data_2K5Q # _entry.id 2K5Q # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2K5Q pdb_00002k5q 10.2210/pdb2k5q/pdb RCSB RCSB100709 ? ? WWPDB D_1000100709 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-08-26 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 4 'Structure model' 1 3 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_spectrometer 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' struct_ref_seq_dif 6 4 'Structure model' chem_comp_atom 7 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_spectrometer.model' 4 3 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2K5Q _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2008-06-30 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified BcR97A TargetDB . unspecified 15846 BMRB . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Swapna, G.' 1 'Wang, D.' 2 'Owens, L.' 3 'Xiao, R.' 4 'Liu, J.' 5 'Baran, M.C.' 6 'Everett, J.' 7 'Acton, T.B.' 8 'Rost, B.' 9 'Montelione, G.T.' 10 'Northeast Structural Genomics Consortium (NESG)' 11 # _citation.id primary _citation.title 'NMR solution Structure of Membrane associated protein from Bacillus cereus: Northeast Structural Genomics Consortium Target: BcR97A' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Swapna, G.' 1 ? primary 'Wang, D.C.' 2 ? primary 'Owens, L.' 3 ? primary 'Xiao, R.' 4 ? primary 'Liu, J.' 5 ? primary 'Baran, M.C.' 6 ? primary 'Everett, J.' 7 ? primary 'Acton, T.B.' 8 ? primary 'Rost, B.' 9 ? primary 'Montelione, G.T.' 10 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Hypothetical Membrane Associated Protein BcR97A' _entity.formula_weight 12458.083 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MDLNRMGKDEYYVQITVDGKEVHSKADNGQKYKDYEYKLTGFDKDGKEKELEFTAQKNLRKEAFLRVYHSDKKGVSAWEE VKKDELPAKVKEKLGVKLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MDLNRMGKDEYYVQITVDGKEVHSKADNGQKYKDYEYKLTGFDKDGKEKELEFTAQKNLRKEAFLRVYHSDKKGVSAWEE VKKDELPAKVKEKLGVKLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier BcR97A # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 LEU n 1 4 ASN n 1 5 ARG n 1 6 MET n 1 7 GLY n 1 8 LYS n 1 9 ASP n 1 10 GLU n 1 11 TYR n 1 12 TYR n 1 13 VAL n 1 14 GLN n 1 15 ILE n 1 16 THR n 1 17 VAL n 1 18 ASP n 1 19 GLY n 1 20 LYS n 1 21 GLU n 1 22 VAL n 1 23 HIS n 1 24 SER n 1 25 LYS n 1 26 ALA n 1 27 ASP n 1 28 ASN n 1 29 GLY n 1 30 GLN n 1 31 LYS n 1 32 TYR n 1 33 LYS n 1 34 ASP n 1 35 TYR n 1 36 GLU n 1 37 TYR n 1 38 LYS n 1 39 LEU n 1 40 THR n 1 41 GLY n 1 42 PHE n 1 43 ASP n 1 44 LYS n 1 45 ASP n 1 46 GLY n 1 47 LYS n 1 48 GLU n 1 49 LYS n 1 50 GLU n 1 51 LEU n 1 52 GLU n 1 53 PHE n 1 54 THR n 1 55 ALA n 1 56 GLN n 1 57 LYS n 1 58 ASN n 1 59 LEU n 1 60 ARG n 1 61 LYS n 1 62 GLU n 1 63 ALA n 1 64 PHE n 1 65 LEU n 1 66 ARG n 1 67 VAL n 1 68 TYR n 1 69 HIS n 1 70 SER n 1 71 ASP n 1 72 LYS n 1 73 LYS n 1 74 GLY n 1 75 VAL n 1 76 SER n 1 77 ALA n 1 78 TRP n 1 79 GLU n 1 80 GLU n 1 81 VAL n 1 82 LYS n 1 83 LYS n 1 84 ASP n 1 85 GLU n 1 86 LEU n 1 87 PRO n 1 88 ALA n 1 89 LYS n 1 90 VAL n 1 91 LYS n 1 92 GLU n 1 93 LYS n 1 94 LEU n 1 95 GLY n 1 96 VAL n 1 97 LYS n 1 98 LEU n 1 99 GLU n 1 100 HIS n 1 101 HIS n 1 102 HIS n 1 103 HIS n 1 104 HIS n 1 105 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Bacillus _entity_src_gen.pdbx_gene_src_gene BC_4932 _entity_src_gen.gene_src_species cereus _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacillus cereus ATCC 14579' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 226900 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species coli _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)+MAGIC' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET 21-23C' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 ASN 4 4 4 ASN ASN A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 MET 6 6 6 MET MET A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 TYR 11 11 11 TYR TYR A . n A 1 12 TYR 12 12 12 TYR TYR A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 HIS 23 23 23 HIS HIS A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 ASN 28 28 28 ASN ASN A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 TYR 32 32 32 TYR TYR A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 TYR 68 68 68 TYR TYR A . n A 1 69 HIS 69 69 69 HIS HIS A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 LYS 73 73 73 LYS LYS A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 TRP 78 78 78 TRP TRP A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 PRO 87 87 87 PRO PRO A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 VAL 96 96 96 VAL VAL A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 HIS 100 100 100 HIS HIS A . n A 1 101 HIS 101 101 101 HIS HIS A . n A 1 102 HIS 102 102 102 HIS HIS A . n A 1 103 HIS 103 103 103 HIS HIS A . n A 1 104 HIS 104 104 104 HIS HIS A . n A 1 105 HIS 105 105 105 HIS HIS A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2K5Q _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2K5Q _struct.title 'NMR Solution structure of membrane associated protein from Bacillus cereus: Northeast Structural Genomics Consortium Target: BcR97A' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag Y _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2K5Q _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' _struct_keywords.text ;NESG, BcR97A, Bacillus cereus, Q812L6 protein, GFT NMR, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, MEMBRANE PROTEIN ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q812L6_BACCR _struct_ref.pdbx_db_accession Q812L6 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;DLNRMGKDEYYVQITVDGKEVHSKADNGQKYKDYEYKLTGFDKDGKEKELEFTAQKNLRKEAFLRVYHSDKKGVSAWEEV KKDELPAKVKEKLGVK ; _struct_ref.pdbx_align_begin 22 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2K5Q _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 97 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q812L6 _struct_ref_seq.db_align_beg 22 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 117 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 97 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2K5Q MET A 1 ? UNP Q812L6 ? ? 'expression tag' 1 1 1 2K5Q LEU A 98 ? UNP Q812L6 ? ? 'expression tag' 98 2 1 2K5Q GLU A 99 ? UNP Q812L6 ? ? 'expression tag' 99 3 1 2K5Q HIS A 100 ? UNP Q812L6 ? ? 'expression tag' 100 4 1 2K5Q HIS A 101 ? UNP Q812L6 ? ? 'expression tag' 101 5 1 2K5Q HIS A 102 ? UNP Q812L6 ? ? 'expression tag' 102 6 1 2K5Q HIS A 103 ? UNP Q812L6 ? ? 'expression tag' 103 7 1 2K5Q HIS A 104 ? UNP Q812L6 ? ? 'expression tag' 104 8 1 2K5Q HIS A 105 ? UNP Q812L6 ? ? 'expression tag' 105 9 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 HIS A 23 ? ASP A 27 ? HIS A 23 ASP A 27 5 ? 5 HELX_P HELX_P2 2 ALA A 88 ? LEU A 94 ? ALA A 88 LEU A 94 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ASP A 9 ? GLN A 14 ? ASP A 9 GLN A 14 A 2 PHE A 64 ? HIS A 69 ? PHE A 64 HIS A 69 A 3 TRP A 78 ? VAL A 81 ? TRP A 78 VAL A 81 B 1 GLU A 21 ? VAL A 22 ? GLU A 21 VAL A 22 B 2 ASP A 34 ? PHE A 42 ? ASP A 34 PHE A 42 B 3 GLU A 48 ? ALA A 55 ? GLU A 48 ALA A 55 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N TYR A 11 ? N TYR A 11 O VAL A 67 ? O VAL A 67 A 2 3 N ARG A 66 ? N ARG A 66 O GLU A 79 ? O GLU A 79 B 1 2 N VAL A 22 ? N VAL A 22 O ASP A 34 ? O ASP A 34 B 2 3 N GLY A 41 ? N GLY A 41 O LYS A 49 ? O LYS A 49 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 8 _pdbx_validate_close_contact.auth_atom_id_1 HG3 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 LYS _pdbx_validate_close_contact.auth_seq_id_1 72 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 H _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 LYS _pdbx_validate_close_contact.auth_seq_id_2 73 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.34 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 4 ? ? 46.90 -86.38 2 1 MET A 6 ? ? 52.69 -93.25 3 1 ILE A 15 ? ? -65.09 93.31 4 1 ASP A 27 ? ? 44.79 -80.26 5 1 LYS A 73 ? ? -151.20 2.82 6 1 SER A 76 ? ? -151.43 -60.45 7 1 LYS A 93 ? ? -90.70 -60.79 8 1 HIS A 102 ? ? -57.77 102.96 9 2 ASP A 2 ? ? -66.69 85.54 10 2 LYS A 8 ? ? -81.00 -125.26 11 2 ILE A 15 ? ? -69.72 92.96 12 2 SER A 24 ? ? -67.91 69.05 13 2 LYS A 25 ? ? 165.37 -29.52 14 2 GLN A 30 ? ? -63.54 86.89 15 2 LYS A 31 ? ? -142.05 -1.20 16 2 LEU A 59 ? ? -105.15 -165.24 17 2 LYS A 73 ? ? 67.28 -72.87 18 2 VAL A 75 ? ? 68.22 102.71 19 2 LEU A 94 ? ? 67.39 106.20 20 3 MET A 6 ? ? 59.00 -169.48 21 3 LYS A 8 ? ? 65.39 148.64 22 3 LYS A 25 ? ? -170.01 14.35 23 3 ASP A 27 ? ? 61.43 94.90 24 3 ARG A 60 ? ? -57.15 109.68 25 3 LYS A 73 ? ? -150.77 28.28 26 3 SER A 76 ? ? -135.88 -35.94 27 3 LYS A 93 ? ? -93.75 -60.53 28 3 LEU A 94 ? ? 175.44 -42.42 29 3 GLU A 99 ? ? -149.76 -26.41 30 3 HIS A 102 ? ? -177.81 102.94 31 4 LYS A 8 ? ? -83.94 -141.38 32 4 HIS A 23 ? ? -72.06 34.10 33 4 SER A 24 ? ? -87.90 30.85 34 4 LYS A 44 ? ? 82.22 -61.86 35 4 ASP A 45 ? ? -162.63 35.04 36 4 ARG A 60 ? ? -57.70 178.16 37 4 LYS A 61 ? ? -120.16 -72.03 38 4 TYR A 68 ? ? -69.92 99.21 39 4 LYS A 73 ? ? 67.35 178.62 40 4 VAL A 75 ? ? 66.40 125.56 41 4 LEU A 94 ? ? 71.97 123.10 42 4 GLU A 99 ? ? -105.70 -86.11 43 4 HIS A 100 ? ? 50.61 87.71 44 4 HIS A 102 ? ? 62.64 85.54 45 4 HIS A 104 ? ? -66.01 94.90 46 5 THR A 16 ? ? -84.52 -71.18 47 5 HIS A 23 ? ? -79.21 38.34 48 5 LYS A 25 ? ? -164.84 93.90 49 5 ASP A 27 ? ? -55.92 85.83 50 5 ASN A 28 ? ? 178.46 -47.45 51 5 LYS A 44 ? ? 61.02 70.85 52 5 GLU A 62 ? ? 74.33 -43.74 53 5 TYR A 68 ? ? -69.51 99.60 54 5 LEU A 98 ? ? -56.77 97.91 55 5 HIS A 100 ? ? 61.73 103.45 56 6 ILE A 15 ? ? -65.60 93.15 57 6 LYS A 20 ? ? -68.73 95.64 58 6 LYS A 44 ? ? 70.85 -66.60 59 6 ASP A 45 ? ? -154.10 -44.44 60 6 LYS A 73 ? ? -143.67 -15.09 61 6 LEU A 98 ? ? -168.23 84.84 62 6 GLU A 99 ? ? -131.56 -47.01 63 6 HIS A 100 ? ? 61.74 -161.83 64 6 HIS A 102 ? ? 70.15 -8.07 65 7 LYS A 25 ? ? 67.54 92.09 66 7 ASP A 27 ? ? -56.55 98.26 67 7 ASN A 28 ? ? 175.25 -27.06 68 7 LYS A 44 ? ? 52.60 -86.29 69 7 ASP A 71 ? ? -65.31 0.31 70 7 LEU A 94 ? ? 64.45 79.30 71 7 LYS A 97 ? ? 173.19 149.85 72 7 HIS A 101 ? ? 54.87 83.99 73 8 THR A 16 ? ? -94.09 -67.93 74 8 LYS A 25 ? ? -110.33 55.12 75 8 ALA A 26 ? ? -126.66 -72.56 76 8 ASP A 27 ? ? 62.87 168.76 77 8 ASN A 28 ? ? 70.81 -34.10 78 8 LYS A 31 ? ? -93.05 45.23 79 8 LYS A 49 ? ? -170.06 143.56 80 8 TYR A 68 ? ? -69.19 95.87 81 8 ASP A 71 ? ? 54.46 -80.24 82 8 LYS A 73 ? ? -155.44 -64.29 83 8 LYS A 93 ? ? -103.58 -67.87 84 8 VAL A 96 ? ? -63.23 98.74 85 8 HIS A 100 ? ? 69.15 -61.47 86 8 HIS A 103 ? ? 61.65 100.26 87 9 ASP A 2 ? ? 53.90 -171.78 88 9 LYS A 8 ? ? -117.66 -85.55 89 9 ILE A 15 ? ? -69.59 98.75 90 9 ALA A 26 ? ? -77.33 32.97 91 9 LEU A 59 ? ? -103.35 -165.92 92 9 GLU A 62 ? ? 67.66 -14.27 93 10 ASN A 4 ? ? -92.31 -75.33 94 10 LYS A 8 ? ? 50.47 81.71 95 10 ASP A 9 ? ? -69.40 98.96 96 10 LYS A 20 ? ? -69.40 91.11 97 10 SER A 24 ? ? -130.97 -33.09 98 10 LYS A 25 ? ? -74.85 25.73 99 10 GLN A 30 ? ? -66.89 96.36 100 10 LYS A 44 ? ? 68.23 -79.32 101 10 GLU A 62 ? ? 75.26 -20.59 102 10 LEU A 98 ? ? 67.56 153.68 103 11 HIS A 23 ? ? -108.32 78.19 104 11 SER A 24 ? ? -150.24 71.97 105 11 LYS A 25 ? ? -178.64 41.58 106 11 ASP A 27 ? ? 60.58 -82.35 107 11 LYS A 31 ? ? -88.19 38.29 108 11 ASP A 71 ? ? -55.71 -70.95 109 11 SER A 76 ? ? -133.58 -39.31 110 11 LYS A 97 ? ? -159.51 -39.13 111 11 HIS A 100 ? ? 66.08 -157.94 112 11 HIS A 102 ? ? -68.10 84.83 113 12 ASN A 4 ? ? -98.46 -65.13 114 12 LYS A 8 ? ? 66.07 -176.48 115 12 THR A 16 ? ? -102.42 -66.61 116 12 LYS A 20 ? ? -69.60 94.75 117 12 VAL A 22 ? ? -92.85 58.89 118 12 HIS A 23 ? ? -98.08 37.67 119 12 LEU A 59 ? ? -105.91 -80.17 120 12 GLU A 62 ? ? 74.46 -36.29 121 12 LYS A 72 ? ? -110.83 -72.21 122 12 LYS A 73 ? ? -156.73 -156.04 123 12 VAL A 75 ? ? 72.48 114.21 124 12 LEU A 98 ? ? -72.01 27.91 125 12 HIS A 104 ? ? 65.78 177.17 126 13 ILE A 15 ? ? -63.97 89.93 127 13 HIS A 23 ? ? -70.41 43.27 128 13 ASN A 28 ? ? -153.79 79.21 129 13 GLN A 30 ? ? -42.21 100.21 130 13 LYS A 44 ? ? 70.68 -79.01 131 13 ASP A 45 ? ? -159.24 69.50 132 13 LEU A 59 ? ? -57.94 -80.61 133 13 ARG A 60 ? ? -177.09 115.67 134 13 ASP A 71 ? ? -55.30 -72.61 135 13 LEU A 98 ? ? 54.76 -178.78 136 13 GLU A 99 ? ? 54.54 77.97 137 14 ARG A 5 ? ? -92.77 -77.83 138 14 MET A 6 ? ? 38.36 -87.25 139 14 LYS A 25 ? ? -176.74 77.43 140 14 ALA A 26 ? ? 39.00 50.69 141 14 ASN A 28 ? ? -142.90 11.54 142 14 LYS A 44 ? ? 47.54 -94.48 143 14 LYS A 73 ? ? -154.67 -50.72 144 14 LEU A 94 ? ? 71.25 131.87 145 14 GLU A 99 ? ? -174.65 94.30 146 14 HIS A 101 ? ? 68.79 -62.87 147 14 HIS A 102 ? ? -49.33 104.89 148 14 HIS A 103 ? ? -140.14 19.42 149 15 MET A 6 ? ? 58.55 -168.10 150 15 THR A 16 ? ? -97.19 -61.53 151 15 HIS A 23 ? ? -98.10 38.15 152 15 SER A 24 ? ? -68.56 78.06 153 15 LYS A 25 ? ? 55.49 17.03 154 15 ASP A 27 ? ? -59.33 92.29 155 15 ASN A 28 ? ? 163.24 -45.62 156 15 LYS A 33 ? ? -165.33 59.37 157 15 LEU A 59 ? ? -85.69 -73.12 158 15 GLU A 62 ? ? 72.16 -21.15 159 15 LYS A 73 ? ? 60.53 173.79 160 15 VAL A 75 ? ? 179.88 165.96 161 15 SER A 76 ? ? -138.12 -57.45 162 15 LEU A 94 ? ? 67.84 116.18 163 15 HIS A 102 ? ? 65.51 -64.84 164 16 ARG A 5 ? ? -109.28 -66.46 165 16 MET A 6 ? ? 62.23 -179.52 166 16 LYS A 20 ? ? -69.14 76.43 167 16 VAL A 22 ? ? -69.35 84.25 168 16 LYS A 25 ? ? 63.21 74.85 169 16 ASP A 27 ? ? 53.29 -153.72 170 16 ASN A 28 ? ? 67.54 -12.34 171 16 PHE A 53 ? ? -172.77 148.35 172 16 ARG A 60 ? ? -57.44 108.04 173 16 LYS A 73 ? ? 64.40 164.45 174 16 VAL A 75 ? ? 69.28 138.22 175 16 HIS A 100 ? ? 68.38 175.82 176 17 VAL A 22 ? ? -118.53 65.57 177 17 SER A 24 ? ? 49.34 -81.00 178 17 LYS A 25 ? ? -153.27 24.59 179 17 ALA A 26 ? ? 64.93 69.78 180 17 ASN A 28 ? ? 71.82 -37.69 181 17 GLN A 30 ? ? -35.41 155.26 182 17 GLU A 62 ? ? 70.67 -19.13 183 17 ALA A 77 ? ? -173.63 148.30 184 17 LEU A 94 ? ? 67.80 -22.86 185 17 GLU A 99 ? ? -96.55 -74.05 186 18 LYS A 8 ? ? -89.16 45.31 187 18 ILE A 15 ? ? -69.35 86.30 188 18 SER A 24 ? ? 61.60 -80.76 189 18 LYS A 25 ? ? -162.65 20.53 190 18 ALA A 26 ? ? -78.69 24.01 191 18 LYS A 33 ? ? -167.68 92.39 192 18 LYS A 61 ? ? -69.32 14.53 193 18 LYS A 73 ? ? -143.23 -8.94 194 18 HIS A 100 ? ? -167.33 -76.05 195 18 HIS A 104 ? ? 68.10 140.84 196 19 LYS A 8 ? ? -72.59 -73.44 197 19 THR A 16 ? ? -96.93 -69.21 198 19 SER A 24 ? ? -164.39 42.70 199 19 LYS A 25 ? ? -164.56 58.83 200 19 ALA A 26 ? ? -169.21 -111.46 201 19 LEU A 59 ? ? -80.52 -89.17 202 19 ARG A 60 ? ? -125.32 -163.90 203 19 LYS A 61 ? ? -129.05 -77.02 204 19 LYS A 97 ? ? -156.67 -51.94 205 19 HIS A 100 ? ? 61.38 81.72 206 19 HIS A 104 ? ? 61.50 -88.64 207 20 MET A 6 ? ? 64.01 175.42 208 20 VAL A 22 ? ? -92.68 57.86 209 20 SER A 24 ? ? -149.00 10.69 210 20 ALA A 26 ? ? -62.00 -87.53 211 20 ASP A 27 ? ? -175.63 85.42 212 20 ASN A 28 ? ? 46.53 27.96 213 20 GLN A 30 ? ? -68.47 86.20 214 20 LYS A 49 ? ? -170.11 93.55 215 20 LYS A 73 ? ? 63.78 -161.78 216 20 VAL A 75 ? ? 64.07 103.44 217 20 LEU A 98 ? ? 58.41 101.19 # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 176 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2K5Q _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 0.35 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method 'PSVS software' # _pdbx_nmr_ensemble_rms.atom_type ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.chain_range_begin ? _pdbx_nmr_ensemble_rms.chain_range_end ? _pdbx_nmr_ensemble_rms.coord_average_rmsd_method ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error ? _pdbx_nmr_ensemble_rms.distance_rms_dev 0.01 _pdbx_nmr_ensemble_rms.distance_rms_dev_error ? _pdbx_nmr_ensemble_rms.entry_id 2K5Q _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev ? _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error ? _pdbx_nmr_ensemble_rms.residue_range_begin ? _pdbx_nmr_ensemble_rms.residue_range_end ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2K5Q _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1.25 mM [U-100% 13C; U-100% 15N] BcR97A protein, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '0.77 mM [U-10% 13C; U-100% 15N] BcR97A protein, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'BcR97A protein' 1.25 mM '[U-100% 13C; U-100% 15N]' 1 'BcR97A protein' 0.77 mM '[U-10% 13C; U-100% 15N]' 2 # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.temperature_units 1 '5mM CaCl2, 100mM NaCl' 6.5 1 atm 293 K 2 '5mM CaCl2, 100mM NaCl' 6.5 1 atm 293 K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D HNCO' 1 4 1 '3D CBCA(CO)NH' 1 5 1 '3D HNCACB' 1 6 1 '3D HBHA(CO)NH' 1 7 1 '3D C(CO)NH' 1 8 1 '3D HCCH-TOCSY' 1 9 1 '3D HCCH-COSY' 1 10 1 '3D 13C-edited_NOESY' 1 11 1 '3D 1H-15N NOESY' 1 12 1 '3D 13C-edited_NOESY' 2 13 2 '2D 1H-15N HSQC' 2 14 2 '2D 1H-13C HSQC' # _pdbx_nmr_details.entry_id 2K5Q _pdbx_nmr_details.text 'GFT (4,3)D data was acquired for backbone assignments.' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2K5Q _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1121 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 245 _pdbx_nmr_constraints.NOE_long_range_total_count 366 _pdbx_nmr_constraints.NOE_medium_range_total_count 129 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 381 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 91 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 51 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 51 # _pdbx_nmr_refine.entry_id 2K5Q _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;The structure was determined using triple resonance NMR spectroscopy. Automated backbone resonance assignments were made using AutoAssign and pattern picker algorithms developed for automated assignments of GFT NMR data. Side chain assignments were completed manually. Automated NOESY assignments were made using AUTOSTRUCTURE and structure solution was determined using AUTOSTRUCTURE and CYANA-2.1. 176 structures were calculated and 20 best conformers were then refined in a shell of water using CNS. Initial Dihedral constriants were obtained from TALOS. The structure calculations were done including the C-terminal tag LEHHHHHH. Completeness of assignments excluding the 8-residue tag are: Backbone ~98.5%, sidechain ~ 95%, stereospecific methyl assignments 100%. The assignments were validated using the AVS software. Final structure quality factors determined using PSVS software: Ordered residues are defined as: 10-22,32-42,47-58,63-69,76-93. (a) RMSD(ordered residues) all Backbone atoms 0.9A; all heavy atoms 1.4A. (b) Ramachandran statistics for all ordered residues: Most favoured regions:85.9%, Additionally allowed regions 14.0%, Generously allowed region:0.2%. (c) Procheck scores for ordered residues (Raw/Z)phi-psi -0.73/-2.56, All:-0.49/-2.90 (d) MolProbity clash score (Raw/Z): 17.11/-1.41. (e) RPFscores for goodness of fit to NOESY data : Recall:0.963 Precision: 0.805F-measure:0.877 DP-score: 0.848 ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Zimmerman, Moseley, Kulikowski and Montelione' 'chemical shift assignment' AutoAssign 2.2.1 1 'Huang, Tejero, Powers and Montelione' 'chemical shift assignment' AutoStructure 2.2.1 2 'Huang, Tejero, Powers and Montelione' 'structure solution' AutoStructure 2.2.1 3 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 4 'Guntert, Mumenthaler and Wuthrich' 'geometry optimization' CYANA 2.1 5 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS 2.0.6 6 'Brunger, Adams, Clore, Gros, Nilges and Read' 'geometry optimization' CNS 2.0.6 7 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TRP N N N N 304 TRP CA C N S 305 TRP C C N N 306 TRP O O N N 307 TRP CB C N N 308 TRP CG C Y N 309 TRP CD1 C Y N 310 TRP CD2 C Y N 311 TRP NE1 N Y N 312 TRP CE2 C Y N 313 TRP CE3 C Y N 314 TRP CZ2 C Y N 315 TRP CZ3 C Y N 316 TRP CH2 C Y N 317 TRP OXT O N N 318 TRP H H N N 319 TRP H2 H N N 320 TRP HA H N N 321 TRP HB2 H N N 322 TRP HB3 H N N 323 TRP HD1 H N N 324 TRP HE1 H N N 325 TRP HE3 H N N 326 TRP HZ2 H N N 327 TRP HZ3 H N N 328 TRP HH2 H N N 329 TRP HXT H N N 330 TYR N N N N 331 TYR CA C N S 332 TYR C C N N 333 TYR O O N N 334 TYR CB C N N 335 TYR CG C Y N 336 TYR CD1 C Y N 337 TYR CD2 C Y N 338 TYR CE1 C Y N 339 TYR CE2 C Y N 340 TYR CZ C Y N 341 TYR OH O N N 342 TYR OXT O N N 343 TYR H H N N 344 TYR H2 H N N 345 TYR HA H N N 346 TYR HB2 H N N 347 TYR HB3 H N N 348 TYR HD1 H N N 349 TYR HD2 H N N 350 TYR HE1 H N N 351 TYR HE2 H N N 352 TYR HH H N N 353 TYR HXT H N N 354 VAL N N N N 355 VAL CA C N S 356 VAL C C N N 357 VAL O O N N 358 VAL CB C N N 359 VAL CG1 C N N 360 VAL CG2 C N N 361 VAL OXT O N N 362 VAL H H N N 363 VAL H2 H N N 364 VAL HA H N N 365 VAL HB H N N 366 VAL HG11 H N N 367 VAL HG12 H N N 368 VAL HG13 H N N 369 VAL HG21 H N N 370 VAL HG22 H N N 371 VAL HG23 H N N 372 VAL HXT H N N 373 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TRP N CA sing N N 291 TRP N H sing N N 292 TRP N H2 sing N N 293 TRP CA C sing N N 294 TRP CA CB sing N N 295 TRP CA HA sing N N 296 TRP C O doub N N 297 TRP C OXT sing N N 298 TRP CB CG sing N N 299 TRP CB HB2 sing N N 300 TRP CB HB3 sing N N 301 TRP CG CD1 doub Y N 302 TRP CG CD2 sing Y N 303 TRP CD1 NE1 sing Y N 304 TRP CD1 HD1 sing N N 305 TRP CD2 CE2 doub Y N 306 TRP CD2 CE3 sing Y N 307 TRP NE1 CE2 sing Y N 308 TRP NE1 HE1 sing N N 309 TRP CE2 CZ2 sing Y N 310 TRP CE3 CZ3 doub Y N 311 TRP CE3 HE3 sing N N 312 TRP CZ2 CH2 doub Y N 313 TRP CZ2 HZ2 sing N N 314 TRP CZ3 CH2 sing Y N 315 TRP CZ3 HZ3 sing N N 316 TRP CH2 HH2 sing N N 317 TRP OXT HXT sing N N 318 TYR N CA sing N N 319 TYR N H sing N N 320 TYR N H2 sing N N 321 TYR CA C sing N N 322 TYR CA CB sing N N 323 TYR CA HA sing N N 324 TYR C O doub N N 325 TYR C OXT sing N N 326 TYR CB CG sing N N 327 TYR CB HB2 sing N N 328 TYR CB HB3 sing N N 329 TYR CG CD1 doub Y N 330 TYR CG CD2 sing Y N 331 TYR CD1 CE1 sing Y N 332 TYR CD1 HD1 sing N N 333 TYR CD2 CE2 doub Y N 334 TYR CD2 HD2 sing N N 335 TYR CE1 CZ doub Y N 336 TYR CE1 HE1 sing N N 337 TYR CE2 CZ sing Y N 338 TYR CE2 HE2 sing N N 339 TYR CZ OH sing N N 340 TYR OH HH sing N N 341 TYR OXT HXT sing N N 342 VAL N CA sing N N 343 VAL N H sing N N 344 VAL N H2 sing N N 345 VAL CA C sing N N 346 VAL CA CB sing N N 347 VAL CA HA sing N N 348 VAL C O doub N N 349 VAL C OXT sing N N 350 VAL CB CG1 sing N N 351 VAL CB CG2 sing N N 352 VAL CB HB sing N N 353 VAL CG1 HG11 sing N N 354 VAL CG1 HG12 sing N N 355 VAL CG1 HG13 sing N N 356 VAL CG2 HG21 sing N N 357 VAL CG2 HG22 sing N N 358 VAL CG2 HG23 sing N N 359 VAL OXT HXT sing N N 360 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Varian INOVA 1 'Varian INOVA' 600 Bruker AVANCE 2 'Bruker Avance' # _atom_sites.entry_id 2K5Q _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_