data_2K52 # _entry.id 2K52 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2K52 pdb_00002k52 10.2210/pdb2k52/pdb RCSB RCSB100685 ? ? BMRB 15821 ? 10.13018/BMR15821 WWPDB D_1000100685 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-07-15 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-19 4 'Structure model' 1 3 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Derived calculations' 4 3 'Structure model' Other 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' pdbx_database_status 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' chem_comp_atom 7 4 'Structure model' chem_comp_bond 8 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_software.name' 3 3 'Structure model' '_pdbx_nmr_spectrometer.model' 4 4 'Structure model' '_database_2.pdbx_DOI' 5 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2K52 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2008-06-24 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details MjR117B TargetDB unspecified . 15821 BMRB unspecified . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Rossi, P.' 1 'Maglaqui, M.' 2 'Foote, E.L.' 3 'Hamilton, K.' 4 'Ciccosanti, C.' 5 'Xiao, R.' 6 'Nair, R.' 7 'Swapna, G.' 8 'Everett, J.K.' 9 'Acton, T.B.' 10 'Rost, B.' 11 'Montelione, G.T.' 12 'Northeast Structural Genomics Consortium (NESG)' 13 # _citation.id primary _citation.title ;Structure of uncharacterized protein MJ1198 from Methanocaldococcus jannaschii. Northeast Structural Genomics Target MjR117B ; _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Rossi, P.' 1 ? primary 'Xiao, R.' 2 ? primary 'Acton, T.B.' 3 ? primary 'Montelione, G.T.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Uncharacterized protein MJ1198' _entity.formula_weight 9502.940 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MDVEPGKFYKGVVTRIEKYGAFINLNEQVRGLLRPRDMISLRLENLNVGDEIIVQAIDVRPEKREIDFKYIPLEHHHHHH _entity_poly.pdbx_seq_one_letter_code_can MDVEPGKFYKGVVTRIEKYGAFINLNEQVRGLLRPRDMISLRLENLNVGDEIIVQAIDVRPEKREIDFKYIPLEHHHHHH _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier MjR117B # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 VAL n 1 4 GLU n 1 5 PRO n 1 6 GLY n 1 7 LYS n 1 8 PHE n 1 9 TYR n 1 10 LYS n 1 11 GLY n 1 12 VAL n 1 13 VAL n 1 14 THR n 1 15 ARG n 1 16 ILE n 1 17 GLU n 1 18 LYS n 1 19 TYR n 1 20 GLY n 1 21 ALA n 1 22 PHE n 1 23 ILE n 1 24 ASN n 1 25 LEU n 1 26 ASN n 1 27 GLU n 1 28 GLN n 1 29 VAL n 1 30 ARG n 1 31 GLY n 1 32 LEU n 1 33 LEU n 1 34 ARG n 1 35 PRO n 1 36 ARG n 1 37 ASP n 1 38 MET n 1 39 ILE n 1 40 SER n 1 41 LEU n 1 42 ARG n 1 43 LEU n 1 44 GLU n 1 45 ASN n 1 46 LEU n 1 47 ASN n 1 48 VAL n 1 49 GLY n 1 50 ASP n 1 51 GLU n 1 52 ILE n 1 53 ILE n 1 54 VAL n 1 55 GLN n 1 56 ALA n 1 57 ILE n 1 58 ASP n 1 59 VAL n 1 60 ARG n 1 61 PRO n 1 62 GLU n 1 63 LYS n 1 64 ARG n 1 65 GLU n 1 66 ILE n 1 67 ASP n 1 68 PHE n 1 69 LYS n 1 70 TYR n 1 71 ILE n 1 72 PRO n 1 73 LEU n 1 74 GLU n 1 75 HIS n 1 76 HIS n 1 77 HIS n 1 78 HIS n 1 79 HIS n 1 80 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Methanococcus _entity_src_gen.pdbx_gene_src_gene MJ1198 _entity_src_gen.gene_src_species jannaschii _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Methanocaldococcus jannaschii' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2190 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species coli _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)+ Magic' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET 21-23C' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ;Expression media: MJ9 100%N15 5%C13 MJ9 100%N15 100%C13 ; # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 TYR 9 9 9 TYR TYR A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 MET 38 38 38 MET MET A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 ASN 45 45 45 ASN ASN A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 ASN 47 47 47 ASN ASN A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 PRO 61 61 61 PRO PRO A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 PHE 68 68 68 PHE PHE A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 TYR 70 70 70 TYR TYR A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 PRO 72 72 72 PRO PRO A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 HIS 75 75 ? ? ? A . n A 1 76 HIS 76 76 ? ? ? A . n A 1 77 HIS 77 77 ? ? ? A . n A 1 78 HIS 78 78 ? ? ? A . n A 1 79 HIS 79 79 ? ? ? A . n A 1 80 HIS 80 80 ? ? ? A . n # _exptl.entry_id 2K52 _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2K52 _struct.title 'Structure of uncharacterized protein MJ1198 from Methanocaldococcus jannaschii. Northeast Structural Genomics Target MjR117B' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2K52 _struct_keywords.pdbx_keywords 'structural genomics, unknown function' _struct_keywords.text ;Uncharacterized protein, Metal-binding, Zinc, Zinc-finger, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, unknown function ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Y1198_METJA _struct_ref.pdbx_db_accession Q58598 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code DVEPGKFYKGVVTRIEKYGAFINLNEQVRGLLRPRDMISLRLENLNVGDEIIVQAIDVRPEKREIDFKYIPL _struct_ref.pdbx_align_begin 131 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2K52 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 73 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q58598 _struct_ref_seq.db_align_beg 131 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 202 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 73 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2K52 MET A 1 ? UNP Q58598 ? ? 'expression tag' 1 1 1 2K52 GLU A 74 ? UNP Q58598 ? ? 'expression tag' 74 2 1 2K52 HIS A 75 ? UNP Q58598 ? ? 'expression tag' 75 3 1 2K52 HIS A 76 ? UNP Q58598 ? ? 'expression tag' 76 4 1 2K52 HIS A 77 ? UNP Q58598 ? ? 'expression tag' 77 5 1 2K52 HIS A 78 ? UNP Q58598 ? ? 'expression tag' 78 6 1 2K52 HIS A 79 ? UNP Q58598 ? ? 'expression tag' 79 7 1 2K52 HIS A 80 ? UNP Q58598 ? ? 'expression tag' 80 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 35 ? MET A 38 ? PRO A 35 MET A 38 5 ? 4 HELX_P HELX_P2 2 ARG A 42 ? LEU A 46 ? ARG A 42 LEU A 46 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 8 ? GLU A 17 ? PHE A 8 GLU A 17 A 2 GLY A 20 ? ASN A 26 ? GLY A 20 ASN A 26 A 3 VAL A 29 ? LEU A 33 ? VAL A 29 LEU A 33 A 4 GLU A 65 ? TYR A 70 ? GLU A 65 TYR A 70 A 5 GLU A 51 ? VAL A 59 ? GLU A 51 VAL A 59 A 6 PHE A 8 ? GLU A 17 ? PHE A 8 GLU A 17 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N THR A 14 ? N THR A 14 O PHE A 22 ? O PHE A 22 A 2 3 N LEU A 25 ? N LEU A 25 O VAL A 29 ? O VAL A 29 A 3 4 N LEU A 32 ? N LEU A 32 O ILE A 66 ? O ILE A 66 A 4 5 O ASP A 67 ? O ASP A 67 N ILE A 57 ? N ILE A 57 A 5 6 O VAL A 54 ? O VAL A 54 N TYR A 9 ? N TYR A 9 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 39 ? ? -99.63 -79.69 2 1 ARG A 64 ? ? 65.20 -0.92 3 3 THR A 14 ? ? -91.35 -64.40 4 3 ILE A 39 ? ? -88.01 -80.99 5 3 ILE A 57 ? ? -93.56 -67.88 6 4 TYR A 19 ? ? -142.65 14.39 7 4 ILE A 39 ? ? -104.66 -67.68 8 4 LEU A 73 ? ? -68.91 88.87 9 5 ILE A 39 ? ? -87.07 -82.17 10 6 ILE A 39 ? ? -107.36 -74.34 11 6 ILE A 57 ? ? -60.29 -70.88 12 7 ILE A 57 ? ? -95.35 -70.93 13 8 THR A 14 ? ? -103.76 -64.35 14 8 SER A 40 ? ? -90.38 -62.85 15 9 ILE A 57 ? ? -90.11 -73.93 16 11 PRO A 5 ? ? -63.45 93.89 17 11 PRO A 72 ? ? -73.90 40.51 18 12 PRO A 5 ? ? -61.96 94.31 19 12 ILE A 39 ? ? -104.82 -80.26 20 13 ILE A 39 ? ? -109.94 -78.11 21 16 PRO A 5 ? ? -58.33 103.21 22 17 ILE A 39 ? ? -85.86 -73.61 23 17 ILE A 57 ? ? -61.73 -71.42 24 18 ILE A 39 ? ? -110.57 -80.46 25 18 PRO A 72 ? ? -65.71 92.48 26 19 ILE A 39 ? ? -63.66 -71.83 27 19 PRO A 72 ? ? -69.22 83.71 28 20 ILE A 57 ? ? -64.48 -70.12 # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' # _pdbx_nmr_ensemble.entry_id 2K52 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2K52 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria ? # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;1.682 MM [U-100% 13C 15N] MJR117B, 20 MM AMMONIUM ACETATE, 100 MM SODIUM CHLORIDE, 0.02 MM SODIUM AZIDE, 10 MM DTT, 50 UM DSS, 5 MM CALCIUM CHLORIDE, 1X PROTEASE INHIBITOR, 90% H2O/ 10% D2O; 1.226 MM [5% 13C; U- 100% 15N] MJR117B, 20 MM AMMONIUM ACETATE, 100 MM SODIUM CHLORIDE, 0.02 MM SODIUM AZIDE, 10 MM DTT, 50 UM DSS, 5 MM CALCIUM CHLORIDE, 1X PROTEASE INHIBITOR, 90% H2O/ 10% D2O ; _pdbx_nmr_sample_details.solvent_system ? # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id MjR117B 1.682 mM '[U-100% 13C; U-100% 15N]' 1 'ammonium acetate' 20 mM ? 1 'sodium chloride' 100 mM ? 1 'sodium azide' 0.02 mM ? 1 DTT 10 mM ? 1 DSS 50 uM ? 1 'calcium chloride' 5 mM ? 1 'protease inhibitor' 1 mM ? 1 MjR117B 1.226 mM '[5% 13C; U-100% 15N]' 2 'ammonium acetate' 20 mM ? 2 'sodium chloride' 100 mM ? 2 'sodium azide' 0.02 mM ? 2 DTT 10 mM ? 2 DSS 50 uM ? 2 'calcium chloride' 5 mM ? 2 'protease inhibitor' 1 mM ? 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 4.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.1 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D HNCO' 1 5 1 '3D HN(CO)CA' 1 6 1 '3D HBHA(CO)NH' 1 7 1 '3D HNCACB' 1 8 1 '3D HN(CA)CO' 1 9 1 '3D HCCH-TOCSY' 1 10 1 '3D HCCH-COSY' 1 11 1 '3D CCH- TOCSY' 1 12 1 '3D SIM 13C' 1 13 1 '15N NOESY' 1 14 1 '3D ARO 13C NOESY' 1 15 1 '2D 1H-13C HSQC STEREO' 1 16 1 '2D HETNOE' 1 17 1 'PSEUDO 2D N15 T1' 1 18 1 'PSEUDO 2D N15 T2 (CPMG)' 1 19 1 '2D 1H-13C HSQC CT ARO' 1 # _pdbx_nmr_details.entry_id 2K52 _pdbx_nmr_details.text ;MONOMER BY GEL FILTRATION CHROMATOGRAPHY/LIGHT SCATTERING AND BY NMR. T1/T2 (MS) = 792.1/78.18, TAUC = 9.7(NS) CONSISTENT WITH MOLECULAR WEIGHT. STRUCTURE DETERMINED BY TRIPLE RESONANCE NMR SPECTROSCOPY. NOESY ASSIGNMENTS BY CYANA2.1. 20 OF 100 STRUCTURES LOWEST TARGET FUNCTION SELECTED WITH CYANA2.1. SELECTED MODELS ARE FURTHER REFINED USING CNS IN EXPLICIT WATER SHELL (NILGES PROTOCOL WITH PARAM19). ASSIGNMENT STATS AROMATIC (SC) 92.6%, VL METHYL STEREOSPECIFIC 100%, UNAMBIGUOS SIDECHAIN NH2 100%. STRUCTURE BASED ON 1088 NOE, 166 DIHE. MAX NOE VIOLATION: 0.25 A (1MODEL); MAX DIHE VIOLATION: 3.2 DEG. 2 TOTAL CLOSE CONTACTS PER 20 MODELS. STRUCTURE QUALITY FACTOR > 1.8. SECONDARY STRUCTURE - BETA STRANDS: (8-17, 20-26, 29- 33, 51-60, 65-70). RMSD 0.4 BACKBONE, 0.8 ALL HEAVY ATOMS. MOLPROBITY CLASH: 16.80/-1.36 (RAW/Z). RPF SCORES ALL ASSIGNED PRECISION: 0.89, F-MEASURE: 0.93, DP-SCORE: 0.83. ; # _pdbx_nmr_refine.entry_id 2K52 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement CNS 1.1 'BRUNGER, ADAMS, CLORE, GROS, NILGES' 1 'structure solution' CYANA 2.1 ? 2 'structure solution' NMRPipe ? ? 3 'structure solution' AutoAssign ? ? 4 'structure solution' Sparky 3.113 ? 5 'structure solution' TopSpin 2.1 ? 6 'structure solution' 'RPF(AUTOSTRUCTURE)' 2.2.1 ? 7 'structure solution' PSVS 1.3 ? 8 'structure solution' MOLMOL ? ? 9 'structure solution' PROCHECK ? ? 10 'structure solution' MolProbity ? ? 11 'structure solution' TALOS ? ? 12 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 75 ? A HIS 75 2 1 Y 1 A HIS 76 ? A HIS 76 3 1 Y 1 A HIS 77 ? A HIS 77 4 1 Y 1 A HIS 78 ? A HIS 78 5 1 Y 1 A HIS 79 ? A HIS 79 6 1 Y 1 A HIS 80 ? A HIS 80 7 2 Y 1 A HIS 75 ? A HIS 75 8 2 Y 1 A HIS 76 ? A HIS 76 9 2 Y 1 A HIS 77 ? A HIS 77 10 2 Y 1 A HIS 78 ? A HIS 78 11 2 Y 1 A HIS 79 ? A HIS 79 12 2 Y 1 A HIS 80 ? A HIS 80 13 3 Y 1 A HIS 75 ? A HIS 75 14 3 Y 1 A HIS 76 ? A HIS 76 15 3 Y 1 A HIS 77 ? A HIS 77 16 3 Y 1 A HIS 78 ? A HIS 78 17 3 Y 1 A HIS 79 ? A HIS 79 18 3 Y 1 A HIS 80 ? A HIS 80 19 4 Y 1 A HIS 75 ? A HIS 75 20 4 Y 1 A HIS 76 ? A HIS 76 21 4 Y 1 A HIS 77 ? A HIS 77 22 4 Y 1 A HIS 78 ? A HIS 78 23 4 Y 1 A HIS 79 ? A HIS 79 24 4 Y 1 A HIS 80 ? A HIS 80 25 5 Y 1 A HIS 75 ? A HIS 75 26 5 Y 1 A HIS 76 ? A HIS 76 27 5 Y 1 A HIS 77 ? A HIS 77 28 5 Y 1 A HIS 78 ? A HIS 78 29 5 Y 1 A HIS 79 ? A HIS 79 30 5 Y 1 A HIS 80 ? A HIS 80 31 6 Y 1 A HIS 75 ? A HIS 75 32 6 Y 1 A HIS 76 ? A HIS 76 33 6 Y 1 A HIS 77 ? A HIS 77 34 6 Y 1 A HIS 78 ? A HIS 78 35 6 Y 1 A HIS 79 ? A HIS 79 36 6 Y 1 A HIS 80 ? A HIS 80 37 7 Y 1 A HIS 75 ? A HIS 75 38 7 Y 1 A HIS 76 ? A HIS 76 39 7 Y 1 A HIS 77 ? A HIS 77 40 7 Y 1 A HIS 78 ? A HIS 78 41 7 Y 1 A HIS 79 ? A HIS 79 42 7 Y 1 A HIS 80 ? A HIS 80 43 8 Y 1 A HIS 75 ? A HIS 75 44 8 Y 1 A HIS 76 ? A HIS 76 45 8 Y 1 A HIS 77 ? A HIS 77 46 8 Y 1 A HIS 78 ? A HIS 78 47 8 Y 1 A HIS 79 ? A HIS 79 48 8 Y 1 A HIS 80 ? A HIS 80 49 9 Y 1 A HIS 75 ? A HIS 75 50 9 Y 1 A HIS 76 ? A HIS 76 51 9 Y 1 A HIS 77 ? A HIS 77 52 9 Y 1 A HIS 78 ? A HIS 78 53 9 Y 1 A HIS 79 ? A HIS 79 54 9 Y 1 A HIS 80 ? A HIS 80 55 10 Y 1 A HIS 75 ? A HIS 75 56 10 Y 1 A HIS 76 ? A HIS 76 57 10 Y 1 A HIS 77 ? A HIS 77 58 10 Y 1 A HIS 78 ? A HIS 78 59 10 Y 1 A HIS 79 ? A HIS 79 60 10 Y 1 A HIS 80 ? A HIS 80 61 11 Y 1 A HIS 75 ? A HIS 75 62 11 Y 1 A HIS 76 ? A HIS 76 63 11 Y 1 A HIS 77 ? A HIS 77 64 11 Y 1 A HIS 78 ? A HIS 78 65 11 Y 1 A HIS 79 ? A HIS 79 66 11 Y 1 A HIS 80 ? A HIS 80 67 12 Y 1 A HIS 75 ? A HIS 75 68 12 Y 1 A HIS 76 ? A HIS 76 69 12 Y 1 A HIS 77 ? A HIS 77 70 12 Y 1 A HIS 78 ? A HIS 78 71 12 Y 1 A HIS 79 ? A HIS 79 72 12 Y 1 A HIS 80 ? A HIS 80 73 13 Y 1 A HIS 75 ? A HIS 75 74 13 Y 1 A HIS 76 ? A HIS 76 75 13 Y 1 A HIS 77 ? A HIS 77 76 13 Y 1 A HIS 78 ? A HIS 78 77 13 Y 1 A HIS 79 ? A HIS 79 78 13 Y 1 A HIS 80 ? A HIS 80 79 14 Y 1 A HIS 75 ? A HIS 75 80 14 Y 1 A HIS 76 ? A HIS 76 81 14 Y 1 A HIS 77 ? A HIS 77 82 14 Y 1 A HIS 78 ? A HIS 78 83 14 Y 1 A HIS 79 ? A HIS 79 84 14 Y 1 A HIS 80 ? A HIS 80 85 15 Y 1 A HIS 75 ? A HIS 75 86 15 Y 1 A HIS 76 ? A HIS 76 87 15 Y 1 A HIS 77 ? A HIS 77 88 15 Y 1 A HIS 78 ? A HIS 78 89 15 Y 1 A HIS 79 ? A HIS 79 90 15 Y 1 A HIS 80 ? A HIS 80 91 16 Y 1 A HIS 75 ? A HIS 75 92 16 Y 1 A HIS 76 ? A HIS 76 93 16 Y 1 A HIS 77 ? A HIS 77 94 16 Y 1 A HIS 78 ? A HIS 78 95 16 Y 1 A HIS 79 ? A HIS 79 96 16 Y 1 A HIS 80 ? A HIS 80 97 17 Y 1 A HIS 75 ? A HIS 75 98 17 Y 1 A HIS 76 ? A HIS 76 99 17 Y 1 A HIS 77 ? A HIS 77 100 17 Y 1 A HIS 78 ? A HIS 78 101 17 Y 1 A HIS 79 ? A HIS 79 102 17 Y 1 A HIS 80 ? A HIS 80 103 18 Y 1 A HIS 75 ? A HIS 75 104 18 Y 1 A HIS 76 ? A HIS 76 105 18 Y 1 A HIS 77 ? A HIS 77 106 18 Y 1 A HIS 78 ? A HIS 78 107 18 Y 1 A HIS 79 ? A HIS 79 108 18 Y 1 A HIS 80 ? A HIS 80 109 19 Y 1 A HIS 75 ? A HIS 75 110 19 Y 1 A HIS 76 ? A HIS 76 111 19 Y 1 A HIS 77 ? A HIS 77 112 19 Y 1 A HIS 78 ? A HIS 78 113 19 Y 1 A HIS 79 ? A HIS 79 114 19 Y 1 A HIS 80 ? A HIS 80 115 20 Y 1 A HIS 75 ? A HIS 75 116 20 Y 1 A HIS 76 ? A HIS 76 117 20 Y 1 A HIS 77 ? A HIS 77 118 20 Y 1 A HIS 78 ? A HIS 78 119 20 Y 1 A HIS 79 ? A HIS 79 120 20 Y 1 A HIS 80 ? A HIS 80 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TYR N N N N 304 TYR CA C N S 305 TYR C C N N 306 TYR O O N N 307 TYR CB C N N 308 TYR CG C Y N 309 TYR CD1 C Y N 310 TYR CD2 C Y N 311 TYR CE1 C Y N 312 TYR CE2 C Y N 313 TYR CZ C Y N 314 TYR OH O N N 315 TYR OXT O N N 316 TYR H H N N 317 TYR H2 H N N 318 TYR HA H N N 319 TYR HB2 H N N 320 TYR HB3 H N N 321 TYR HD1 H N N 322 TYR HD2 H N N 323 TYR HE1 H N N 324 TYR HE2 H N N 325 TYR HH H N N 326 TYR HXT H N N 327 VAL N N N N 328 VAL CA C N S 329 VAL C C N N 330 VAL O O N N 331 VAL CB C N N 332 VAL CG1 C N N 333 VAL CG2 C N N 334 VAL OXT O N N 335 VAL H H N N 336 VAL H2 H N N 337 VAL HA H N N 338 VAL HB H N N 339 VAL HG11 H N N 340 VAL HG12 H N N 341 VAL HG13 H N N 342 VAL HG21 H N N 343 VAL HG22 H N N 344 VAL HG23 H N N 345 VAL HXT H N N 346 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TYR N CA sing N N 291 TYR N H sing N N 292 TYR N H2 sing N N 293 TYR CA C sing N N 294 TYR CA CB sing N N 295 TYR CA HA sing N N 296 TYR C O doub N N 297 TYR C OXT sing N N 298 TYR CB CG sing N N 299 TYR CB HB2 sing N N 300 TYR CB HB3 sing N N 301 TYR CG CD1 doub Y N 302 TYR CG CD2 sing Y N 303 TYR CD1 CE1 sing Y N 304 TYR CD1 HD1 sing N N 305 TYR CD2 CE2 doub Y N 306 TYR CD2 HD2 sing N N 307 TYR CE1 CZ doub Y N 308 TYR CE1 HE1 sing N N 309 TYR CE2 CZ sing Y N 310 TYR CE2 HE2 sing N N 311 TYR CZ OH sing N N 312 TYR OH HH sing N N 313 TYR OXT HXT sing N N 314 VAL N CA sing N N 315 VAL N H sing N N 316 VAL N H2 sing N N 317 VAL CA C sing N N 318 VAL CA CB sing N N 319 VAL CA HA sing N N 320 VAL C O doub N N 321 VAL C OXT sing N N 322 VAL CB CG1 sing N N 323 VAL CB CG2 sing N N 324 VAL CB HB sing N N 325 VAL CG1 HG11 sing N N 326 VAL CG1 HG12 sing N N 327 VAL CG1 HG13 sing N N 328 VAL CG2 HG21 sing N N 329 VAL CG2 HG22 sing N N 330 VAL CG2 HG23 sing N N 331 VAL OXT HXT sing N N 332 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 AVANCE Bruker 600 ? 2 AVANCE Bruker 800 ? # _atom_sites.entry_id 2K52 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_