data_2K6P # _entry.id 2K6P # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2K6P pdb_00002k6p 10.2210/pdb2k6p/pdb RCSB RCSB100744 ? ? WWPDB D_1000100744 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-06-16 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 4 'Structure model' 1 3 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Database references' 3 3 'Structure model' 'Derived calculations' 4 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_struct_assembly 3 3 'Structure model' pdbx_struct_oper_list 4 3 'Structure model' struct_ref_seq_dif 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2K6P _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2008-07-15 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kim, J.' 1 'Park, S.' 2 'Lee, K.' 3 'Son, W.' 4 'Sohn, N.' 5 'Lee, B.' 6 # _citation.id primary _citation.title 'Solution structure of hypothetical protein HP1423 (Y1423_HELPY) reveals the presence of alphaL motif related to RNA binding' _citation.journal_abbrev Proteins _citation.journal_volume 75 _citation.page_first 252 _citation.page_last 257 _citation.year 2009 _citation.journal_id_ASTM PSFGEY _citation.country US _citation.journal_id_ISSN 0887-3585 _citation.journal_id_CSD 0867 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19137609 _citation.pdbx_database_id_DOI 10.1002/prot.22335 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kim, J.H.' 1 ? primary 'Park, S.J.' 2 ? primary 'Lee, K.Y.' 3 ? primary 'Son, W.S.' 4 ? primary 'Sohn, N.Y.' 5 ? primary 'Kwon, A.R.' 6 ? primary 'Lee, B.J.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Uncharacterized protein HP_1423' _entity.formula_weight 10472.249 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MRIDKFLQSVGLVKRRVLATDMCNVGAVWLNGSCAKASKEVKAGDTISLHYLKGIEEYTILQIPALKNVPRKDTHLYIAP KTKELEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MRIDKFLQSVGLVKRRVLATDMCNVGAVWLNGSCAKASKEVKAGDTISLHYLKGIEEYTILQIPALKNVPRKDTHLYIAP KTKELEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ARG n 1 3 ILE n 1 4 ASP n 1 5 LYS n 1 6 PHE n 1 7 LEU n 1 8 GLN n 1 9 SER n 1 10 VAL n 1 11 GLY n 1 12 LEU n 1 13 VAL n 1 14 LYS n 1 15 ARG n 1 16 ARG n 1 17 VAL n 1 18 LEU n 1 19 ALA n 1 20 THR n 1 21 ASP n 1 22 MET n 1 23 CYS n 1 24 ASN n 1 25 VAL n 1 26 GLY n 1 27 ALA n 1 28 VAL n 1 29 TRP n 1 30 LEU n 1 31 ASN n 1 32 GLY n 1 33 SER n 1 34 CYS n 1 35 ALA n 1 36 LYS n 1 37 ALA n 1 38 SER n 1 39 LYS n 1 40 GLU n 1 41 VAL n 1 42 LYS n 1 43 ALA n 1 44 GLY n 1 45 ASP n 1 46 THR n 1 47 ILE n 1 48 SER n 1 49 LEU n 1 50 HIS n 1 51 TYR n 1 52 LEU n 1 53 LYS n 1 54 GLY n 1 55 ILE n 1 56 GLU n 1 57 GLU n 1 58 TYR n 1 59 THR n 1 60 ILE n 1 61 LEU n 1 62 GLN n 1 63 ILE n 1 64 PRO n 1 65 ALA n 1 66 LEU n 1 67 LYS n 1 68 ASN n 1 69 VAL n 1 70 PRO n 1 71 ARG n 1 72 LYS n 1 73 ASP n 1 74 THR n 1 75 HIS n 1 76 LEU n 1 77 TYR n 1 78 ILE n 1 79 ALA n 1 80 PRO n 1 81 LYS n 1 82 THR n 1 83 LYS n 1 84 GLU n 1 85 LEU n 1 86 GLU n 1 87 HIS n 1 88 HIS n 1 89 HIS n 1 90 HIS n 1 91 HIS n 1 92 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Campylobacter pylori' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene HP_1423 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Helicobacter pylori' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 210 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET21a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ARG 2 2 2 ARG ARG A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 ASP 4 4 4 ASP ASP A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 MET 22 22 22 MET MET A . n A 1 23 CYS 23 23 23 CYS CYS A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 TRP 29 29 29 TRP TRP A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 HIS 50 50 50 HIS HIS A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 TYR 58 58 58 TYR TYR A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 PRO 64 64 64 PRO PRO A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 HIS 75 75 75 HIS HIS A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 TYR 77 77 77 TYR TYR A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 PRO 80 80 80 PRO PRO A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 LEU 85 85 ? ? ? A . n A 1 86 GLU 86 86 ? ? ? A . n A 1 87 HIS 87 87 ? ? ? A . n A 1 88 HIS 88 88 ? ? ? A . n A 1 89 HIS 89 89 ? ? ? A . n A 1 90 HIS 90 90 ? ? ? A . n A 1 91 HIS 91 91 ? ? ? A . n A 1 92 HIS 92 92 ? ? ? A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2K6P _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2K6P _struct.title 'Solution Structure of hypothetical protein, HP1423' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2K6P _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' _struct_keywords.text 'hp1423, alpha-L motif, RNA-binding, UNKNOWN FUNCTION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Y1423_HELPY _struct_ref.pdbx_db_accession O25966 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MRIDKFLQSVGLVKRRVLATDMCNVGAVWLNGSCAKASKEVKAGDTISLHYLKGIEEYTILQIPALKNVPRKDTHLYIAP KTKE ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2K6P _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 84 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O25966 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 84 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 84 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2K6P LEU A 85 ? UNP O25966 ? ? 'expression tag' 85 1 1 2K6P GLU A 86 ? UNP O25966 ? ? 'expression tag' 86 2 1 2K6P HIS A 87 ? UNP O25966 ? ? 'expression tag' 87 3 1 2K6P HIS A 88 ? UNP O25966 ? ? 'expression tag' 88 4 1 2K6P HIS A 89 ? UNP O25966 ? ? 'expression tag' 89 5 1 2K6P HIS A 90 ? UNP O25966 ? ? 'expression tag' 90 6 1 2K6P HIS A 91 ? UNP O25966 ? ? 'expression tag' 91 7 1 2K6P HIS A 92 ? UNP O25966 ? ? 'expression tag' 92 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ARG _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 2 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LEU _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 7 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ARG _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 2 _struct_conf.end_auth_comp_id LEU _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 7 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TRP A 29 ? LEU A 30 ? TRP A 29 LEU A 30 A 2 SER A 33 ? CYS A 34 ? SER A 33 CYS A 34 B 1 THR A 46 ? LEU A 49 ? THR A 46 LEU A 49 B 2 GLU A 56 ? ILE A 60 ? GLU A 56 ILE A 60 B 3 ILE A 78 ? PRO A 80 ? ILE A 78 PRO A 80 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 30 ? N LEU A 30 O SER A 33 ? O SER A 33 B 1 2 N ILE A 47 ? N ILE A 47 O TYR A 58 ? O TYR A 58 B 2 3 N THR A 59 ? N THR A 59 O ALA A 79 ? O ALA A 79 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 7 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ILE _pdbx_validate_close_contact.auth_seq_id_1 47 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 H _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 TYR _pdbx_validate_close_contact.auth_seq_id_2 58 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 36 ? ? -79.57 -165.45 2 1 SER A 38 ? ? -143.37 26.38 3 1 PRO A 70 ? ? -67.17 -167.96 4 1 ARG A 71 ? ? -90.23 51.85 5 1 LYS A 72 ? ? -133.19 -57.21 6 2 ARG A 15 ? ? 60.13 76.51 7 2 ARG A 16 ? ? -159.64 -52.39 8 2 VAL A 17 ? ? 65.14 96.12 9 2 LEU A 18 ? ? 60.10 -176.02 10 2 ALA A 19 ? ? 71.95 118.74 11 2 SER A 38 ? ? -152.50 27.36 12 2 GLU A 57 ? ? 62.04 91.79 13 2 ASN A 68 ? ? 178.18 146.65 14 2 ARG A 71 ? ? -94.97 43.86 15 2 LYS A 72 ? ? -132.91 -45.55 16 2 PRO A 80 ? ? -56.60 106.43 17 2 LYS A 83 ? ? 43.23 88.83 18 3 LEU A 18 ? ? -102.14 -169.68 19 3 THR A 20 ? ? -59.20 104.89 20 3 LYS A 36 ? ? -101.85 -166.54 21 3 SER A 38 ? ? -147.09 27.54 22 3 GLU A 57 ? ? 63.84 97.59 23 3 PRO A 70 ? ? -61.45 -156.63 24 3 ARG A 71 ? ? -110.78 54.48 25 3 LYS A 72 ? ? -148.27 -49.05 26 3 LYS A 81 ? ? -59.48 102.93 27 3 LYS A 83 ? ? 43.38 72.53 28 4 ARG A 15 ? ? 61.36 160.12 29 4 ARG A 16 ? ? -108.57 60.14 30 4 ALA A 27 ? ? -97.86 31.05 31 4 ASN A 31 ? ? 69.32 -67.46 32 4 SER A 33 ? ? -159.41 29.09 33 4 CYS A 34 ? ? 60.57 158.10 34 4 SER A 38 ? ? -148.80 28.21 35 4 GLU A 57 ? ? 63.54 102.48 36 4 PRO A 70 ? ? -52.61 -175.17 37 4 ARG A 71 ? ? -97.21 30.93 38 5 ARG A 15 ? ? 61.34 156.42 39 5 ARG A 16 ? ? -173.41 -175.61 40 5 VAL A 17 ? ? 68.09 161.92 41 5 LEU A 18 ? ? 66.47 -76.10 42 5 SER A 38 ? ? -142.03 27.46 43 5 PRO A 70 ? ? -59.10 -175.20 44 5 ARG A 71 ? ? -98.74 33.12 45 5 LYS A 72 ? ? -138.22 -46.38 46 5 THR A 74 ? ? -97.83 30.44 47 5 HIS A 75 ? ? -141.73 21.60 48 5 LYS A 83 ? ? -157.03 34.05 49 6 ARG A 16 ? ? -107.03 -77.01 50 6 VAL A 17 ? ? -111.61 61.63 51 6 LYS A 36 ? ? -105.97 -167.37 52 6 SER A 38 ? ? -159.52 29.06 53 6 ASN A 68 ? ? -161.10 74.45 54 6 PRO A 70 ? ? -56.88 -162.85 55 6 LYS A 72 ? ? -165.85 -67.04 56 7 LEU A 12 ? ? -105.71 -60.59 57 7 ARG A 15 ? ? -152.69 -61.70 58 7 ASP A 21 ? ? 75.13 -53.23 59 7 ALA A 27 ? ? -99.41 32.17 60 7 LYS A 36 ? ? -75.21 -165.74 61 7 SER A 38 ? ? -146.63 26.39 62 7 LYS A 72 ? ? -176.80 -43.41 63 8 VAL A 17 ? ? 60.17 158.83 64 8 SER A 33 ? ? -140.21 26.21 65 8 CYS A 34 ? ? 61.97 151.21 66 8 SER A 38 ? ? -146.65 29.54 67 8 LYS A 67 ? ? -98.66 -66.83 68 8 PRO A 70 ? ? -54.01 -178.68 69 8 ARG A 71 ? ? -101.48 43.50 70 8 LYS A 72 ? ? -133.83 -50.38 71 8 LYS A 81 ? ? -90.76 53.50 72 9 ARG A 15 ? ? -144.78 -64.83 73 9 ARG A 16 ? ? -156.82 -46.12 74 9 ALA A 19 ? ? -56.35 -169.80 75 9 GLN A 62 ? ? 179.50 167.14 76 9 LYS A 67 ? ? -110.33 -71.43 77 9 LYS A 72 ? ? -148.38 -57.23 78 10 PHE A 6 ? ? -80.29 -70.74 79 10 VAL A 13 ? ? -102.30 66.77 80 10 ARG A 16 ? ? -97.53 37.23 81 10 LYS A 36 ? ? -126.19 -168.21 82 10 SER A 38 ? ? -163.75 30.67 83 10 ARG A 71 ? ? -90.86 51.41 84 10 LYS A 72 ? ? -141.29 -47.07 85 11 ARG A 15 ? ? 63.06 142.22 86 11 ARG A 16 ? ? 59.35 76.65 87 11 ALA A 19 ? ? 63.00 -80.89 88 11 LYS A 36 ? ? -125.80 -165.95 89 11 SER A 38 ? ? -163.94 31.44 90 11 GLU A 57 ? ? 61.95 98.70 91 11 PRO A 70 ? ? -50.12 179.00 92 11 LYS A 72 ? ? -173.70 -60.82 93 12 LEU A 12 ? ? -47.04 -70.02 94 12 VAL A 13 ? ? -118.99 72.78 95 12 LYS A 36 ? ? -67.23 -164.48 96 12 SER A 38 ? ? -146.51 29.77 97 12 GLU A 57 ? ? 60.96 88.78 98 12 PRO A 70 ? ? -65.87 -167.29 99 12 ARG A 71 ? ? -96.82 38.36 100 12 LYS A 72 ? ? -132.39 -46.13 101 13 ARG A 15 ? ? -56.58 98.91 102 13 VAL A 17 ? ? 59.81 159.17 103 13 ALA A 19 ? ? 62.35 -81.99 104 13 THR A 20 ? ? -163.87 -80.54 105 13 ASP A 21 ? ? 78.93 -7.76 106 13 SER A 38 ? ? -147.39 29.23 107 13 PRO A 70 ? ? -65.70 -166.76 108 13 ARG A 71 ? ? -97.21 35.29 109 13 LYS A 83 ? ? -140.33 32.33 110 14 ARG A 16 ? ? 69.88 86.50 111 14 VAL A 17 ? ? -166.52 44.55 112 14 LEU A 18 ? ? 62.83 99.01 113 14 ALA A 19 ? ? 61.32 163.05 114 14 ASP A 21 ? ? -132.09 -42.72 115 14 VAL A 28 ? ? -58.83 108.74 116 14 LYS A 36 ? ? -111.84 -168.86 117 14 SER A 38 ? ? -157.35 26.88 118 14 GLU A 57 ? ? 62.38 105.43 119 14 ARG A 71 ? ? -91.54 51.27 120 14 LYS A 72 ? ? -130.96 -62.77 121 15 LYS A 14 ? ? -98.53 34.99 122 15 ARG A 16 ? ? 62.80 123.77 123 15 ALA A 19 ? ? 60.00 158.93 124 15 LYS A 36 ? ? -77.61 -168.11 125 15 SER A 38 ? ? -148.23 28.22 126 15 GLU A 57 ? ? 61.86 98.02 127 15 LEU A 66 ? ? -113.28 -168.30 128 15 PRO A 70 ? ? -70.24 -168.94 129 15 HIS A 75 ? ? -141.95 19.26 130 15 LYS A 81 ? ? -110.96 52.35 131 15 LYS A 83 ? ? 46.41 -169.98 132 16 PHE A 6 ? ? -84.01 -70.16 133 16 VAL A 17 ? ? 66.00 94.18 134 16 LEU A 18 ? ? 58.20 179.75 135 16 THR A 20 ? ? 60.15 80.42 136 16 SER A 38 ? ? -154.03 27.61 137 16 ASN A 68 ? ? -176.61 111.63 138 16 LYS A 83 ? ? -145.48 31.63 139 17 VAL A 17 ? ? -90.13 -67.16 140 17 LEU A 18 ? ? -129.56 -68.85 141 17 ALA A 19 ? ? -109.42 -78.12 142 17 ASP A 21 ? ? -151.63 -43.01 143 17 SER A 33 ? ? -165.24 116.67 144 17 CYS A 34 ? ? -55.00 109.53 145 17 LYS A 36 ? ? -70.50 -162.59 146 17 SER A 38 ? ? -141.18 25.10 147 17 GLU A 57 ? ? 63.50 95.74 148 17 PRO A 70 ? ? -66.60 -173.82 149 17 ASP A 73 ? ? -134.70 -83.41 150 17 HIS A 75 ? ? -135.85 -30.36 151 18 ARG A 16 ? ? 61.81 85.73 152 18 LEU A 18 ? ? -110.78 75.05 153 18 THR A 20 ? ? 52.71 98.96 154 18 LYS A 36 ? ? -60.73 -168.33 155 18 SER A 38 ? ? -148.86 28.97 156 18 GLU A 57 ? ? 63.49 94.11 157 18 PRO A 70 ? ? -49.62 175.04 158 18 LYS A 72 ? ? -166.23 -58.55 159 18 THR A 82 ? ? 62.07 155.94 160 19 ARG A 2 ? ? -127.90 -155.99 161 19 LEU A 12 ? ? -123.06 -52.46 162 19 LYS A 14 ? ? -97.32 33.52 163 19 ARG A 15 ? ? 60.03 111.18 164 19 SER A 38 ? ? -151.11 28.03 165 19 GLU A 57 ? ? 61.17 97.35 166 19 LYS A 72 ? ? -169.76 -55.84 167 20 ARG A 16 ? ? -157.38 71.79 168 20 LEU A 18 ? ? 63.77 -78.96 169 20 LYS A 36 ? ? -64.73 -166.04 170 20 SER A 38 ? ? -147.31 27.81 171 20 GLU A 57 ? ? 61.28 91.31 172 20 GLN A 62 ? ? 179.73 169.74 173 20 ASN A 68 ? ? -164.45 97.75 174 20 PRO A 70 ? ? -76.49 -167.89 175 20 LYS A 72 ? ? -175.48 -42.30 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2K6P _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2K6P _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.contents '1-0.1mM [U-98% 15N] 15N, 1-0.5mM [U-98% 13C; U-98% 15N] 13C, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 15N 1 mM '[U-98% 15N]' 1 13C 1 mM '[U-98% 13C; U-98% 15N]' 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.3 _pdbx_nmr_exptl_sample_conditions.pH 5.8 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D HNCO' 1 3 1 '3D HNCA' 1 4 1 '3D HN(CO)CA' 1 5 1 '3D HNCACB' 1 6 1 '3D HN(CO)CA' 1 7 1 '3D HBHA(CO)NH' 1 8 1 '3D HCCH-TOCSY' 1 9 1 '3D 1H-15N NOESY' 1 10 1 '3D 1H-13C NOESY' 1 11 1 '3D 1H-15N TOCSY' 1 12 1 '3D H(CCO)NH' # _pdbx_nmr_refine.entry_id 2K6P _pdbx_nmr_refine.method 'distance geometry' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_software.authors 'Brunger A. T. et.al.' _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name CNS _pdbx_nmr_software.version ? _pdbx_nmr_software.ordinal 1 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LEU 85 ? A LEU 85 2 1 Y 1 A GLU 86 ? A GLU 86 3 1 Y 1 A HIS 87 ? A HIS 87 4 1 Y 1 A HIS 88 ? A HIS 88 5 1 Y 1 A HIS 89 ? A HIS 89 6 1 Y 1 A HIS 90 ? A HIS 90 7 1 Y 1 A HIS 91 ? A HIS 91 8 1 Y 1 A HIS 92 ? A HIS 92 9 2 Y 1 A LEU 85 ? A LEU 85 10 2 Y 1 A GLU 86 ? A GLU 86 11 2 Y 1 A HIS 87 ? A HIS 87 12 2 Y 1 A HIS 88 ? A HIS 88 13 2 Y 1 A HIS 89 ? A HIS 89 14 2 Y 1 A HIS 90 ? A HIS 90 15 2 Y 1 A HIS 91 ? A HIS 91 16 2 Y 1 A HIS 92 ? A HIS 92 17 3 Y 1 A LEU 85 ? A LEU 85 18 3 Y 1 A GLU 86 ? A GLU 86 19 3 Y 1 A HIS 87 ? A HIS 87 20 3 Y 1 A HIS 88 ? A HIS 88 21 3 Y 1 A HIS 89 ? A HIS 89 22 3 Y 1 A HIS 90 ? A HIS 90 23 3 Y 1 A HIS 91 ? A HIS 91 24 3 Y 1 A HIS 92 ? A HIS 92 25 4 Y 1 A LEU 85 ? A LEU 85 26 4 Y 1 A GLU 86 ? A GLU 86 27 4 Y 1 A HIS 87 ? A HIS 87 28 4 Y 1 A HIS 88 ? A HIS 88 29 4 Y 1 A HIS 89 ? A HIS 89 30 4 Y 1 A HIS 90 ? A HIS 90 31 4 Y 1 A HIS 91 ? A HIS 91 32 4 Y 1 A HIS 92 ? A HIS 92 33 5 Y 1 A LEU 85 ? A LEU 85 34 5 Y 1 A GLU 86 ? A GLU 86 35 5 Y 1 A HIS 87 ? A HIS 87 36 5 Y 1 A HIS 88 ? A HIS 88 37 5 Y 1 A HIS 89 ? A HIS 89 38 5 Y 1 A HIS 90 ? A HIS 90 39 5 Y 1 A HIS 91 ? A HIS 91 40 5 Y 1 A HIS 92 ? A HIS 92 41 6 Y 1 A LEU 85 ? A LEU 85 42 6 Y 1 A GLU 86 ? A GLU 86 43 6 Y 1 A HIS 87 ? A HIS 87 44 6 Y 1 A HIS 88 ? A HIS 88 45 6 Y 1 A HIS 89 ? A HIS 89 46 6 Y 1 A HIS 90 ? A HIS 90 47 6 Y 1 A HIS 91 ? A HIS 91 48 6 Y 1 A HIS 92 ? A HIS 92 49 7 Y 1 A LEU 85 ? A LEU 85 50 7 Y 1 A GLU 86 ? A GLU 86 51 7 Y 1 A HIS 87 ? A HIS 87 52 7 Y 1 A HIS 88 ? A HIS 88 53 7 Y 1 A HIS 89 ? A HIS 89 54 7 Y 1 A HIS 90 ? A HIS 90 55 7 Y 1 A HIS 91 ? A HIS 91 56 7 Y 1 A HIS 92 ? A HIS 92 57 8 Y 1 A LEU 85 ? A LEU 85 58 8 Y 1 A GLU 86 ? A GLU 86 59 8 Y 1 A HIS 87 ? A HIS 87 60 8 Y 1 A HIS 88 ? A HIS 88 61 8 Y 1 A HIS 89 ? A HIS 89 62 8 Y 1 A HIS 90 ? A HIS 90 63 8 Y 1 A HIS 91 ? A HIS 91 64 8 Y 1 A HIS 92 ? A HIS 92 65 9 Y 1 A LEU 85 ? A LEU 85 66 9 Y 1 A GLU 86 ? A GLU 86 67 9 Y 1 A HIS 87 ? A HIS 87 68 9 Y 1 A HIS 88 ? A HIS 88 69 9 Y 1 A HIS 89 ? A HIS 89 70 9 Y 1 A HIS 90 ? A HIS 90 71 9 Y 1 A HIS 91 ? A HIS 91 72 9 Y 1 A HIS 92 ? A HIS 92 73 10 Y 1 A LEU 85 ? A LEU 85 74 10 Y 1 A GLU 86 ? A GLU 86 75 10 Y 1 A HIS 87 ? A HIS 87 76 10 Y 1 A HIS 88 ? A HIS 88 77 10 Y 1 A HIS 89 ? A HIS 89 78 10 Y 1 A HIS 90 ? A HIS 90 79 10 Y 1 A HIS 91 ? A HIS 91 80 10 Y 1 A HIS 92 ? A HIS 92 81 11 Y 1 A LEU 85 ? A LEU 85 82 11 Y 1 A GLU 86 ? A GLU 86 83 11 Y 1 A HIS 87 ? A HIS 87 84 11 Y 1 A HIS 88 ? A HIS 88 85 11 Y 1 A HIS 89 ? A HIS 89 86 11 Y 1 A HIS 90 ? A HIS 90 87 11 Y 1 A HIS 91 ? A HIS 91 88 11 Y 1 A HIS 92 ? A HIS 92 89 12 Y 1 A LEU 85 ? A LEU 85 90 12 Y 1 A GLU 86 ? A GLU 86 91 12 Y 1 A HIS 87 ? A HIS 87 92 12 Y 1 A HIS 88 ? A HIS 88 93 12 Y 1 A HIS 89 ? A HIS 89 94 12 Y 1 A HIS 90 ? A HIS 90 95 12 Y 1 A HIS 91 ? A HIS 91 96 12 Y 1 A HIS 92 ? A HIS 92 97 13 Y 1 A LEU 85 ? A LEU 85 98 13 Y 1 A GLU 86 ? A GLU 86 99 13 Y 1 A HIS 87 ? A HIS 87 100 13 Y 1 A HIS 88 ? A HIS 88 101 13 Y 1 A HIS 89 ? A HIS 89 102 13 Y 1 A HIS 90 ? A HIS 90 103 13 Y 1 A HIS 91 ? A HIS 91 104 13 Y 1 A HIS 92 ? A HIS 92 105 14 Y 1 A LEU 85 ? A LEU 85 106 14 Y 1 A GLU 86 ? A GLU 86 107 14 Y 1 A HIS 87 ? A HIS 87 108 14 Y 1 A HIS 88 ? A HIS 88 109 14 Y 1 A HIS 89 ? A HIS 89 110 14 Y 1 A HIS 90 ? A HIS 90 111 14 Y 1 A HIS 91 ? A HIS 91 112 14 Y 1 A HIS 92 ? A HIS 92 113 15 Y 1 A LEU 85 ? A LEU 85 114 15 Y 1 A GLU 86 ? A GLU 86 115 15 Y 1 A HIS 87 ? A HIS 87 116 15 Y 1 A HIS 88 ? A HIS 88 117 15 Y 1 A HIS 89 ? A HIS 89 118 15 Y 1 A HIS 90 ? A HIS 90 119 15 Y 1 A HIS 91 ? A HIS 91 120 15 Y 1 A HIS 92 ? A HIS 92 121 16 Y 1 A LEU 85 ? A LEU 85 122 16 Y 1 A GLU 86 ? A GLU 86 123 16 Y 1 A HIS 87 ? A HIS 87 124 16 Y 1 A HIS 88 ? A HIS 88 125 16 Y 1 A HIS 89 ? A HIS 89 126 16 Y 1 A HIS 90 ? A HIS 90 127 16 Y 1 A HIS 91 ? A HIS 91 128 16 Y 1 A HIS 92 ? A HIS 92 129 17 Y 1 A LEU 85 ? A LEU 85 130 17 Y 1 A GLU 86 ? A GLU 86 131 17 Y 1 A HIS 87 ? A HIS 87 132 17 Y 1 A HIS 88 ? A HIS 88 133 17 Y 1 A HIS 89 ? A HIS 89 134 17 Y 1 A HIS 90 ? A HIS 90 135 17 Y 1 A HIS 91 ? A HIS 91 136 17 Y 1 A HIS 92 ? A HIS 92 137 18 Y 1 A LEU 85 ? A LEU 85 138 18 Y 1 A GLU 86 ? A GLU 86 139 18 Y 1 A HIS 87 ? A HIS 87 140 18 Y 1 A HIS 88 ? A HIS 88 141 18 Y 1 A HIS 89 ? A HIS 89 142 18 Y 1 A HIS 90 ? A HIS 90 143 18 Y 1 A HIS 91 ? A HIS 91 144 18 Y 1 A HIS 92 ? A HIS 92 145 19 Y 1 A LEU 85 ? A LEU 85 146 19 Y 1 A GLU 86 ? A GLU 86 147 19 Y 1 A HIS 87 ? A HIS 87 148 19 Y 1 A HIS 88 ? A HIS 88 149 19 Y 1 A HIS 89 ? A HIS 89 150 19 Y 1 A HIS 90 ? A HIS 90 151 19 Y 1 A HIS 91 ? A HIS 91 152 19 Y 1 A HIS 92 ? A HIS 92 153 20 Y 1 A LEU 85 ? A LEU 85 154 20 Y 1 A GLU 86 ? A GLU 86 155 20 Y 1 A HIS 87 ? A HIS 87 156 20 Y 1 A HIS 88 ? A HIS 88 157 20 Y 1 A HIS 89 ? A HIS 89 158 20 Y 1 A HIS 90 ? A HIS 90 159 20 Y 1 A HIS 91 ? A HIS 91 160 20 Y 1 A HIS 92 ? A HIS 92 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker DRX' # _atom_sites.entry_id 2K6P _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_