data_2K5K # _entry.id 2K5K # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2K5K pdb_00002k5k 10.2210/pdb2k5k/pdb RCSB RCSB100703 ? ? WWPDB D_1000100703 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-08-26 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 4 'Structure model' 1 3 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2K5K _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2008-06-28 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type TargetDB RhR2 . unspecified BMRB 15840 . unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Lee, H.' 1 'Bansal, S.' 2 'Chen, C.X.' 3 'Jiang, M.' 4 'Maglaqui, M.' 5 'Xiao, R.' 6 'Liu, J.' 7 'Baran, M.C.' 8 'Swapna, G.' 9 'Acton, T.B.' 10 'Rost, B.' 11 'Montelione, G.T.' 12 'Prestegard, J.H.' 13 'Northeast Structural Genomics Consortium (NESG)' 14 # _citation.id primary _citation.title 'Solution Structure of RhR2' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lee, H.' 1 ? primary 'Bansal, S.' 2 ? primary 'Montelione, G.T.' 3 ? primary 'Prestegard, J.H.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'uncharacterized protein RhR2' _entity.formula_weight 8219.302 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MRDMTEETRKDLPPEALRALAEAEERRRRAKALDLPKEIGGRNGPEPVRFGDWEKKGIAIDFLEHHHHHH _entity_poly.pdbx_seq_one_letter_code_can MRDMTEETRKDLPPEALRALAEAEERRRRAKALDLPKEIGGRNGPEPVRFGDWEKKGIAIDFLEHHHHHH _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier RhR2 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ARG n 1 3 ASP n 1 4 MET n 1 5 THR n 1 6 GLU n 1 7 GLU n 1 8 THR n 1 9 ARG n 1 10 LYS n 1 11 ASP n 1 12 LEU n 1 13 PRO n 1 14 PRO n 1 15 GLU n 1 16 ALA n 1 17 LEU n 1 18 ARG n 1 19 ALA n 1 20 LEU n 1 21 ALA n 1 22 GLU n 1 23 ALA n 1 24 GLU n 1 25 GLU n 1 26 ARG n 1 27 ARG n 1 28 ARG n 1 29 ARG n 1 30 ALA n 1 31 LYS n 1 32 ALA n 1 33 LEU n 1 34 ASP n 1 35 LEU n 1 36 PRO n 1 37 LYS n 1 38 GLU n 1 39 ILE n 1 40 GLY n 1 41 GLY n 1 42 ARG n 1 43 ASN n 1 44 GLY n 1 45 PRO n 1 46 GLU n 1 47 PRO n 1 48 VAL n 1 49 ARG n 1 50 PHE n 1 51 GLY n 1 52 ASP n 1 53 TRP n 1 54 GLU n 1 55 LYS n 1 56 LYS n 1 57 GLY n 1 58 ILE n 1 59 ALA n 1 60 ILE n 1 61 ASP n 1 62 PHE n 1 63 LEU n 1 64 GLU n 1 65 HIS n 1 66 HIS n 1 67 HIS n 1 68 HIS n 1 69 HIS n 1 70 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Rhodobacter _entity_src_gen.pdbx_gene_src_gene 'RHOS4_27210, RSP_1104' _entity_src_gen.gene_src_species sphaeroides _entity_src_gen.gene_src_strain XL10 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rhodobacter sphaeroides 2.4.1' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 272943 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species coli _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET21 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ARG 2 2 2 ARG ARG A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 MET 4 4 4 MET MET A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 PHE 50 50 50 PHE PHE A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 TRP 53 53 53 TRP TRP A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 PHE 62 62 62 PHE PHE A . n A 1 63 LEU 63 63 ? ? ? A . n A 1 64 GLU 64 64 ? ? ? A . n A 1 65 HIS 65 65 ? ? ? A . n A 1 66 HIS 66 66 ? ? ? A . n A 1 67 HIS 67 67 ? ? ? A . n A 1 68 HIS 68 68 ? ? ? A . n A 1 69 HIS 69 69 ? ? ? A . n A 1 70 HIS 70 70 ? ? ? A . n # _exptl.entry_id 2K5K _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2K5K _struct.title 'Solution structure of RhR2 from Rhodobacter Sphaeroides. Northeast Structural Genomics Consortium' _struct.pdbx_model_details ;The results from one bond HN-N NOEs, CSI analysis, residual dipolar couplings, and correlation time measurement on the protein indicated that extensive parts of the C and N terminal regions of the RhR2 protein are highly disordered. The resonances for R26, R27, and R28 were not assigned due to signal overlap; therefore no restraints were used for this region. The ordered regions of the calculated RhR2 structure are residues 15 to 25 (four turn helix) and 28 to 31 (one turn helix). ; _struct.pdbx_CASP_flag Y _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2K5K _struct_keywords.pdbx_keywords 'structural genomics, unknown function' _struct_keywords.text 'RhR2, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, unknown function' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q3IYU5_RHOS4 _struct_ref.pdbx_db_accession Q3IYU5 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MRDMTEETRKDLPPEALRALAEAEERRRRAKALDLPKEIGGRNGPEPVRFGDWEKKGIAIDF _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2K5K _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 62 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q3IYU5 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 62 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 62 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2K5K LEU A 63 ? UNP Q3IYU5 ? ? 'expression tag' 63 1 1 2K5K GLU A 64 ? UNP Q3IYU5 ? ? 'expression tag' 64 2 1 2K5K HIS A 65 ? UNP Q3IYU5 ? ? 'expression tag' 65 3 1 2K5K HIS A 66 ? UNP Q3IYU5 ? ? 'expression tag' 66 4 1 2K5K HIS A 67 ? UNP Q3IYU5 ? ? 'expression tag' 67 5 1 2K5K HIS A 68 ? UNP Q3IYU5 ? ? 'expression tag' 68 6 1 2K5K HIS A 69 ? UNP Q3IYU5 ? ? 'expression tag' 69 7 1 2K5K HIS A 70 ? UNP Q3IYU5 ? ? 'expression tag' 70 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id PRO _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 14 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLU _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 25 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id PRO _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 14 _struct_conf.end_auth_comp_id GLU _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 25 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 6 O A ARG 18 ? ? H A ALA 21 ? ? 1.59 2 8 HZ3 A LYS 31 ? ? HZ1 A LYS 55 ? ? 1.31 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 3 ? ? -138.27 -35.47 2 1 GLU A 6 ? ? 38.34 -121.11 3 1 ASP A 11 ? ? 39.42 71.80 4 1 PRO A 14 ? ? -74.91 46.61 5 1 GLU A 25 ? ? -47.77 -16.80 6 1 ALA A 32 ? ? 75.02 53.84 7 1 LEU A 33 ? ? -151.40 86.23 8 1 LEU A 35 ? ? 77.45 57.20 9 1 GLU A 38 ? ? -159.99 -40.45 10 1 GLU A 46 ? ? -161.70 80.71 11 1 ILE A 60 ? ? -39.55 109.80 12 2 MET A 4 ? ? -87.77 -99.82 13 2 ARG A 9 ? ? -138.17 -78.20 14 2 LYS A 10 ? ? -87.34 -79.72 15 2 ASP A 11 ? ? -161.36 -91.54 16 2 LYS A 37 ? ? -138.36 -73.83 17 2 GLU A 38 ? ? -169.14 -79.63 18 2 ARG A 42 ? ? 45.96 83.94 19 2 GLU A 46 ? ? -39.61 151.15 20 2 VAL A 48 ? ? 52.98 113.36 21 2 TRP A 53 ? ? 36.99 80.95 22 2 LYS A 55 ? ? 51.74 76.42 23 2 ALA A 59 ? ? 48.25 20.78 24 2 ILE A 60 ? ? 52.81 2.30 25 3 ASP A 3 ? ? 48.08 -115.28 26 3 MET A 4 ? ? 37.79 45.52 27 3 THR A 5 ? ? 64.02 -79.11 28 3 GLU A 6 ? ? 36.91 41.64 29 3 LYS A 10 ? ? 57.79 86.89 30 3 ARG A 26 ? ? 37.45 -163.16 31 3 ILE A 39 ? ? 55.02 -82.31 32 3 ARG A 42 ? ? 39.02 101.84 33 3 PRO A 45 ? ? -47.96 170.41 34 3 PRO A 47 ? ? -53.03 -158.81 35 3 GLU A 54 ? ? -67.12 -106.79 36 3 LYS A 55 ? ? 47.37 27.54 37 3 ILE A 58 ? ? 57.33 -2.75 38 3 ALA A 59 ? ? -151.97 9.96 39 3 ILE A 60 ? ? 32.08 53.31 40 4 MET A 4 ? ? -163.39 -34.04 41 4 PRO A 13 ? ? -38.81 102.57 42 4 ARG A 27 ? ? -157.35 50.15 43 4 LEU A 35 ? ? -43.41 153.29 44 4 GLU A 46 ? ? 33.99 62.45 45 4 VAL A 48 ? ? -73.22 -95.29 46 4 GLU A 54 ? ? -171.45 37.29 47 4 LYS A 56 ? ? 39.71 -163.23 48 4 ALA A 59 ? ? -150.06 -50.37 49 4 ILE A 60 ? ? -154.88 -39.35 50 4 ASP A 61 ? ? 58.73 174.35 51 5 GLU A 7 ? ? -162.10 60.06 52 5 ARG A 9 ? ? 62.03 131.03 53 5 ASP A 11 ? ? 38.96 -157.49 54 5 PRO A 14 ? ? -83.53 42.08 55 5 ARG A 26 ? ? 70.43 52.01 56 5 LEU A 35 ? ? 79.50 74.43 57 5 GLU A 38 ? ? -156.34 -20.18 58 5 VAL A 48 ? ? -81.63 47.05 59 5 ARG A 49 ? ? 56.59 -73.15 60 5 ILE A 60 ? ? 57.27 -3.28 61 5 ASP A 61 ? ? -174.19 -115.24 62 6 THR A 5 ? ? 43.86 92.56 63 6 ARG A 9 ? ? -65.08 -93.17 64 6 LYS A 10 ? ? -57.73 102.72 65 6 PRO A 14 ? ? -74.38 -160.97 66 6 ARG A 27 ? ? 60.02 62.94 67 6 ALA A 32 ? ? -123.80 -84.84 68 6 LEU A 33 ? ? 86.49 -33.85 69 6 ASP A 34 ? ? -173.31 92.60 70 6 LYS A 37 ? ? 34.48 75.98 71 6 GLU A 38 ? ? -151.03 -49.28 72 6 PRO A 45 ? ? -42.97 82.98 73 6 VAL A 48 ? ? 31.34 90.28 74 6 PHE A 50 ? ? 43.69 86.04 75 6 GLU A 54 ? ? -166.12 75.98 76 6 LYS A 55 ? ? 51.07 83.06 77 7 MET A 4 ? ? -90.65 -62.01 78 7 ASP A 11 ? ? -76.81 -146.34 79 7 PRO A 13 ? ? -50.52 109.25 80 7 LEU A 35 ? ? -16.93 84.09 81 7 LYS A 37 ? ? 55.78 75.24 82 7 PRO A 45 ? ? -80.06 -98.02 83 7 GLU A 46 ? ? 71.07 65.24 84 7 PHE A 50 ? ? 58.06 5.88 85 7 ASP A 52 ? ? 43.83 -98.62 86 7 TRP A 53 ? ? 39.69 62.60 87 7 LYS A 55 ? ? -157.32 -81.67 88 7 LYS A 56 ? ? 47.21 92.38 89 7 ILE A 60 ? ? -41.86 87.78 90 8 ASP A 11 ? ? -105.30 -140.78 91 8 LEU A 12 ? ? -45.74 155.97 92 8 PRO A 13 ? ? -45.55 -174.87 93 8 GLU A 38 ? ? -159.99 -31.18 94 8 GLU A 46 ? ? -90.30 -64.28 95 8 GLU A 54 ? ? 55.81 -78.21 96 8 LYS A 55 ? ? 59.62 75.43 97 8 LYS A 56 ? ? 39.69 -108.42 98 8 ALA A 59 ? ? 162.62 -21.47 99 8 ASP A 61 ? ? 56.51 -88.60 100 9 GLU A 7 ? ? -122.09 -58.46 101 9 LYS A 10 ? ? 52.40 -124.85 102 9 PRO A 14 ? ? -38.91 85.68 103 9 ARG A 27 ? ? -49.45 85.06 104 9 LEU A 33 ? ? 87.07 74.19 105 9 ASP A 34 ? ? 36.56 -89.55 106 9 LEU A 35 ? ? 61.69 72.85 107 9 GLU A 38 ? ? -136.93 -30.25 108 9 ASN A 43 ? ? 58.11 -175.89 109 9 GLU A 54 ? ? 38.22 82.13 110 9 ALA A 59 ? ? -170.59 38.23 111 9 ASP A 61 ? ? 44.77 -88.22 112 10 THR A 5 ? ? 40.80 77.42 113 10 ARG A 9 ? ? 60.16 161.31 114 10 LYS A 10 ? ? 68.58 -37.77 115 10 ASP A 11 ? ? 34.02 -88.04 116 10 PRO A 13 ? ? -42.10 155.42 117 10 ARG A 26 ? ? 37.30 -117.06 118 10 ARG A 27 ? ? -176.92 38.92 119 10 ASP A 34 ? ? 43.78 74.40 120 10 LEU A 35 ? ? -154.76 58.52 121 10 GLU A 38 ? ? -145.65 -39.02 122 10 ASN A 43 ? ? -103.13 72.49 123 10 ARG A 49 ? ? -83.00 47.34 124 10 GLU A 54 ? ? -161.73 -30.80 125 10 LYS A 55 ? ? 33.49 -141.10 126 10 ILE A 58 ? ? 37.83 25.34 # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' # _pdbx_nmr_ensemble.entry_id 2K5K _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2K5K _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system 1 ;0.87 mM [U-100% 13C; U-100% 15N] RhR2, 0.2 % sodium azide, 100 mM DTT, 5 mM CaCl2, 100 mM sodium chloride, 20 mM MES, 95% H2O/5% D2O ; ? 2 ;0.74 mM [U-100% 13C; U-100% 15N] RhR2, 0.2 % sodium azide, 100 mM DTT, 5 mM CaCl2, 100 mM sodium chloride, 20 mM MES, 8 % Pentaethylene glycol monodecyl ether, 95% H2O/5% D2O ; ? # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id RhR2 0.87 mM '[U-100% 13C; U-100% 15N]' 1 'sodium azide' 0.2 % ? 1 DTT 100 mM ? 1 CaCl2 5 mM ? 1 'sodium chloride' 100 mM ? 1 MES 20 mM ? 1 RhR2 0.74 mM '[U-100% 13C; U-100% 15N]' 2 'sodium azide' 0.2 % ? 2 DTT 100 mM ? 2 CaCl2 5 mM ? 2 'sodium chloride' 100 mM ? 2 MES 20 mM ? 2 'Pentaethylene glycol monodecyl ether' 8 % ? 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 '2D 1H-15N HSQC' 1 2 1 '3D CBCA(CO)NH' 1 3 1 '3D C(CO)NH' 1 4 1 '3D HNCO' 1 5 1 '3D HNCACB' 1 6 1 '3D H(CCO)NH' 1 7 1 '3D HCCH-TOCSY' 1 8 1 '3D 1H-15N NOESY' 1 9 1 '3D 1H-15N TOCSY' 1 10 1 '3D 1H-13C NOESY' 1 11 1 '2D 1H-15N HSQCTROSY' 2 # _pdbx_nmr_refine.entry_id 2K5K _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal 'structure solution' CYANA 2.1 'Guntert, Mumenthaler and Wuthrich' 1 refinement 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' 2 'chemical shift assignment' Sparky ? Goddard 3 'data analysis' TALOS ? 'Cornilescu, Delaglio and Bax' 4 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 5 'data analysis' PSVS ? 'Bhattacharya and Montelione' 6 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LEU 63 ? A LEU 63 2 1 Y 1 A GLU 64 ? A GLU 64 3 1 Y 1 A HIS 65 ? A HIS 65 4 1 Y 1 A HIS 66 ? A HIS 66 5 1 Y 1 A HIS 67 ? A HIS 67 6 1 Y 1 A HIS 68 ? A HIS 68 7 1 Y 1 A HIS 69 ? A HIS 69 8 1 Y 1 A HIS 70 ? A HIS 70 9 2 Y 1 A LEU 63 ? A LEU 63 10 2 Y 1 A GLU 64 ? A GLU 64 11 2 Y 1 A HIS 65 ? A HIS 65 12 2 Y 1 A HIS 66 ? A HIS 66 13 2 Y 1 A HIS 67 ? A HIS 67 14 2 Y 1 A HIS 68 ? A HIS 68 15 2 Y 1 A HIS 69 ? A HIS 69 16 2 Y 1 A HIS 70 ? A HIS 70 17 3 Y 1 A LEU 63 ? A LEU 63 18 3 Y 1 A GLU 64 ? A GLU 64 19 3 Y 1 A HIS 65 ? A HIS 65 20 3 Y 1 A HIS 66 ? A HIS 66 21 3 Y 1 A HIS 67 ? A HIS 67 22 3 Y 1 A HIS 68 ? A HIS 68 23 3 Y 1 A HIS 69 ? A HIS 69 24 3 Y 1 A HIS 70 ? A HIS 70 25 4 Y 1 A LEU 63 ? A LEU 63 26 4 Y 1 A GLU 64 ? A GLU 64 27 4 Y 1 A HIS 65 ? A HIS 65 28 4 Y 1 A HIS 66 ? A HIS 66 29 4 Y 1 A HIS 67 ? A HIS 67 30 4 Y 1 A HIS 68 ? A HIS 68 31 4 Y 1 A HIS 69 ? A HIS 69 32 4 Y 1 A HIS 70 ? A HIS 70 33 5 Y 1 A LEU 63 ? A LEU 63 34 5 Y 1 A GLU 64 ? A GLU 64 35 5 Y 1 A HIS 65 ? A HIS 65 36 5 Y 1 A HIS 66 ? A HIS 66 37 5 Y 1 A HIS 67 ? A HIS 67 38 5 Y 1 A HIS 68 ? A HIS 68 39 5 Y 1 A HIS 69 ? A HIS 69 40 5 Y 1 A HIS 70 ? A HIS 70 41 6 Y 1 A LEU 63 ? A LEU 63 42 6 Y 1 A GLU 64 ? A GLU 64 43 6 Y 1 A HIS 65 ? A HIS 65 44 6 Y 1 A HIS 66 ? A HIS 66 45 6 Y 1 A HIS 67 ? A HIS 67 46 6 Y 1 A HIS 68 ? A HIS 68 47 6 Y 1 A HIS 69 ? A HIS 69 48 6 Y 1 A HIS 70 ? A HIS 70 49 7 Y 1 A LEU 63 ? A LEU 63 50 7 Y 1 A GLU 64 ? A GLU 64 51 7 Y 1 A HIS 65 ? A HIS 65 52 7 Y 1 A HIS 66 ? A HIS 66 53 7 Y 1 A HIS 67 ? A HIS 67 54 7 Y 1 A HIS 68 ? A HIS 68 55 7 Y 1 A HIS 69 ? A HIS 69 56 7 Y 1 A HIS 70 ? A HIS 70 57 8 Y 1 A LEU 63 ? A LEU 63 58 8 Y 1 A GLU 64 ? A GLU 64 59 8 Y 1 A HIS 65 ? A HIS 65 60 8 Y 1 A HIS 66 ? A HIS 66 61 8 Y 1 A HIS 67 ? A HIS 67 62 8 Y 1 A HIS 68 ? A HIS 68 63 8 Y 1 A HIS 69 ? A HIS 69 64 8 Y 1 A HIS 70 ? A HIS 70 65 9 Y 1 A LEU 63 ? A LEU 63 66 9 Y 1 A GLU 64 ? A GLU 64 67 9 Y 1 A HIS 65 ? A HIS 65 68 9 Y 1 A HIS 66 ? A HIS 66 69 9 Y 1 A HIS 67 ? A HIS 67 70 9 Y 1 A HIS 68 ? A HIS 68 71 9 Y 1 A HIS 69 ? A HIS 69 72 9 Y 1 A HIS 70 ? A HIS 70 73 10 Y 1 A LEU 63 ? A LEU 63 74 10 Y 1 A GLU 64 ? A GLU 64 75 10 Y 1 A HIS 65 ? A HIS 65 76 10 Y 1 A HIS 66 ? A HIS 66 77 10 Y 1 A HIS 67 ? A HIS 67 78 10 Y 1 A HIS 68 ? A HIS 68 79 10 Y 1 A HIS 69 ? A HIS 69 80 10 Y 1 A HIS 70 ? A HIS 70 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLU N N N N 74 GLU CA C N S 75 GLU C C N N 76 GLU O O N N 77 GLU CB C N N 78 GLU CG C N N 79 GLU CD C N N 80 GLU OE1 O N N 81 GLU OE2 O N N 82 GLU OXT O N N 83 GLU H H N N 84 GLU H2 H N N 85 GLU HA H N N 86 GLU HB2 H N N 87 GLU HB3 H N N 88 GLU HG2 H N N 89 GLU HG3 H N N 90 GLU HE2 H N N 91 GLU HXT H N N 92 GLY N N N N 93 GLY CA C N N 94 GLY C C N N 95 GLY O O N N 96 GLY OXT O N N 97 GLY H H N N 98 GLY H2 H N N 99 GLY HA2 H N N 100 GLY HA3 H N N 101 GLY HXT H N N 102 HIS N N N N 103 HIS CA C N S 104 HIS C C N N 105 HIS O O N N 106 HIS CB C N N 107 HIS CG C Y N 108 HIS ND1 N Y N 109 HIS CD2 C Y N 110 HIS CE1 C Y N 111 HIS NE2 N Y N 112 HIS OXT O N N 113 HIS H H N N 114 HIS H2 H N N 115 HIS HA H N N 116 HIS HB2 H N N 117 HIS HB3 H N N 118 HIS HD1 H N N 119 HIS HD2 H N N 120 HIS HE1 H N N 121 HIS HE2 H N N 122 HIS HXT H N N 123 ILE N N N N 124 ILE CA C N S 125 ILE C C N N 126 ILE O O N N 127 ILE CB C N S 128 ILE CG1 C N N 129 ILE CG2 C N N 130 ILE CD1 C N N 131 ILE OXT O N N 132 ILE H H N N 133 ILE H2 H N N 134 ILE HA H N N 135 ILE HB H N N 136 ILE HG12 H N N 137 ILE HG13 H N N 138 ILE HG21 H N N 139 ILE HG22 H N N 140 ILE HG23 H N N 141 ILE HD11 H N N 142 ILE HD12 H N N 143 ILE HD13 H N N 144 ILE HXT H N N 145 LEU N N N N 146 LEU CA C N S 147 LEU C C N N 148 LEU O O N N 149 LEU CB C N N 150 LEU CG C N N 151 LEU CD1 C N N 152 LEU CD2 C N N 153 LEU OXT O N N 154 LEU H H N N 155 LEU H2 H N N 156 LEU HA H N N 157 LEU HB2 H N N 158 LEU HB3 H N N 159 LEU HG H N N 160 LEU HD11 H N N 161 LEU HD12 H N N 162 LEU HD13 H N N 163 LEU HD21 H N N 164 LEU HD22 H N N 165 LEU HD23 H N N 166 LEU HXT H N N 167 LYS N N N N 168 LYS CA C N S 169 LYS C C N N 170 LYS O O N N 171 LYS CB C N N 172 LYS CG C N N 173 LYS CD C N N 174 LYS CE C N N 175 LYS NZ N N N 176 LYS OXT O N N 177 LYS H H N N 178 LYS H2 H N N 179 LYS HA H N N 180 LYS HB2 H N N 181 LYS HB3 H N N 182 LYS HG2 H N N 183 LYS HG3 H N N 184 LYS HD2 H N N 185 LYS HD3 H N N 186 LYS HE2 H N N 187 LYS HE3 H N N 188 LYS HZ1 H N N 189 LYS HZ2 H N N 190 LYS HZ3 H N N 191 LYS HXT H N N 192 MET N N N N 193 MET CA C N S 194 MET C C N N 195 MET O O N N 196 MET CB C N N 197 MET CG C N N 198 MET SD S N N 199 MET CE C N N 200 MET OXT O N N 201 MET H H N N 202 MET H2 H N N 203 MET HA H N N 204 MET HB2 H N N 205 MET HB3 H N N 206 MET HG2 H N N 207 MET HG3 H N N 208 MET HE1 H N N 209 MET HE2 H N N 210 MET HE3 H N N 211 MET HXT H N N 212 PHE N N N N 213 PHE CA C N S 214 PHE C C N N 215 PHE O O N N 216 PHE CB C N N 217 PHE CG C Y N 218 PHE CD1 C Y N 219 PHE CD2 C Y N 220 PHE CE1 C Y N 221 PHE CE2 C Y N 222 PHE CZ C Y N 223 PHE OXT O N N 224 PHE H H N N 225 PHE H2 H N N 226 PHE HA H N N 227 PHE HB2 H N N 228 PHE HB3 H N N 229 PHE HD1 H N N 230 PHE HD2 H N N 231 PHE HE1 H N N 232 PHE HE2 H N N 233 PHE HZ H N N 234 PHE HXT H N N 235 PRO N N N N 236 PRO CA C N S 237 PRO C C N N 238 PRO O O N N 239 PRO CB C N N 240 PRO CG C N N 241 PRO CD C N N 242 PRO OXT O N N 243 PRO H H N N 244 PRO HA H N N 245 PRO HB2 H N N 246 PRO HB3 H N N 247 PRO HG2 H N N 248 PRO HG3 H N N 249 PRO HD2 H N N 250 PRO HD3 H N N 251 PRO HXT H N N 252 THR N N N N 253 THR CA C N S 254 THR C C N N 255 THR O O N N 256 THR CB C N R 257 THR OG1 O N N 258 THR CG2 C N N 259 THR OXT O N N 260 THR H H N N 261 THR H2 H N N 262 THR HA H N N 263 THR HB H N N 264 THR HG1 H N N 265 THR HG21 H N N 266 THR HG22 H N N 267 THR HG23 H N N 268 THR HXT H N N 269 TRP N N N N 270 TRP CA C N S 271 TRP C C N N 272 TRP O O N N 273 TRP CB C N N 274 TRP CG C Y N 275 TRP CD1 C Y N 276 TRP CD2 C Y N 277 TRP NE1 N Y N 278 TRP CE2 C Y N 279 TRP CE3 C Y N 280 TRP CZ2 C Y N 281 TRP CZ3 C Y N 282 TRP CH2 C Y N 283 TRP OXT O N N 284 TRP H H N N 285 TRP H2 H N N 286 TRP HA H N N 287 TRP HB2 H N N 288 TRP HB3 H N N 289 TRP HD1 H N N 290 TRP HE1 H N N 291 TRP HE3 H N N 292 TRP HZ2 H N N 293 TRP HZ3 H N N 294 TRP HH2 H N N 295 TRP HXT H N N 296 VAL N N N N 297 VAL CA C N S 298 VAL C C N N 299 VAL O O N N 300 VAL CB C N N 301 VAL CG1 C N N 302 VAL CG2 C N N 303 VAL OXT O N N 304 VAL H H N N 305 VAL H2 H N N 306 VAL HA H N N 307 VAL HB H N N 308 VAL HG11 H N N 309 VAL HG12 H N N 310 VAL HG13 H N N 311 VAL HG21 H N N 312 VAL HG22 H N N 313 VAL HG23 H N N 314 VAL HXT H N N 315 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLU N CA sing N N 70 GLU N H sing N N 71 GLU N H2 sing N N 72 GLU CA C sing N N 73 GLU CA CB sing N N 74 GLU CA HA sing N N 75 GLU C O doub N N 76 GLU C OXT sing N N 77 GLU CB CG sing N N 78 GLU CB HB2 sing N N 79 GLU CB HB3 sing N N 80 GLU CG CD sing N N 81 GLU CG HG2 sing N N 82 GLU CG HG3 sing N N 83 GLU CD OE1 doub N N 84 GLU CD OE2 sing N N 85 GLU OE2 HE2 sing N N 86 GLU OXT HXT sing N N 87 GLY N CA sing N N 88 GLY N H sing N N 89 GLY N H2 sing N N 90 GLY CA C sing N N 91 GLY CA HA2 sing N N 92 GLY CA HA3 sing N N 93 GLY C O doub N N 94 GLY C OXT sing N N 95 GLY OXT HXT sing N N 96 HIS N CA sing N N 97 HIS N H sing N N 98 HIS N H2 sing N N 99 HIS CA C sing N N 100 HIS CA CB sing N N 101 HIS CA HA sing N N 102 HIS C O doub N N 103 HIS C OXT sing N N 104 HIS CB CG sing N N 105 HIS CB HB2 sing N N 106 HIS CB HB3 sing N N 107 HIS CG ND1 sing Y N 108 HIS CG CD2 doub Y N 109 HIS ND1 CE1 doub Y N 110 HIS ND1 HD1 sing N N 111 HIS CD2 NE2 sing Y N 112 HIS CD2 HD2 sing N N 113 HIS CE1 NE2 sing Y N 114 HIS CE1 HE1 sing N N 115 HIS NE2 HE2 sing N N 116 HIS OXT HXT sing N N 117 ILE N CA sing N N 118 ILE N H sing N N 119 ILE N H2 sing N N 120 ILE CA C sing N N 121 ILE CA CB sing N N 122 ILE CA HA sing N N 123 ILE C O doub N N 124 ILE C OXT sing N N 125 ILE CB CG1 sing N N 126 ILE CB CG2 sing N N 127 ILE CB HB sing N N 128 ILE CG1 CD1 sing N N 129 ILE CG1 HG12 sing N N 130 ILE CG1 HG13 sing N N 131 ILE CG2 HG21 sing N N 132 ILE CG2 HG22 sing N N 133 ILE CG2 HG23 sing N N 134 ILE CD1 HD11 sing N N 135 ILE CD1 HD12 sing N N 136 ILE CD1 HD13 sing N N 137 ILE OXT HXT sing N N 138 LEU N CA sing N N 139 LEU N H sing N N 140 LEU N H2 sing N N 141 LEU CA C sing N N 142 LEU CA CB sing N N 143 LEU CA HA sing N N 144 LEU C O doub N N 145 LEU C OXT sing N N 146 LEU CB CG sing N N 147 LEU CB HB2 sing N N 148 LEU CB HB3 sing N N 149 LEU CG CD1 sing N N 150 LEU CG CD2 sing N N 151 LEU CG HG sing N N 152 LEU CD1 HD11 sing N N 153 LEU CD1 HD12 sing N N 154 LEU CD1 HD13 sing N N 155 LEU CD2 HD21 sing N N 156 LEU CD2 HD22 sing N N 157 LEU CD2 HD23 sing N N 158 LEU OXT HXT sing N N 159 LYS N CA sing N N 160 LYS N H sing N N 161 LYS N H2 sing N N 162 LYS CA C sing N N 163 LYS CA CB sing N N 164 LYS CA HA sing N N 165 LYS C O doub N N 166 LYS C OXT sing N N 167 LYS CB CG sing N N 168 LYS CB HB2 sing N N 169 LYS CB HB3 sing N N 170 LYS CG CD sing N N 171 LYS CG HG2 sing N N 172 LYS CG HG3 sing N N 173 LYS CD CE sing N N 174 LYS CD HD2 sing N N 175 LYS CD HD3 sing N N 176 LYS CE NZ sing N N 177 LYS CE HE2 sing N N 178 LYS CE HE3 sing N N 179 LYS NZ HZ1 sing N N 180 LYS NZ HZ2 sing N N 181 LYS NZ HZ3 sing N N 182 LYS OXT HXT sing N N 183 MET N CA sing N N 184 MET N H sing N N 185 MET N H2 sing N N 186 MET CA C sing N N 187 MET CA CB sing N N 188 MET CA HA sing N N 189 MET C O doub N N 190 MET C OXT sing N N 191 MET CB CG sing N N 192 MET CB HB2 sing N N 193 MET CB HB3 sing N N 194 MET CG SD sing N N 195 MET CG HG2 sing N N 196 MET CG HG3 sing N N 197 MET SD CE sing N N 198 MET CE HE1 sing N N 199 MET CE HE2 sing N N 200 MET CE HE3 sing N N 201 MET OXT HXT sing N N 202 PHE N CA sing N N 203 PHE N H sing N N 204 PHE N H2 sing N N 205 PHE CA C sing N N 206 PHE CA CB sing N N 207 PHE CA HA sing N N 208 PHE C O doub N N 209 PHE C OXT sing N N 210 PHE CB CG sing N N 211 PHE CB HB2 sing N N 212 PHE CB HB3 sing N N 213 PHE CG CD1 doub Y N 214 PHE CG CD2 sing Y N 215 PHE CD1 CE1 sing Y N 216 PHE CD1 HD1 sing N N 217 PHE CD2 CE2 doub Y N 218 PHE CD2 HD2 sing N N 219 PHE CE1 CZ doub Y N 220 PHE CE1 HE1 sing N N 221 PHE CE2 CZ sing Y N 222 PHE CE2 HE2 sing N N 223 PHE CZ HZ sing N N 224 PHE OXT HXT sing N N 225 PRO N CA sing N N 226 PRO N CD sing N N 227 PRO N H sing N N 228 PRO CA C sing N N 229 PRO CA CB sing N N 230 PRO CA HA sing N N 231 PRO C O doub N N 232 PRO C OXT sing N N 233 PRO CB CG sing N N 234 PRO CB HB2 sing N N 235 PRO CB HB3 sing N N 236 PRO CG CD sing N N 237 PRO CG HG2 sing N N 238 PRO CG HG3 sing N N 239 PRO CD HD2 sing N N 240 PRO CD HD3 sing N N 241 PRO OXT HXT sing N N 242 THR N CA sing N N 243 THR N H sing N N 244 THR N H2 sing N N 245 THR CA C sing N N 246 THR CA CB sing N N 247 THR CA HA sing N N 248 THR C O doub N N 249 THR C OXT sing N N 250 THR CB OG1 sing N N 251 THR CB CG2 sing N N 252 THR CB HB sing N N 253 THR OG1 HG1 sing N N 254 THR CG2 HG21 sing N N 255 THR CG2 HG22 sing N N 256 THR CG2 HG23 sing N N 257 THR OXT HXT sing N N 258 TRP N CA sing N N 259 TRP N H sing N N 260 TRP N H2 sing N N 261 TRP CA C sing N N 262 TRP CA CB sing N N 263 TRP CA HA sing N N 264 TRP C O doub N N 265 TRP C OXT sing N N 266 TRP CB CG sing N N 267 TRP CB HB2 sing N N 268 TRP CB HB3 sing N N 269 TRP CG CD1 doub Y N 270 TRP CG CD2 sing Y N 271 TRP CD1 NE1 sing Y N 272 TRP CD1 HD1 sing N N 273 TRP CD2 CE2 doub Y N 274 TRP CD2 CE3 sing Y N 275 TRP NE1 CE2 sing Y N 276 TRP NE1 HE1 sing N N 277 TRP CE2 CZ2 sing Y N 278 TRP CE3 CZ3 doub Y N 279 TRP CE3 HE3 sing N N 280 TRP CZ2 CH2 doub Y N 281 TRP CZ2 HZ2 sing N N 282 TRP CZ3 CH2 sing Y N 283 TRP CZ3 HZ3 sing N N 284 TRP CH2 HH2 sing N N 285 TRP OXT HXT sing N N 286 VAL N CA sing N N 287 VAL N H sing N N 288 VAL N H2 sing N N 289 VAL CA C sing N N 290 VAL CA CB sing N N 291 VAL CA HA sing N N 292 VAL C O doub N N 293 VAL C OXT sing N N 294 VAL CB CG1 sing N N 295 VAL CB CG2 sing N N 296 VAL CB HB sing N N 297 VAL CG1 HG11 sing N N 298 VAL CG1 HG12 sing N N 299 VAL CG1 HG13 sing N N 300 VAL CG2 HG21 sing N N 301 VAL CG2 HG22 sing N N 302 VAL CG2 HG23 sing N N 303 VAL OXT HXT sing N N 304 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 2K5K _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_