, R.' 6 'Liu, J.' 7 'Baran, M.C.' 8 'Swapna, G.' 9 'Acton, T.B.' 10 'Rost, B.' 11 'Montelione, G.T.' 12 'Kennedy, M.A.' 13 'Northeast Structural Genomics Consortium (NESG)' 14 # _citation.id primary _citation.title 'Solution-State NMR Structure of protein PF0246 from Pyrococcus Furiosis' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # _citation_author.citation_id primary _citation_author.name 'Cort, J.R.' _citation_author.ordinal 1 _citation_author.identifier_ORCID ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Protein PF0246' _entity.formula_weight 13459.262 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MNSEVIKEFLEDIGEDYIELENEIHLKPEVFYEVWKYVGEPELKTYVIEDEIVEPGEYDPPEMKYTNVKKVKIKKVYFET LDNVRVVTDYSEFQKILKKRGTKLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MNSEVIKEFLEDIGEDYIELENEIHLKPEVFYEVWKYVGEPELKTYVIEDEIVEPGEYDPPEMKYTNVKKVKIKKVYFET LDNVRVVTDYSEFQKILKKRGTKLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier PfR75 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASN n 1 3 SER n 1 4 GLU n 1 5 VAL n 1 6 ILE n 1 7 LYS n 1 8 GLU n 1 9 PHE n 1 10 LEU n 1 11 GLU n 1 12 ASP n 1 13 ILE n 1 14 GLY n 1 15 GLU n 1 16 ASP n 1 17 TYR n 1 18 ILE n 1 19 GLU n 1 20 LEU n 1 21 GLU n 1 22 ASN n 1 23 GLU n 1 24 ILE n 1 25 HIS n 1 26 LEU n 1 27 LYS n 1 28 PRO n 1 29 GLU n 1 30 VAL n 1 31 PHE n 1 32 TYR n 1 33 GLU n 1 34 VAL n 1 35 TRP n 1 36 LYS n 1 37 TYR n 1 38 VAL n 1 39 GLY n 1 40 GLU n 1 41 PRO n 1 42 GLU n 1 43 LEU n 1 44 LYS n 1 45 THR n 1 46 TYR n 1 47 VAL n 1 48 ILE n 1 49 GLU n 1 50 ASP n 1 51 GLU n 1 52 ILE n 1 53 VAL n 1 54 GLU n 1 55 PRO n 1 56 GLY n 1 57 GLU n 1 58 TYR n 1 59 ASP n 1 60 PRO n 1 61 PRO n 1 62 GLU n 1 63 MET n 1 64 LYS n 1 65 TYR n 1 66 THR n 1 67 ASN n 1 68 VAL n 1 69 LYS n 1 70 LYS n 1 71 VAL n 1 72 LYS n 1 73 ILE n 1 74 LYS n 1 75 LYS n 1 76 VAL n 1 77 TYR n 1 78 PHE n 1 79 GLU n 1 80 THR n 1 81 LEU n 1 82 ASP n 1 83 ASN n 1 84 VAL n 1 85 ARG n 1 86 VAL n 1 87 VAL n 1 88 THR n 1 89 ASP n 1 90 TYR n 1 91 SER n 1 92 GLU n 1 93 PHE n 1 94 GLN n 1 95 LYS n 1 96 ILE n 1 97 LEU n 1 98 LYS n 1 99 LYS n 1 100 ARG n 1 101 GLY n 1 102 THR n 1 103 LYS n 1 104 LEU n 1 105 GLU n 1 106 HIS n 1 107 HIS n 1 108 HIS n 1 109 HIS n 1 110 HIS n 1 111 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Pyrococcus _entity_src_gen.pdbx_gene_src_gene PF0246 _entity_src_gen.gene_src_species furiosus _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pyrococcus furiosus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2261 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species coli _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)+Magic' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET21 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASN 2 2 2 ASN ASN A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 TYR 17 17 17 TYR TYR A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 HIS 25 25 25 HIS HIS A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 PHE 31 31 31 PHE PHE A . n A 1 32 TYR 32 32 32 TYR TYR A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 TRP 35 35 35 TRP TRP A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 PRO 41 41 41 PRO PRO A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 TYR 46 46 46 TYR TYR A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 TYR 58 58 58 TYR TYR A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 PRO 61 61 61 PRO PRO A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 MET 63 63 63 MET MET A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 TYR 65 65 65 TYR TYR A . n A 1 66 THR 66 66 66 THR THR A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 TYR 77 77 77 TYR TYR A . n A 1 78 PHE 78 78 78 PHE PHE A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 ASP 82 82 82 ASP ASP A . n A 1 83 ASN 83 83 83 ASN ASN A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 THR 88 88 88 THR THR A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 TYR 90 90 90 TYR TYR A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 PHE 93 93 93 PHE PHE A . n A 1 94 GLN 94 94 94 GLN GLN A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 ARG 100 100 100 ARG ARG A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 THR 102 102 102 THR THR A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 HIS 106 106 106 HIS HIS A . n A 1 107 HIS 107 107 107 HIS HIS A . n A 1 108 HIS 108 108 108 HIS HIS A . n A 1 109 HIS 109 109 109 HIS HIS A . n A 1 110 HIS 110 110 110 HIS HIS A . n A 1 111 HIS 111 111 111 HIS HIS A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2K4N _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2K4N _struct.title 'NMR structure of protein PF0246 from Pyrococcus furiosus: target PfR75 from the Northeast Structural Genomics Consortium' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag Y _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2K4N _struct_keywords.pdbx_keywords 'structural genomics, unknown function' _struct_keywords.text ;beta-sheet, alpha-helix, mobile loop, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, unknown function ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8U449_PYRFU _struct_ref.pdbx_db_accession Q8U449 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MNSEVIKEFLEDIGEDYIELENEIHLKPEVFYEVWKYVGEPELKTYVIEDEIVEPGEYDPPEMKYTNVKKVKIKKVYFET LDNVRVVTDYSEFQKILKKRGTK ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2K4N _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 103 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8U449 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 103 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 103 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2K4N LEU A 104 ? UNP Q8U449 ? ? 'expression tag' 104 1 1 2K4N GLU A 105 ? UNP Q8U449 ? ? 'expression tag' 105 2 1 2K4N HIS A 106 ? UNP Q8U449 ? ? 'expression tag' 106 3 1 2K4N HIS A 107 ? UNP Q8U449 ? ? 'expression tag' 107 4 1 2K4N HIS A 108 ? UNP Q8U449 ? ? 'expression tag' 108 5 1 2K4N HIS A 109 ? UNP Q8U449 ? ? 'expression tag' 109 6 1 2K4N HIS A 110 ? UNP Q8U449 ? ? 'expression tag' 110 7 1 2K4N HIS A 111 ? UNP Q8U449 ? ? 'expression tag' 111 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 2 ? GLY A 14 ? ASN A 2 GLY A 14 1 ? 13 HELX_P HELX_P2 2 LYS A 27 ? VAL A 38 ? LYS A 27 VAL A 38 1 ? 12 HELX_P HELX_P3 3 TYR A 90 ? GLY A 101 ? TYR A 90 GLY A 101 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 18 ? GLU A 19 ? ILE A 18 GLU A 19 A 2 GLU A 23 ? HIS A 25 ? GLU A 23 HIS A 25 A 3 ARG A 85 ? ASP A 89 ? ARG A 85 ASP A 89 A 4 LYS A 69 ? GLU A 79 ? LYS A 69 GLU A 79 A 5 LYS A 44 ? ILE A 52 ? LYS A 44 ILE A 52 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 18 ? N ILE A 18 O HIS A 25 ? O HIS A 25 A 2 3 N ILE A 24 ? N ILE A 24 O ARG A 85 ? O ARG A 85 A 3 4 O THR A 88 ? O THR A 88 N VAL A 76 ? N VAL A 76 A 4 5 O LYS A 75 ? O LYS A 75 N TYR A 46 ? N TYR A 46 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HZ3 A LYS 36 ? ? OE1 A GLU 40 ? ? 1.59 2 2 OE2 A GLU 15 ? ? HZ1 A LYS 27 ? ? 1.56 3 2 OE2 A GLU 57 ? ? HZ2 A LYS 64 ? ? 1.59 4 4 HZ2 A LYS 36 ? ? OE2 A GLU 40 ? ? 1.57 5 5 HD2 A PRO 60 ? ? HE1 A TYR 65 ? ? 1.24 6 9 OE2 A GLU 49 ? ? HZ2 A LYS 72 ? ? 1.59 7 10 HZ3 A LYS 36 ? ? OE2 A GLU 40 ? ? 1.59 8 11 OE1 A GLU 15 ? ? HZ2 A LYS 27 ? ? 1.58 9 11 OE2 A GLU 49 ? ? HZ2 A LYS 72 ? ? 1.60 10 12 HZ1 A LYS 7 ? ? OE2 A GLU 19 ? ? 1.57 11 14 HZ2 A LYS 36 ? ? OE2 A GLU 40 ? ? 1.60 12 15 HZ2 A LYS 7 ? ? OE1 A GLU 19 ? ? 1.53 13 16 HE1 A PHE 31 ? ? HE1 A PHE 78 ? ? 1.20 14 16 HG22 A ILE 48 ? ? HG13 A ILE 73 ? ? 1.34 15 17 HZ3 A LYS 7 ? ? OE2 A GLU 19 ? ? 1.57 16 19 HG1 A THR 80 ? ? OD1 A ASP 82 ? ? 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 21 ? ? 69.80 101.12 2 1 GLU A 40 ? ? 40.69 81.36 3 1 ASP A 59 ? ? -141.12 -52.89 4 1 GLU A 62 ? ? -69.61 87.43 5 1 MET A 63 ? ? -164.24 -45.60 6 1 HIS A 109 ? ? -81.07 38.19 7 2 GLU A 40 ? ? 57.22 70.45 8 2 THR A 66 ? ? -123.54 -61.08 9 3 GLU A 40 ? ? 59.99 70.11 10 3 PRO A 55 ? ? -100.16 70.18 11 3 GLU A 105 ? ? 63.23 -175.51 12 3 HIS A 106 ? ? -100.64 79.93 13 3 HIS A 110 ? ? -100.50 -63.07 14 4 GLU A 40 ? ? 59.49 75.12 15 4 ILE A 52 ? ? 36.49 -104.31 16 5 GLU A 21 ? ? 59.30 71.50 17 5 GLU A 40 ? ? 57.59 78.29 18 6 GLU A 21 ? ? -68.21 99.79 19 6 GLU A 62 ? ? -93.70 -159.41 20 6 GLU A 105 ? ? 58.27 -165.58 21 6 HIS A 106 ? ? -105.39 65.87 22 6 HIS A 110 ? ? -156.50 -47.08 23 7 ASN A 22 ? ? 80.48 2.95 24 7 GLU A 40 ? ? 55.25 78.39 25 7 ILE A 52 ? ? 68.19 91.61 26 7 PRO A 61 ? ? -65.07 94.50 27 8 GLU A 40 ? ? 57.09 72.78 28 8 GLU A 51 ? ? -140.87 -62.99 29 9 PRO A 55 ? ? -31.93 110.24 30 9 HIS A 106 ? ? 57.77 87.35 31 10 GLU A 40 ? ? 57.02 76.03 32 10 GLU A 57 ? ? -65.32 76.44 33 10 TYR A 58 ? ? -145.84 -80.18 34 10 ASP A 59 ? ? 172.37 101.27 35 10 MET A 63 ? ? -102.62 -167.79 36 10 HIS A 107 ? ? -82.95 42.33 37 10 HIS A 108 ? ? -130.40 -40.58 38 11 LEU A 20 ? ? -116.07 -166.40 39 11 GLU A 40 ? ? 37.17 65.82 40 11 GLU A 51 ? ? 60.46 -133.62 41 11 ILE A 52 ? ? 72.25 -63.80 42 11 HIS A 109 ? ? -78.92 41.50 43 11 HIS A 110 ? ? -170.32 -39.81 44 12 GLU A 21 ? ? -69.56 92.73 45 12 GLU A 40 ? ? 58.24 78.33 46 12 GLU A 62 ? ? -90.23 -158.06 47 12 THR A 66 ? ? -76.49 45.10 48 12 LYS A 103 ? ? 57.62 70.07 49 12 HIS A 108 ? ? -77.34 42.08 50 12 HIS A 109 ? ? -172.39 -7.29 51 12 HIS A 110 ? ? 68.30 -62.68 52 13 LEU A 20 ? ? -101.32 -161.86 53 13 GLU A 21 ? ? -66.37 96.09 54 13 TYR A 65 ? ? -104.72 56.73 55 14 LEU A 20 ? ? -120.39 -161.65 56 14 GLU A 40 ? ? 57.77 72.17 57 15 GLU A 40 ? ? 61.70 84.59 58 15 GLU A 51 ? ? -179.51 -81.65 59 15 GLU A 62 ? ? -105.60 -165.07 60 15 HIS A 110 ? ? -105.88 -71.93 61 16 GLU A 40 ? ? 44.67 87.09 62 16 ASP A 59 ? ? 60.32 81.82 63 17 GLU A 40 ? ? 170.98 61.06 64 17 ILE A 52 ? ? 69.02 94.40 65 17 LYS A 103 ? ? -178.13 142.19 66 18 GLU A 40 ? ? 48.75 73.09 67 18 LYS A 64 ? ? -120.66 -162.22 68 18 GLU A 105 ? ? -91.83 -63.17 69 18 HIS A 109 ? ? -57.73 -71.79 70 18 HIS A 110 ? ? 174.00 -68.22 71 19 LEU A 20 ? ? -95.16 46.49 72 19 GLU A 21 ? ? 66.62 94.79 73 19 ASN A 22 ? ? 73.18 -8.25 74 19 PRO A 28 ? ? -42.56 -70.42 75 19 PRO A 61 ? ? -72.44 43.67 76 19 LYS A 103 ? ? -106.27 69.89 77 19 HIS A 110 ? ? 67.51 -81.62 78 20 LEU A 20 ? ? -121.44 -162.24 79 20 GLU A 40 ? ? 36.42 75.21 80 20 PRO A 41 ? ? -89.01 -159.32 81 20 ILE A 52 ? ? 63.72 85.63 # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with lowest energy and fewest restraint violations' _pdbx_nmr_ensemble.conformers_calculated_total_number 30 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2K4N _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2K4N _pdbx_nmr_representative.selection_criteria 'no criteria used' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;1 mM [U-100% 13C; U-100% 15N] PA0426, 95 % H2O, 5 % [U-100% 2H] D2O, 100 mM sodium chloride, 20 mM MES, 5 mM calcium chloride, 0.02 % sodium azide, 95% H2O/5% D2O ; 1 '95% H2O/5% D2O' ;1 mM [U-100% 13C; U-100% 15N] PA0426, 100 % [U-100% 2H] D2O, 100 mM sodium chloride, 20 mM MES, 5 mM calcium chloride, 0.02 % sodium azide, 100% D2O ; 2 '100% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id PA0426 1 mM '[U-100% 13C; U-100% 15N]' 1 H2O 95 % ? 1 D2O 5 % '[U-100% 2H]' 1 'sodium chloride' 100 mM ? 1 MES 20 mM ? 1 'calcium chloride' 5 mM ? 1 'sodium azide' 0.02 % ? 1 PA0426 1 mM '[U-100% 13C; U-100% 15N]' 2 D2O 100 % '[U-100% 2H]' 2 'sodium chloride' 100 mM ? 2 MES 20 mM ? 2 'calcium chloride' 5 mM ? 2 'sodium azide' 0.02 % ? 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 150 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 313 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D HNCACB' 1 5 1 '3D HCCH-TOCSY' 1 6 1 '3D 1H-15N NOESY' 1 7 1 '3D 1H-13C NOESY' 1 8 1 '3D HCCH-COSY' 1 9 2 '4D 13C-13C HMQC NOESY' # _pdbx_nmr_refine.entry_id 2K4N _pdbx_nmr_refine.method 'torsion angle dynamics, simulated annealing' _pdbx_nmr_refine.details 'initial structures generated with AutoStructure, Structures were refined with XPLOR-NIH and CNS' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Accelrys Software Inc.' processing Felix 98 1 'Accelrys Software Inc.' 'data analysis' Felix 98 2 Goddard 'data analysis' Sparky ? 3 Goddard 'peak picking' Sparky ? 4 'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution' 'X-PLOR NIH' ? 5 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' ? 6 'Huang, Tejero, Powers and Montelione' 'structure solution' AutoStructure ? 7 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 8 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ARG N N N N 1 ARG CA C N S 2 ARG C C N N 3 ARG O O N N 4 ARG CB C N N 5 ARG CG C N N 6 ARG CD C N N 7 ARG NE N N N 8 ARG CZ C N N 9 ARG NH1 N N N 10 ARG NH2 N N N 11 ARG OXT O N N 12 ARG H H N N 13 ARG H2 H N N 14 ARG HA H N N 15 ARG HB2 H N N 16 ARG HB3 H N N 17 ARG HG2 H N N 18 ARG HG3 H N N 19 ARG HD2 H N N 20 ARG HD3 H N N 21 ARG HE H N N 22 ARG HH11 H N N 23 ARG HH12 H N N 24 ARG HH21 H N N 25 ARG HH22 H N N 26 ARG HXT H N N 27 ASN N N N N 28 ASN CA C N S 29 ASN C C N N 30 ASN O O N N 31 ASN CB C N N 32 ASN CG C N N 33 ASN OD1 O N N 34 ASN ND2 N N N 35 ASN OXT O N N 36 ASN H H N N 37 ASN H2 H N N 38 ASN HA H N N 39 ASN HB2 H N N 40 ASN HB3 H N N 41 ASN HD21 H N N 42 ASN HD22 H N N 43 ASN HXT H N N 44 ASP N N N N 45 ASP CA C N S 46 ASP C C N N 47 ASP O O N N 48 ASP CB C N N 49 ASP CG C N N 50 ASP OD1 O N N 51 ASP OD2 O N N 52 ASP OXT O N N 53 ASP H H N N 54 ASP H2 H N N 55 ASP HA H N N 56 ASP HB2 H N N 57 ASP HB3 H N N 58 ASP HD2 H N N 59 ASP HXT H N N 60 GLN N N N N 61 GLN CA C N S 62 GLN C C N N 63 GLN O O N N 64 GLN CB C N N 65 GLN CG C N N 66 GLN CD C N N 67 GLN OE1 O N N 68 GLN NE2 N N N 69 GLN OXT O N N 70 GLN H H N N 71 GLN H2 H N N 72 GLN HA H N N 73 GLN HB2 H N N 74 GLN HB3 H N N 75 GLN HG2 H N N 76 GLN HG3 H N N 77 GLN HE21 H N N 78 GLN HE22 H N N 79 GLN HXT H N N 80 GLU N N N N 81 GLU CA C N S 82 GLU C C N N 83 GLU O O N N 84 GLU CB C N N 85 GLU CG C N N 86 GLU CD C N N 87 GLU OE1 O N N 88 GLU OE2 O N N 89 GLU OXT O N N 90 GLU H H N N 91 GLU H2 H N N 92 GLU HA H N N 93 GLU HB2 H N N 94 GLU HB3 H N N 95 GLU HG2 H N N 96 GLU HG3 H N N 97 GLU HE2 H N N 98 GLU HXT H N N 99 GLY N N N N 100 GLY CA C N N 101 GLY C C N N 102 GLY O O N N 103 GLY OXT O N N 104 GLY H H N N 105 GLY H2 H N N 106 GLY HA2 H N N 107 GLY HA3 H N N 108 GLY HXT H N N 109 HIS N N N N 110 HIS CA C N S 111 HIS C C N N 112 HIS O O N N 113 HIS CB C N N 114 HIS CG C Y N 115 HIS ND1 N Y N 116 HIS CD2 C Y N 117 HIS CE1 C Y N 118 HIS NE2 N Y N 119 HIS OXT O N N 120 HIS H H N N 121 HIS H2 H N N 122 HIS HA H N N 123 HIS HB2 H N N 124 HIS HB3 H N N 125 HIS HD1 H N N 126 HIS HD2 H N N 127 HIS HE1 H N N 128 HIS HE2 H N N 129 HIS HXT H N N 130 ILE N N N N 131 ILE CA C N S 132 ILE C C N N 133 ILE O O N N 134 ILE CB C N S 135 ILE CG1 C N N 136 ILE CG2 C N N 137 ILE CD1 C N N 138 ILE OXT O N N 139 ILE H H N N 140 ILE H2 H N N 141 ILE HA H N N 142 ILE HB H N N 143 ILE HG12 H N N 144 ILE HG13 H N N 145 ILE HG21 H N N 146 ILE HG22 H N N 147 ILE HG23 H N N 148 ILE HD11 H N N 149 ILE HD12 H N N 150 ILE HD13 H N N 151 ILE HXT H N N 152 LEU N N N N 153 LEU CA C N S 154 LEU C C N N 155 LEU O O N N 156 LEU CB C N N 157 LEU CG C N N 158 LEU CD1 C N N 159 LEU CD2 C N N 160 LEU OXT O N N 161 LEU H H N N 162 LEU H2 H N N 163 LEU HA H N N 164 LEU HB2 H N N 165 LEU HB3 H N N 166 LEU HG H N N 167 LEU HD11 H N N 168 LEU HD12 H N N 169 LEU HD13 H N N 170 LEU HD21 H N N 171 LEU HD22 H N N 172 LEU HD23 H N N 173 LEU HXT H N N 174 LYS N N N N 175 LYS CA C N S 176 LYS C C N N 177 LYS O O N N 178 LYS CB C N N 179 LYS CG C N N 180 LYS CD C N N 181 LYS CE C N N 182 LYS NZ N N N 183 LYS OXT O N N 184 LYS H H N N 185 LYS H2 H N N 186 LYS HA H N N 187 LYS HB2 H N N 188 LYS HB3 H N N 189 LYS HG2 H N N 190 LYS HG3 H N N 191 LYS HD2 H N N 192 LYS HD3 H N N 193 LYS HE2 H N N 194 LYS HE3 H N N 195 LYS HZ1 H N N 196 LYS HZ2 H N N 197 LYS HZ3 H N N 198 LYS HXT H N N 199 MET N N N N 200 MET CA C N S 201 MET C C N N 202 MET O O N N 203 MET CB C N N 204 MET CG C N N 205 MET SD S N N 206 MET CE C N N 207 MET OXT O N N 208 MET H H N N 209 MET H2 H N N 210 MET HA H N N 211 MET HB2 H N N 212 MET HB3 H N N 213 MET HG2 H N N 214 MET HG3 H N N 215 MET HE1 H N N 216 MET HE2 H N N 217 MET HE3 H N N 218 MET HXT H N N 219 PHE N N N N 220 PHE CA C N S 221 PHE C C N N 222 PHE O O N N 223 PHE CB C N N 224 PHE CG C Y N 225 PHE CD1 C Y N 226 PHE CD2 C Y N 227 PHE CE1 C Y N 228 PHE CE2 C Y N 229 PHE CZ C Y N 230 PHE OXT O N N 231 PHE H H N N 232 PHE H2 H N N 233 PHE HA H N N 234 PHE HB2 H N N 235 PHE HB3 H N N 236 PHE HD1 H N N 237 PHE HD2 H N N 238 PHE HE1 H N N 239 PHE HE2 H N N 240 PHE HZ H N N 241 PHE HXT H N N 242 PRO N N N N 243 PRO CA C N S 244 PRO C C N N 245 PRO O O N N 246 PRO CB C N N 247 PRO CG C N N 248 PRO CD C N N 249 PRO OXT O N N 250 PRO H H N N 251 PRO HA H N N 252 PRO HB2 H N N 253 PRO HB3 H N N 254 PRO HG2 H N N 255 PRO HG3 H N N 256 PRO HD2 H N N 257 PRO HD3 H N N 258 PRO HXT H N N 259 SER N N N N 260 SER CA C N S 261 SER C C N N 262 SER O O N N 263 SER CB C N N 264 SER OG O N N 265 SER OXT O N N 266 SER H H N N 267 SER H2 H N N 268 SER HA H N N 269 SER HB2 H N N 270 SER HB3 H N N 271 SER HG H N N 272 SER HXT H N N 273 THR N N N N 274 THR CA C N S 275 THR C C N N 276 THR O O N N 277 THR CB C N R 278 THR OG1 O N N 279 THR CG2 C N N 280 THR OXT O N N 281 THR H H N N 282 THR H2 H N N 283 THR HA H N N 284 THR HB H N N 285 THR HG1 H N N 286 THR HG21 H N N 287 THR HG22 H N N 288 THR HG23 H N N 289 THR HXT H N N 290 TRP N N N N 291 TRP CA C N S 292 TRP C C N N 293 TRP O O N N 294 TRP CB C N N 295 TRP CG C Y N 296 TRP CD1 C Y N 297 TRP CD2 C Y N 298 TRP NE1 N Y N 299 TRP CE2 C Y N 300 TRP CE3 C Y N 301 TRP CZ2 C Y N 302 TRP CZ3 C Y N 303 TRP CH2 C Y N 304 TRP OXT O N N 305 TRP H H N N 306 TRP H2 H N N 307 TRP HA H N N 308 TRP HB2 H N N 309 TRP HB3 H N N 310 TRP HD1 H N N 311 TRP HE1 H N N 312 TRP HE3 H N N 313 TRP HZ2 H N N 314 TRP HZ3 H N N 315 TRP HH2 H N N 316 TRP HXT H N N 317 TYR N N N N 318 TYR CA C N S 319 TYR C C N N 320 TYR O O N N 321 TYR CB C N N 322 TYR CG C Y N 323 TYR CD1 C Y N 324 TYR CD2 C Y N 325 TYR CE1 C Y N 326 TYR CE2 C Y N 327 TYR CZ C Y N 328 TYR OH O N N 329 TYR OXT O N N 330 TYR H H N N 331 TYR H2 H N N 332 TYR HA H N N 333 TYR HB2 H N N 334 TYR HB3 H N N 335 TYR HD1 H N N 336 TYR HD2 H N N 337 TYR HE1 H N N 338 TYR HE2 H N N 339 TYR HH H N N 340 TYR HXT H N N 341 VAL N N N N 342 VAL CA C N S 343 VAL C C N N 344 VAL O O N N 345 VAL CB C N N 346 VAL CG1 C N N 347 VAL CG2 C N N 348 VAL OXT O N N 349 VAL H H N N 350 VAL H2 H N N 351 VAL HA H N N 352 VAL HB H N N 353 VAL HG11 H N N 354 VAL HG12 H N N 355 VAL HG13 H N N 356 VAL HG21 H N N 357 VAL HG22 H N N 358 VAL HG23 H N N 359 VAL HXT H N N 360 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ARG N CA sing N N 1 ARG N H sing N N 2 ARG N H2 sing N N 3 ARG CA C sing N N 4 ARG CA CB sing N N 5 ARG CA HA sing N N 6 ARG C O doub N N 7 ARG C OXT sing N N 8 ARG CB CG sing N N 9 ARG CB HB2 sing N N 10 ARG CB HB3 sing N N 11 ARG CG CD sing N N 12 ARG CG HG2 sing N N 13 ARG CG HG3 sing N N 14 ARG CD NE sing N N 15 ARG CD HD2 sing N N 16 ARG CD HD3 sing N N 17 ARG NE CZ sing N N 18 ARG NE HE sing N N 19 ARG CZ NH1 sing N N 20 ARG CZ NH2 doub N N 21 ARG NH1 HH11 sing N N 22 ARG NH1 HH12 sing N N 23 ARG NH2 HH21 sing N N 24 ARG NH2 HH22 sing N N 25 ARG OXT HXT sing N N 26 ASN N CA sing N N 27 ASN N H sing N N 28 ASN N H2 sing N N 29 ASN CA C sing N N 30 ASN CA CB sing N N 31 ASN CA HA sing N N 32 ASN C O doub N N 33 ASN C OXT sing N N 34 ASN CB CG sing N N 35 ASN CB HB2 sing N N 36 ASN CB HB3 sing N N 37 ASN CG OD1 doub N N 38 ASN CG ND2 sing N N 39 ASN ND2 HD21 sing N N 40 ASN ND2 HD22 sing N N 41 ASN OXT HXT sing N N 42 ASP N CA sing N N 43 ASP N H sing N N 44 ASP N H2 sing N N 45 ASP CA C sing N N 46 ASP CA CB sing N N 47 ASP CA HA sing N N 48 ASP C O doub N N 49 ASP C OXT sing N N 50 ASP CB CG sing N N 51 ASP CB HB2 sing N N 52 ASP CB HB3 sing N N 53 ASP CG OD1 doub N N 54 ASP CG OD2 sing N N 55 ASP OD2 HD2 sing N N 56 ASP OXT HXT sing N N 57 GLN N CA sing N N 58 GLN N H sing N N 59 GLN N H2 sing N N 60 GLN CA C sing N N 61 GLN CA CB sing N N 62 GLN CA HA sing N N 63 GLN C O doub N N 64 GLN C OXT sing N N 65 GLN CB CG sing N N 66 GLN CB HB2 sing N N 67 GLN CB HB3 sing N N 68 GLN CG CD sing N N 69 GLN CG HG2 sing N N 70 GLN CG HG3 sing N N 71 GLN CD OE1 doub N N 72 GLN CD NE2 sing N N 73 GLN NE2 HE21 sing N N 74 GLN NE2 HE22 sing N N 75 GLN OXT HXT sing N N 76 GLU N CA sing N N 77 GLU N H sing N N 78 GLU N H2 sing N N 79 GLU CA C sing N N 80 GLU CA CB sing N N 81 GLU CA HA sing N N 82 GLU C O doub N N 83 GLU C OXT sing N N 84 GLU CB CG sing N N 85 GLU CB HB2 sing N N 86 GLU CB HB3 sing N N 87 GLU CG CD sing N N 88 GLU CG HG2 sing N N 89 GLU CG HG3 sing N N 90 GLU CD OE1 doub N N 91 GLU CD OE2 sing N N 92 GLU OE2 HE2 sing N N 93 GLU OXT HXT sing N N 94 GLY N CA sing N N 95 GLY N H sing N N 96 GLY N H2 sing N N 97 GLY CA C sing N N 98 GLY CA HA2 sing N N 99 GLY CA HA3 sing N N 100 GLY C O doub N N 101 GLY C OXT sing N N 102 GLY OXT HXT sing N N 103 HIS N CA sing N N 104 HIS N H sing N N 105 HIS N H2 sing N N 106 HIS CA C sing N N 107 HIS CA CB sing N N 108 HIS CA HA sing N N 109 HIS C O doub N N 110 HIS C OXT sing N N 111 HIS CB CG sing N N 112 HIS CB HB2 sing N N 113 HIS CB HB3 sing N N 114 HIS CG ND1 sing Y N 115 HIS CG CD2 doub Y N 116 HIS ND1 CE1 doub Y N 117 HIS ND1 HD1 sing N N 118 HIS CD2 NE2 sing Y N 119 HIS CD2 HD2 sing N N 120 HIS CE1 NE2 sing Y N 121 HIS CE1 HE1 sing N N 122 HIS NE2 HE2 sing N N 123 HIS OXT HXT sing N N 124 ILE N CA sing N N 125 ILE N H sing N N 126 ILE N H2 sing N N 127 ILE CA C sing N N 128 ILE CA CB sing N N 129 ILE CA HA sing N N 130 ILE C O doub N N 131 ILE C OXT sing N N 132 ILE CB CG1 sing N N 133 ILE CB CG2 sing N N 134 ILE CB HB sing N N 135 ILE CG1 CD1 sing N N 136 ILE CG1 HG12 sing N N 137 ILE CG1 HG13 sing N N 138 ILE CG2 HG21 sing N N 139 ILE CG2 HG22 sing N N 140 ILE CG2 HG23 sing N N 141 ILE CD1 HD11 sing N N 142 ILE CD1 HD12 sing N N 143 ILE CD1 HD13 sing N N 144 ILE OXT HXT sing N N 145 LEU N CA sing N N 146 LEU N H sing N N 147 LEU N H2 sing N N 148 LEU CA C sing N N 149 LEU CA CB sing N N 150 LEU CA HA sing N N 151 LEU C O doub N N 152 LEU C OXT sing N N 153 LEU CB CG sing N N 154 LEU CB HB2 sing N N 155 LEU CB HB3 sing N N 156 LEU CG CD1 sing N N 157 LEU CG CD2 sing N N 158 LEU CG HG sing N N 159 LEU CD1 HD11 sing N N 160 LEU CD1 HD12 sing N N 161 LEU CD1 HD13 sing N N 162 LEU CD2 HD21 sing N N 163 LEU CD2 HD22 sing N N 164 LEU CD2 HD23 sing N N 165 LEU OXT HXT sing N N 166 LYS N CA sing N N 167 LYS N H sing N N 168 LYS N H2 sing N N 169 LYS CA C sing N N 170 LYS CA CB sing N N 171 LYS CA HA sing N N 172 LYS C O doub N N 173 LYS C OXT sing N N 174 LYS CB CG sing N N 175 LYS CB HB2 sing N N 176 LYS CB HB3 sing N N 177 LYS CG CD sing N N 178 LYS CG HG2 sing N N 179 LYS CG HG3 sing N N 180 LYS CD CE sing N N 181 LYS CD HD2 sing N N 182 LYS CD HD3 sing N N 183 LYS CE NZ sing N N 184 LYS CE HE2 sing N N 185 LYS CE HE3 sing N N 186 LYS NZ HZ1 sing N N 187 LYS NZ HZ2 sing N N 188 LYS NZ HZ3 sing N N 189 LYS OXT HXT sing N N 190 MET N CA sing N N 191 MET N H sing N N 192 MET N H2 sing N N 193 MET CA C sing N N 194 MET CA CB sing N N 195 MET CA HA sing N N 196 MET C O doub N N 197 MET C OXT sing N N 198 MET CB CG sing N N 199 MET CB HB2 sing N N 200 MET CB HB3 sing N N 201 MET CG SD sing N N 202 MET CG HG2 sing N N 203 MET CG HG3 sing N N 204 MET SD CE sing N N 205 MET CE HE1 sing N N 206 MET CE HE2 sing N N 207 MET CE HE3 sing N N 208 MET OXT HXT sing N N 209 PHE N CA sing N N 210 PHE N H sing N N 211 PHE N H2 sing N N 212 PHE CA C sing N N 213 PHE CA CB sing N N 214 PHE CA HA sing N N 215 PHE C O doub N N 216 PHE C OXT sing N N 217 PHE CB CG sing N N 218 PHE CB HB2 sing N N 219 PHE CB HB3 sing N N 220 PHE CG CD1 doub Y N 221 PHE CG CD2 sing Y N 222 PHE CD1 CE1 sing Y N 223 PHE CD1 HD1 sing N N 224 PHE CD2 CE2 doub Y N 225 PHE CD2 HD2 sing N N 226 PHE CE1 CZ doub Y N 227 PHE CE1 HE1 sing N N 228 PHE CE2 CZ sing Y N 229 PHE CE2 HE2 sing N N 230 PHE CZ HZ sing N N 231 PHE OXT HXT sing N N 232 PRO N CA sing N N 233 PRO N CD sing N N 234 PRO N H sing N N 235 PRO CA C sing N N 236 PRO CA CB sing N N 237 PRO CA HA sing N N 238 PRO C O doub N N 239 PRO C OXT sing N N 240 PRO CB CG sing N N 241 PRO CB HB2 sing N N 242 PRO CB HB3 sing N N 243 PRO CG CD sing N N 244 PRO CG HG2 sing N N 245 PRO CG HG3 sing N N 246 PRO CD HD2 sing N N 247 PRO CD HD3 sing N N 248 PRO OXT HXT sing N N 249 SER N CA sing N N 250 SER N H sing N N 251 SER N H2 sing N N 252 SER CA C sing N N 253 SER CA CB sing N N 254 SER CA HA sing N N 255 SER C O doub N N 256 SER C OXT sing N N 257 SER CB OG sing N N 258 SER CB HB2 sing N N 259 SER CB HB3 sing N N 260 SER OG HG sing N N 261 SER OXT HXT sing N N 262 THR N CA sing N N 263 THR N H sing N N 264 THR N H2 sing N N 265 THR CA C sing N N 266 THR CA CB sing N N 267 THR CA HA sing N N 268 THR C O doub N N 269 THR C OXT sing N N 270 THR CB OG1 sing N N 271 THR CB CG2 sing N N 272 THR CB HB sing N N 273 THR OG1 HG1 sing N N 274 THR CG2 HG21 sing N N 275 THR CG2 HG22 sing N N 276 THR CG2 HG23 sing N N 277 THR OXT HXT sing N N 278 TRP N CA sing N N 279 TRP N H sing N N 280 TRP N H2 sing N N 281 TRP CA C sing N N 282 TRP CA CB sing N N 283 TRP CA HA sing N N 284 TRP C O doub N N 285 TRP C OXT sing N N 286 TRP CB CG sing N N 287 TRP CB HB2 sing N N 288 TRP CB HB3 sing N N 289 TRP CG CD1 doub Y N 290 TRP CG CD2 sing Y N 291 TRP CD1 NE1 sing Y N 292 TRP CD1 HD1 sing N N 293 TRP CD2 CE2 doub Y N 294 TRP CD2 CE3 sing Y N 295 TRP NE1 CE2 sing Y N 296 TRP NE1 HE1 sing N N 297 TRP CE2 CZ2 sing Y N 298 TRP CE3 CZ3 doub Y N 299 TRP CE3 HE3 sing N N 300 TRP CZ2 CH2 doub Y N 301 TRP CZ2 HZ2 sing N N 302 TRP CZ3 CH2 sing Y N 303 TRP CZ3 HZ3 sing N N 304 TRP CH2 HH2 sing N N 305 TRP OXT HXT sing N N 306 TYR N CA sing N N 307 TYR N H sing N N 308 TYR N H2 sing N N 309 TYR CA C sing N N 310 TYR CA CB sing N N 311 TYR CA HA sing N N 312 TYR C O doub N N 313 TYR C OXT sing N N 314 TYR CB CG sing N N 315 TYR CB HB2 sing N N 316 TYR CB HB3 sing N N 317 TYR CG CD1 doub Y N 318 TYR CG CD2 sing Y N 319 TYR CD1 CE1 sing Y N 320 TYR CD1 HD1 sing N N 321 TYR CD2 CE2 doub Y N 322 TYR CD2 HD2 sing N N 323 TYR CE1 CZ doub Y N 324 TYR CE1 HE1 sing N N 325 TYR CE2 CZ sing Y N 326 TYR CE2 HE2 sing N N 327 TYR CZ OH sing N N 328 TYR OH HH sing N N 329 TYR OXT HXT sing N N 330 VAL N CA sing N N 331 VAL N H sing N N 332 VAL N H2 sing N N 333 VAL CA C sing N N 334 VAL CA CB sing N N 335 VAL CA HA sing N N 336 VAL C O doub N N 337 VAL C OXT sing N N 338 VAL CB CG1 sing N N 339 VAL CB CG2 sing N N 340 VAL CB HB sing N N 341 VAL CG1 HG11 sing N N 342 VAL CG1 HG12 sing N N 343 VAL CG1 HG13 sing N N 344 VAL CG2 HG21 sing N N 345 VAL CG2 HG22 sing N N 346 VAL CG2 HG23 sing N N 347 VAL OXT HXT sing N N 348 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Varian INOVA 1 'Varian INOVA' 750 Varian INOVA 2 'Varian INOVA' # _atom_sites.entry_id 2K4N _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_