data_2K78 # _entry.id 2K78 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2K78 pdb_00002k78 10.2210/pdb2k78/pdb RCSB RCSB100763 ? ? WWPDB D_1000100763 ? ? # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2K78 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2008-08-06 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Villareal, V.A.' 1 'Pilpa, R.M.' 2 'Robson, S.A.' 3 'Fadeev, E.A.' 4 'Clubb, R.T.' 5 # _citation.id primary _citation.title 'The IsdC Protein from Staphylococcus aureus Uses a Flexible Binding Pocket to Capture Heme.' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 283 _citation.page_first 31591 _citation.page_last 31600 _citation.year 2008 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18715872 _citation.pdbx_database_id_DOI 10.1074/jbc.M801126200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Villareal, V.A.' 1 ? primary 'Pilpa, R.M.' 2 ? primary 'Robson, S.A.' 3 ? primary 'Fadeev, E.A.' 4 ? primary 'Clubb, R.T.' 5 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Iron-regulated surface determinant protein C' 16625.418 1 ? ? 'NEAT domain, UNP residues 25-150' ? 2 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING ZN' 626.051 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Staphylococcal iron-regulated protein D' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSHMSANAADSGTLNYEVYKYNTNDTSIANDYFNKPAKYIKKNGKLYVQITVNHSHWITGMSI EGHKENIISKNTAKDERTSEFEVSKLNGKIDGKIDVYIDEKVNGKPFKYDHHYNITYKFNGPTDVAG ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSHMSANAADSGTLNYEVYKYNTNDTSIANDYFNKPAKYIKKNGKLYVQITVNHSHWITGMSI EGHKENIISKNTAKDERTSEFEVSKLNGKIDGKIDVYIDEKVNGKPFKYDHHYNITYKFNGPTDVAG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 SER n 1 23 ALA n 1 24 ASN n 1 25 ALA n 1 26 ALA n 1 27 ASP n 1 28 SER n 1 29 GLY n 1 30 THR n 1 31 LEU n 1 32 ASN n 1 33 TYR n 1 34 GLU n 1 35 VAL n 1 36 TYR n 1 37 LYS n 1 38 TYR n 1 39 ASN n 1 40 THR n 1 41 ASN n 1 42 ASP n 1 43 THR n 1 44 SER n 1 45 ILE n 1 46 ALA n 1 47 ASN n 1 48 ASP n 1 49 TYR n 1 50 PHE n 1 51 ASN n 1 52 LYS n 1 53 PRO n 1 54 ALA n 1 55 LYS n 1 56 TYR n 1 57 ILE n 1 58 LYS n 1 59 LYS n 1 60 ASN n 1 61 GLY n 1 62 LYS n 1 63 LEU n 1 64 TYR n 1 65 VAL n 1 66 GLN n 1 67 ILE n 1 68 THR n 1 69 VAL n 1 70 ASN n 1 71 HIS n 1 72 SER n 1 73 HIS n 1 74 TRP n 1 75 ILE n 1 76 THR n 1 77 GLY n 1 78 MET n 1 79 SER n 1 80 ILE n 1 81 GLU n 1 82 GLY n 1 83 HIS n 1 84 LYS n 1 85 GLU n 1 86 ASN n 1 87 ILE n 1 88 ILE n 1 89 SER n 1 90 LYS n 1 91 ASN n 1 92 THR n 1 93 ALA n 1 94 LYS n 1 95 ASP n 1 96 GLU n 1 97 ARG n 1 98 THR n 1 99 SER n 1 100 GLU n 1 101 PHE n 1 102 GLU n 1 103 VAL n 1 104 SER n 1 105 LYS n 1 106 LEU n 1 107 ASN n 1 108 GLY n 1 109 LYS n 1 110 ILE n 1 111 ASP n 1 112 GLY n 1 113 LYS n 1 114 ILE n 1 115 ASP n 1 116 VAL n 1 117 TYR n 1 118 ILE n 1 119 ASP n 1 120 GLU n 1 121 LYS n 1 122 VAL n 1 123 ASN n 1 124 GLY n 1 125 LYS n 1 126 PRO n 1 127 PHE n 1 128 LYS n 1 129 TYR n 1 130 ASP n 1 131 HIS n 1 132 HIS n 1 133 TYR n 1 134 ASN n 1 135 ILE n 1 136 THR n 1 137 TYR n 1 138 LYS n 1 139 PHE n 1 140 ASN n 1 141 GLY n 1 142 PRO n 1 143 THR n 1 144 ASP n 1 145 VAL n 1 146 ALA n 1 147 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'isdC, sirD, MW1013' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Staphylococcus aureus (strain MW2)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 196620 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET15b _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ISDC_STAAW _struct_ref.pdbx_db_accession Q7A151 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SANAADSGTLNYEVYKYNTNDTSIANDYFNKPAKYIKKNGKLYVQITVNHSHWITGMSIEGHKENIISKNTAKDERTSEF EVSKLNGKIDGKIDVYIDEKVNGKPFKYDHHYNITYKFNGPTDVAG ; _struct_ref.pdbx_align_begin 25 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2K78 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 22 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 147 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q7A151 _struct_ref_seq.db_align_beg 25 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 150 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 25 _struct_ref_seq.pdbx_auth_seq_align_end 150 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2K78 MET A 1 ? UNP Q7A151 ? ? 'expression tag' 4 1 1 2K78 GLY A 2 ? UNP Q7A151 ? ? 'expression tag' 5 2 1 2K78 SER A 3 ? UNP Q7A151 ? ? 'expression tag' 6 3 1 2K78 SER A 4 ? UNP Q7A151 ? ? 'expression tag' 7 4 1 2K78 HIS A 5 ? UNP Q7A151 ? ? 'expression tag' 8 5 1 2K78 HIS A 6 ? UNP Q7A151 ? ? 'expression tag' 9 6 1 2K78 HIS A 7 ? UNP Q7A151 ? ? 'expression tag' 10 7 1 2K78 HIS A 8 ? UNP Q7A151 ? ? 'expression tag' 11 8 1 2K78 HIS A 9 ? UNP Q7A151 ? ? 'expression tag' 12 9 1 2K78 HIS A 10 ? UNP Q7A151 ? ? 'expression tag' 13 10 1 2K78 SER A 11 ? UNP Q7A151 ? ? 'expression tag' 14 11 1 2K78 SER A 12 ? UNP Q7A151 ? ? 'expression tag' 15 12 1 2K78 GLY A 13 ? UNP Q7A151 ? ? 'expression tag' 16 13 1 2K78 LEU A 14 ? UNP Q7A151 ? ? 'expression tag' 17 14 1 2K78 VAL A 15 ? UNP Q7A151 ? ? 'expression tag' 18 15 1 2K78 PRO A 16 ? UNP Q7A151 ? ? 'expression tag' 19 16 1 2K78 ARG A 17 ? UNP Q7A151 ? ? 'expression tag' 20 17 1 2K78 GLY A 18 ? UNP Q7A151 ? ? 'expression tag' 21 18 1 2K78 SER A 19 ? UNP Q7A151 ? ? 'expression tag' 22 19 1 2K78 HIS A 20 ? UNP Q7A151 ? ? 'expression tag' 23 20 1 2K78 MET A 21 ? UNP Q7A151 ? ? 'expression tag' 24 21 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZNH non-polymer . 'PROTOPORPHYRIN IX CONTAINING ZN' ? 'C34 H32 N4 O4 Zn' 626.051 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 2 '2D 1H-13C HSQC' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D HNCACB' 1 5 1 '3D HNCA' 1 6 1 '3D HNHA' 1 7 2 '3D HCCH-COSY' 1 8 2 '3D HCCH-TOCSY' 1 9 1 '3D 1H-15N NOESY' 1 10 1 '3D HNCO' 1 11 1 '3D HNHB' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.15 _pdbx_nmr_exptl_sample_conditions.pH 6 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 302 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;50 mM sodium phosphate, 100 mM sodium chloride, 0.01 % sodium azide, 1.3 mM [U-100% 13C; U-100% 15N] IsdC, 2.1 mM PROTOPORPHYRIN IX CONTAINING ZN, 7 % [U-100% 2H] D2O, 93% H2O/7% D2O ; 1 '93% H2O/7% D2O' ;50 mM sodium phosphate, 100 mM sodium chloride, 0.01 % sodium azide, 1.1 mM IsdC, 2.3 mM PROTOPORPHYRIN IX CONTAINING ZN, 100 % D2O, 100% D2O ; 2 '100% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Bruker AVANCE 1 'Bruker Avance' 600 Bruker AVANCE 2 'Bruker Avance' 800 Bruker AVANCE 3 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2K78 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 30 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2K78 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2K78 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' ? 1 Garrett 'peak picking' PIPP ? 2 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 3 'Herrmann, Guntert, Wuthrich' 'chemical shift assignment' ATNOS/CANDID ? 4 Keller 'chemical shift assignment' CARA ? 5 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2K78 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2K78 _struct.title 'Solution Structure of the IsdC NEAT domain bound to Zinc Protoporphyrin' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2K78 _struct_keywords.pdbx_keywords 'HEME-BINDING PROTEIN' _struct_keywords.text ;NEAT domain, NMR complex, heme, Isd, IsdC, Cell wall, Iron, Metal-binding, Peptidoglycan-anchor, Secreted, TRANSPORT PROTEIN, HEME-BINDING PROTEIN ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id ILE _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 45 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id TYR _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 49 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ILE _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 48 _struct_conf.end_auth_comp_id TYR _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 52 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 LYS 52 A . ? LYS 55 A PRO 53 A ? PRO 56 A 1 -0.37 2 LYS 52 A . ? LYS 55 A PRO 53 A ? PRO 56 A 2 -0.29 3 LYS 52 A . ? LYS 55 A PRO 53 A ? PRO 56 A 3 -0.33 4 LYS 52 A . ? LYS 55 A PRO 53 A ? PRO 56 A 4 -0.23 5 LYS 52 A . ? LYS 55 A PRO 53 A ? PRO 56 A 5 -0.37 6 LYS 52 A . ? LYS 55 A PRO 53 A ? PRO 56 A 6 0.01 7 LYS 52 A . ? LYS 55 A PRO 53 A ? PRO 56 A 7 -0.08 8 LYS 52 A . ? LYS 55 A PRO 53 A ? PRO 56 A 8 -0.26 9 LYS 52 A . ? LYS 55 A PRO 53 A ? PRO 56 A 9 -0.19 10 LYS 52 A . ? LYS 55 A PRO 53 A ? PRO 56 A 10 -0.16 11 LYS 52 A . ? LYS 55 A PRO 53 A ? PRO 56 A 11 -0.13 12 LYS 52 A . ? LYS 55 A PRO 53 A ? PRO 56 A 12 -0.45 13 LYS 52 A . ? LYS 55 A PRO 53 A ? PRO 56 A 13 -0.24 14 LYS 52 A . ? LYS 55 A PRO 53 A ? PRO 56 A 14 -0.27 15 LYS 52 A . ? LYS 55 A PRO 53 A ? PRO 56 A 15 -0.39 16 LYS 52 A . ? LYS 55 A PRO 53 A ? PRO 56 A 16 -0.29 17 LYS 52 A . ? LYS 55 A PRO 53 A ? PRO 56 A 17 -0.50 18 LYS 52 A . ? LYS 55 A PRO 53 A ? PRO 56 A 18 -0.19 19 LYS 52 A . ? LYS 55 A PRO 53 A ? PRO 56 A 19 -0.41 20 LYS 52 A . ? LYS 55 A PRO 53 A ? PRO 56 A 20 -0.21 21 LYS 52 A . ? LYS 55 A PRO 53 A ? PRO 56 A 21 -0.03 22 LYS 52 A . ? LYS 55 A PRO 53 A ? PRO 56 A 22 -0.67 23 LYS 52 A . ? LYS 55 A PRO 53 A ? PRO 56 A 23 -0.37 24 LYS 52 A . ? LYS 55 A PRO 53 A ? PRO 56 A 24 -0.41 25 LYS 52 A . ? LYS 55 A PRO 53 A ? PRO 56 A 25 -0.20 26 LYS 52 A . ? LYS 55 A PRO 53 A ? PRO 56 A 26 -0.26 27 LYS 52 A . ? LYS 55 A PRO 53 A ? PRO 56 A 27 -0.15 28 LYS 52 A . ? LYS 55 A PRO 53 A ? PRO 56 A 28 -0.45 29 LYS 52 A . ? LYS 55 A PRO 53 A ? PRO 56 A 29 -0.49 30 LYS 52 A . ? LYS 55 A PRO 53 A ? PRO 56 A 30 -0.13 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 9 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel A 7 8 ? anti-parallel A 8 9 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 HIS A 83 ? LYS A 84 ? HIS A 86 LYS A 87 A 2 ILE A 75 ? ILE A 80 ? ILE A 78 ILE A 83 A 3 ILE A 110 ? LYS A 121 ? ILE A 113 LYS A 124 A 4 PRO A 126 ? ASN A 140 ? PRO A 129 ASN A 143 A 5 SER A 28 ? LYS A 37 ? SER A 31 LYS A 40 A 6 ALA A 54 ? LYS A 58 ? ALA A 57 LYS A 61 A 7 LEU A 63 ? ASN A 70 ? LEU A 66 ASN A 73 A 8 GLU A 96 ? GLU A 102 ? GLU A 99 GLU A 105 A 9 ASN A 86 ? ILE A 87 ? ASN A 89 ILE A 90 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O HIS A 83 ? O HIS A 86 N ILE A 80 ? N ILE A 83 A 2 3 N SER A 79 ? N SER A 82 O LYS A 113 ? O LYS A 116 A 3 4 N ILE A 118 ? N ILE A 121 O TYR A 129 ? O TYR A 132 A 4 5 O LYS A 138 ? O LYS A 141 N GLU A 34 ? N GLU A 37 A 5 6 N GLY A 29 ? N GLY A 32 O TYR A 56 ? O TYR A 59 A 6 7 N LYS A 55 ? N LYS A 58 O GLN A 66 ? O GLN A 69 A 7 8 N VAL A 69 ? N VAL A 72 O ARG A 97 ? O ARG A 100 A 8 9 N GLU A 100 ? N GLU A 103 O ASN A 86 ? O ASN A 89 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZNH _struct_site.pdbx_auth_seq_id 151 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 12 _struct_site.details 'BINDING SITE FOR RESIDUE ZNH A 151' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 12 TYR A 36 ? TYR A 39 . ? 1_555 ? 2 AC1 12 LYS A 37 ? LYS A 40 . ? 1_555 ? 3 AC1 12 TYR A 38 ? TYR A 41 . ? 1_555 ? 4 AC1 12 ILE A 45 ? ILE A 48 . ? 1_555 ? 5 AC1 12 ALA A 46 ? ALA A 49 . ? 1_555 ? 6 AC1 12 TYR A 49 ? TYR A 52 . ? 1_555 ? 7 AC1 12 PHE A 50 ? PHE A 53 . ? 1_555 ? 8 AC1 12 HIS A 71 ? HIS A 74 . ? 1_555 ? 9 AC1 12 TRP A 74 ? TRP A 77 . ? 1_555 ? 10 AC1 12 ILE A 114 ? ILE A 117 . ? 1_555 ? 11 AC1 12 ILE A 118 ? ILE A 121 . ? 1_555 ? 12 AC1 12 TYR A 129 ? TYR A 132 . ? 1_555 ? # _atom_sites.entry_id 2K78 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 4 ? ? ? A . n A 1 2 GLY 2 5 ? ? ? A . n A 1 3 SER 3 6 ? ? ? A . n A 1 4 SER 4 7 ? ? ? A . n A 1 5 HIS 5 8 ? ? ? A . n A 1 6 HIS 6 9 ? ? ? A . n A 1 7 HIS 7 10 ? ? ? A . n A 1 8 HIS 8 11 ? ? ? A . n A 1 9 HIS 9 12 ? ? ? A . n A 1 10 HIS 10 13 ? ? ? A . n A 1 11 SER 11 14 ? ? ? A . n A 1 12 SER 12 15 ? ? ? A . n A 1 13 GLY 13 16 ? ? ? A . n A 1 14 LEU 14 17 ? ? ? A . n A 1 15 VAL 15 18 ? ? ? A . n A 1 16 PRO 16 19 ? ? ? A . n A 1 17 ARG 17 20 ? ? ? A . n A 1 18 GLY 18 21 ? ? ? A . n A 1 19 SER 19 22 ? ? ? A . n A 1 20 HIS 20 23 ? ? ? A . n A 1 21 MET 21 24 ? ? ? A . n A 1 22 SER 22 25 25 SER SER A . n A 1 23 ALA 23 26 26 ALA ALA A . n A 1 24 ASN 24 27 27 ASN ASN A . n A 1 25 ALA 25 28 28 ALA ALA A . n A 1 26 ALA 26 29 29 ALA ALA A . n A 1 27 ASP 27 30 30 ASP ASP A . n A 1 28 SER 28 31 31 SER SER A . n A 1 29 GLY 29 32 32 GLY GLY A . n A 1 30 THR 30 33 33 THR THR A . n A 1 31 LEU 31 34 34 LEU LEU A . n A 1 32 ASN 32 35 35 ASN ASN A . n A 1 33 TYR 33 36 36 TYR TYR A . n A 1 34 GLU 34 37 37 GLU GLU A . n A 1 35 VAL 35 38 38 VAL VAL A . n A 1 36 TYR 36 39 39 TYR TYR A . n A 1 37 LYS 37 40 40 LYS LYS A . n A 1 38 TYR 38 41 41 TYR TYR A . n A 1 39 ASN 39 42 42 ASN ASN A . n A 1 40 THR 40 43 43 THR THR A . n A 1 41 ASN 41 44 44 ASN ASN A . n A 1 42 ASP 42 45 45 ASP ASP A . n A 1 43 THR 43 46 46 THR THR A . n A 1 44 SER 44 47 47 SER SER A . n A 1 45 ILE 45 48 48 ILE ILE A . n A 1 46 ALA 46 49 49 ALA ALA A . n A 1 47 ASN 47 50 50 ASN ASN A . n A 1 48 ASP 48 51 51 ASP ASP A . n A 1 49 TYR 49 52 52 TYR TYR A . n A 1 50 PHE 50 53 53 PHE PHE A . n A 1 51 ASN 51 54 54 ASN ASN A . n A 1 52 LYS 52 55 55 LYS LYS A . n A 1 53 PRO 53 56 56 PRO PRO A . n A 1 54 ALA 54 57 57 ALA ALA A . n A 1 55 LYS 55 58 58 LYS LYS A . n A 1 56 TYR 56 59 59 TYR TYR A . n A 1 57 ILE 57 60 60 ILE ILE A . n A 1 58 LYS 58 61 61 LYS LYS A . n A 1 59 LYS 59 62 62 LYS LYS A . n A 1 60 ASN 60 63 63 ASN ASN A . n A 1 61 GLY 61 64 64 GLY GLY A . n A 1 62 LYS 62 65 65 LYS LYS A . n A 1 63 LEU 63 66 66 LEU LEU A . n A 1 64 TYR 64 67 67 TYR TYR A . n A 1 65 VAL 65 68 68 VAL VAL A . n A 1 66 GLN 66 69 69 GLN GLN A . n A 1 67 ILE 67 70 70 ILE ILE A . n A 1 68 THR 68 71 71 THR THR A . n A 1 69 VAL 69 72 72 VAL VAL A . n A 1 70 ASN 70 73 73 ASN ASN A . n A 1 71 HIS 71 74 74 HIS HIS A . n A 1 72 SER 72 75 75 SER SER A . n A 1 73 HIS 73 76 76 HIS HIS A . n A 1 74 TRP 74 77 77 TRP TRP A . n A 1 75 ILE 75 78 78 ILE ILE A . n A 1 76 THR 76 79 79 THR THR A . n A 1 77 GLY 77 80 80 GLY GLY A . n A 1 78 MET 78 81 81 MET MET A . n A 1 79 SER 79 82 82 SER SER A . n A 1 80 ILE 80 83 83 ILE ILE A . n A 1 81 GLU 81 84 84 GLU GLU A . n A 1 82 GLY 82 85 85 GLY GLY A . n A 1 83 HIS 83 86 86 HIS HIS A . n A 1 84 LYS 84 87 87 LYS LYS A . n A 1 85 GLU 85 88 88 GLU GLU A . n A 1 86 ASN 86 89 89 ASN ASN A . n A 1 87 ILE 87 90 90 ILE ILE A . n A 1 88 ILE 88 91 91 ILE ILE A . n A 1 89 SER 89 92 92 SER SER A . n A 1 90 LYS 90 93 93 LYS LYS A . n A 1 91 ASN 91 94 94 ASN ASN A . n A 1 92 THR 92 95 95 THR THR A . n A 1 93 ALA 93 96 96 ALA ALA A . n A 1 94 LYS 94 97 97 LYS LYS A . n A 1 95 ASP 95 98 98 ASP ASP A . n A 1 96 GLU 96 99 99 GLU GLU A . n A 1 97 ARG 97 100 100 ARG ARG A . n A 1 98 THR 98 101 101 THR THR A . n A 1 99 SER 99 102 102 SER SER A . n A 1 100 GLU 100 103 103 GLU GLU A . n A 1 101 PHE 101 104 104 PHE PHE A . n A 1 102 GLU 102 105 105 GLU GLU A . n A 1 103 VAL 103 106 106 VAL VAL A . n A 1 104 SER 104 107 107 SER SER A . n A 1 105 LYS 105 108 108 LYS LYS A . n A 1 106 LEU 106 109 109 LEU LEU A . n A 1 107 ASN 107 110 110 ASN ASN A . n A 1 108 GLY 108 111 111 GLY GLY A . n A 1 109 LYS 109 112 112 LYS LYS A . n A 1 110 ILE 110 113 113 ILE ILE A . n A 1 111 ASP 111 114 114 ASP ASP A . n A 1 112 GLY 112 115 115 GLY GLY A . n A 1 113 LYS 113 116 116 LYS LYS A . n A 1 114 ILE 114 117 117 ILE ILE A . n A 1 115 ASP 115 118 118 ASP ASP A . n A 1 116 VAL 116 119 119 VAL VAL A . n A 1 117 TYR 117 120 120 TYR TYR A . n A 1 118 ILE 118 121 121 ILE ILE A . n A 1 119 ASP 119 122 122 ASP ASP A . n A 1 120 GLU 120 123 123 GLU GLU A . n A 1 121 LYS 121 124 124 LYS LYS A . n A 1 122 VAL 122 125 125 VAL VAL A . n A 1 123 ASN 123 126 126 ASN ASN A . n A 1 124 GLY 124 127 127 GLY GLY A . n A 1 125 LYS 125 128 128 LYS LYS A . n A 1 126 PRO 126 129 129 PRO PRO A . n A 1 127 PHE 127 130 130 PHE PHE A . n A 1 128 LYS 128 131 131 LYS LYS A . n A 1 129 TYR 129 132 132 TYR TYR A . n A 1 130 ASP 130 133 133 ASP ASP A . n A 1 131 HIS 131 134 134 HIS HIS A . n A 1 132 HIS 132 135 135 HIS HIS A . n A 1 133 TYR 133 136 136 TYR TYR A . n A 1 134 ASN 134 137 137 ASN ASN A . n A 1 135 ILE 135 138 138 ILE ILE A . n A 1 136 THR 136 139 139 THR THR A . n A 1 137 TYR 137 140 140 TYR TYR A . n A 1 138 LYS 138 141 141 LYS LYS A . n A 1 139 PHE 139 142 142 PHE PHE A . n A 1 140 ASN 140 143 143 ASN ASN A . n A 1 141 GLY 141 144 144 GLY GLY A . n A 1 142 PRO 142 145 145 PRO PRO A . n A 1 143 THR 143 146 146 THR THR A . n A 1 144 ASP 144 147 147 ASP ASP A . n A 1 145 VAL 145 148 148 VAL VAL A . n A 1 146 ALA 146 149 149 ALA ALA A . n A 1 147 GLY 147 150 150 GLY GLY A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZNH _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 151 _pdbx_nonpoly_scheme.auth_seq_num 151 _pdbx_nonpoly_scheme.pdb_mon_id ZNH _pdbx_nonpoly_scheme.auth_mon_id ZNH _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-08-19 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_ref_seq_dif 7 3 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_ref_seq_dif.details' 6 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 7 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 8 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'sodium phosphate' 50 mM ? 1 'sodium chloride' 100 mM ? 1 'sodium azide' 0.01 % ? 1 IsdC 1.3 mM '[U-100% 13C; U-100% 15N]' 1 'PROTOPORPHYRIN IX CONTAINING ZN' 2.1 mM ? 1 D2O 7 % '[U-100% 2H]' 1 'sodium phosphate' 50 mM ? 2 'sodium chloride' 100 mM ? 2 'sodium azide' 0.01 % ? 2 IsdC 1.1 mM ? 2 'PROTOPORPHYRIN IX CONTAINING ZN' 2.3 mM ? 2 D2O 100 % ? 2 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A SER 82 ? ? H A LYS 116 ? ? 1.60 2 2 H A VAL 72 ? ? O A ARG 100 ? ? 1.58 3 3 O A SER 82 ? ? H A LYS 116 ? ? 1.54 4 3 O A VAL 38 ? ? HG1 A THR 46 ? ? 1.60 5 5 H A VAL 72 ? ? O A ARG 100 ? ? 1.56 6 6 HH A TYR 36 ? ? O A ASN 54 ? ? 1.52 7 6 H A VAL 72 ? ? O A ARG 100 ? ? 1.59 8 8 O A SER 82 ? ? H A LYS 116 ? ? 1.60 9 9 H A VAL 72 ? ? O A ARG 100 ? ? 1.56 10 9 O A ASN 35 ? ? H A ASN 143 ? ? 1.59 11 9 H A ILE 121 ? ? O A TYR 132 ? ? 1.59 12 10 H A VAL 72 ? ? O A ARG 100 ? ? 1.57 13 10 O A SER 82 ? ? H A LYS 116 ? ? 1.57 14 11 O A VAL 38 ? ? HG1 A THR 46 ? ? 1.51 15 11 O A ILE 121 ? ? H A TYR 132 ? ? 1.57 16 11 H A ILE 113 ? ? O A TYR 140 ? ? 1.58 17 13 H A VAL 72 ? ? O A ARG 100 ? ? 1.56 18 14 H A VAL 72 ? ? O A ARG 100 ? ? 1.60 19 15 H A VAL 72 ? ? O A ARG 100 ? ? 1.56 20 16 H A VAL 72 ? ? O A ARG 100 ? ? 1.56 21 17 H A VAL 72 ? ? O A ARG 100 ? ? 1.58 22 18 O A SER 82 ? ? H A LYS 116 ? ? 1.57 23 19 H A VAL 72 ? ? O A ARG 100 ? ? 1.55 24 21 O A VAL 38 ? ? HG1 A THR 46 ? ? 1.47 25 21 H A VAL 72 ? ? O A ARG 100 ? ? 1.59 26 22 H A ILE 117 ? ? O A TYR 136 ? ? 1.58 27 24 O A ASP 30 ? ? H A LYS 61 ? ? 1.59 28 24 H A ILE 121 ? ? O A TYR 132 ? ? 1.60 29 26 O A GLU 123 ? ? H A PHE 130 ? ? 1.60 30 27 O A SER 82 ? ? H A LYS 116 ? ? 1.55 31 27 O A GLU 123 ? ? H A PHE 130 ? ? 1.57 32 27 H A VAL 72 ? ? O A ARG 100 ? ? 1.57 33 27 H A ILE 121 ? ? O A TYR 132 ? ? 1.57 34 28 H A VAL 72 ? ? O A ARG 100 ? ? 1.56 35 30 H A VAL 72 ? ? O A ARG 100 ? ? 1.54 36 30 H A GLY 111 ? ? O A PHE 142 ? ? 1.55 37 30 H A ILE 121 ? ? O A TYR 132 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 28 ? ? 178.87 53.48 2 1 ALA A 29 ? ? -74.30 -150.74 3 1 ILE A 48 ? ? -136.93 -70.91 4 1 TYR A 52 ? ? -142.91 15.73 5 1 LYS A 62 ? ? -153.27 62.21 6 1 ASN A 63 ? ? 46.98 82.44 7 1 TYR A 67 ? ? -137.98 -153.70 8 1 VAL A 68 ? ? -170.73 135.98 9 1 HIS A 74 ? ? 55.04 99.85 10 1 SER A 92 ? ? -167.22 95.91 11 1 LYS A 108 ? ? 46.21 -167.85 12 1 LEU A 109 ? ? -150.25 70.98 13 1 ASP A 122 ? ? -160.57 95.79 14 1 ASP A 133 ? ? -168.01 86.66 15 1 PRO A 145 ? ? -58.57 -166.53 16 1 THR A 146 ? ? -149.84 -54.01 17 1 ASP A 147 ? ? -120.89 -76.71 18 1 ALA A 149 ? ? -157.98 28.79 19 2 ILE A 48 ? ? -137.25 -65.59 20 2 LYS A 62 ? ? -156.73 62.04 21 2 ASN A 63 ? ? 47.53 85.27 22 2 TYR A 67 ? ? -139.48 -155.46 23 2 VAL A 68 ? ? -170.67 134.51 24 2 HIS A 74 ? ? 58.42 99.30 25 2 SER A 92 ? ? -167.04 100.31 26 2 LYS A 108 ? ? 44.83 -164.34 27 2 LEU A 109 ? ? -150.64 68.22 28 2 ASP A 133 ? ? -175.83 87.40 29 2 ASP A 147 ? ? -175.40 -43.12 30 3 ALA A 28 ? ? -143.81 41.44 31 3 ALA A 29 ? ? -165.55 -160.16 32 3 ASN A 42 ? ? 73.09 -1.17 33 3 ILE A 48 ? ? -136.62 -64.94 34 3 LYS A 62 ? ? -159.03 62.21 35 3 ASN A 63 ? ? 48.97 84.00 36 3 VAL A 68 ? ? -170.47 135.98 37 3 HIS A 74 ? ? 52.58 88.81 38 3 SER A 92 ? ? -167.24 100.40 39 3 ARG A 100 ? ? 175.22 160.06 40 3 LYS A 108 ? ? 47.41 -166.04 41 3 LEU A 109 ? ? -151.00 62.75 42 3 GLU A 123 ? ? -174.50 -164.73 43 3 ASP A 133 ? ? -170.45 83.58 44 3 PRO A 145 ? ? -63.22 -174.01 45 3 THR A 146 ? ? -149.47 -42.74 46 3 ASP A 147 ? ? -142.82 -49.16 47 3 ALA A 149 ? ? -158.55 24.67 48 4 ALA A 29 ? ? -165.74 -165.62 49 4 ILE A 48 ? ? -137.32 -71.17 50 4 LYS A 62 ? ? -110.25 62.25 51 4 ASN A 63 ? ? 48.45 97.72 52 4 TYR A 67 ? ? -142.94 -157.92 53 4 HIS A 74 ? ? 54.34 99.44 54 4 GLU A 84 ? ? 72.30 -0.41 55 4 SER A 92 ? ? -166.32 96.08 56 4 LYS A 108 ? ? 46.67 -157.38 57 4 LEU A 109 ? ? -150.21 51.53 58 4 ASP A 122 ? ? -160.73 102.41 59 4 GLU A 123 ? ? -173.70 -164.24 60 4 ASP A 133 ? ? -173.35 87.55 61 4 PRO A 145 ? ? -60.36 -165.73 62 4 THR A 146 ? ? -149.74 -47.83 63 5 ALA A 28 ? ? -149.36 47.25 64 5 THR A 43 ? ? -135.12 -157.84 65 5 ILE A 48 ? ? -136.94 -69.45 66 5 LYS A 62 ? ? -115.91 65.39 67 5 ASN A 63 ? ? 46.39 95.96 68 5 LYS A 65 ? ? -173.18 149.71 69 5 HIS A 74 ? ? 57.60 92.27 70 5 SER A 92 ? ? -167.26 94.64 71 5 LYS A 108 ? ? 49.65 -158.30 72 5 LEU A 109 ? ? -151.31 50.92 73 5 ASP A 122 ? ? -160.39 95.65 74 5 ASP A 133 ? ? -162.81 92.15 75 5 PRO A 145 ? ? -54.89 -168.60 76 5 THR A 146 ? ? -149.20 20.45 77 5 ASP A 147 ? ? -179.69 -61.82 78 6 ALA A 26 ? ? -112.51 76.09 79 6 ALA A 29 ? ? -165.89 -155.50 80 6 ASN A 42 ? ? 72.93 -0.59 81 6 ILE A 48 ? ? -138.47 -76.04 82 6 TYR A 52 ? ? -144.91 15.86 83 6 ASN A 63 ? ? 46.08 99.30 84 6 LEU A 66 ? ? -171.25 145.76 85 6 VAL A 68 ? ? -170.22 128.29 86 6 HIS A 74 ? ? 56.59 90.44 87 6 SER A 92 ? ? -166.20 98.25 88 6 SER A 107 ? ? -68.09 99.98 89 6 LYS A 108 ? ? 55.61 170.82 90 6 ASN A 126 ? ? 49.58 25.47 91 6 ASP A 133 ? ? -160.66 87.36 92 6 PRO A 145 ? ? -66.50 -177.06 93 6 THR A 146 ? ? -149.45 -59.44 94 6 ASP A 147 ? ? -86.85 -148.52 95 7 ILE A 48 ? ? -137.37 -50.75 96 7 LYS A 62 ? ? -103.81 62.42 97 7 ASN A 63 ? ? 47.67 98.31 98 7 HIS A 74 ? ? 55.98 102.80 99 7 SER A 92 ? ? -167.15 94.94 100 7 LYS A 108 ? ? -165.49 -150.96 101 7 LEU A 109 ? ? -148.56 54.18 102 7 ASN A 110 ? ? -145.28 57.64 103 7 ASP A 122 ? ? -160.28 95.56 104 7 ASP A 133 ? ? -176.30 88.38 105 7 PRO A 145 ? ? -49.95 170.84 106 7 THR A 146 ? ? -149.30 -51.01 107 7 VAL A 148 ? ? 55.88 -102.91 108 7 ALA A 149 ? ? -158.56 -58.69 109 8 ALA A 28 ? ? -142.63 35.44 110 8 ALA A 29 ? ? -165.79 -60.89 111 8 ILE A 48 ? ? -138.54 -79.97 112 8 LYS A 62 ? ? -158.26 63.51 113 8 ASN A 63 ? ? 48.71 84.50 114 8 TYR A 67 ? ? -139.00 -159.40 115 8 HIS A 74 ? ? 58.33 89.08 116 8 ASP A 98 ? ? 52.54 79.72 117 8 LYS A 108 ? ? 53.74 174.49 118 8 ASP A 122 ? ? -160.15 98.43 119 8 ASP A 133 ? ? -167.49 86.69 120 8 THR A 146 ? ? -149.28 -41.37 121 8 ASP A 147 ? ? -120.98 -72.76 122 9 ALA A 26 ? ? 56.36 80.63 123 9 ILE A 48 ? ? -136.92 -58.60 124 9 LYS A 62 ? ? -152.75 62.33 125 9 ASN A 63 ? ? 50.47 82.86 126 9 TYR A 67 ? ? -139.61 -155.52 127 9 VAL A 68 ? ? -170.67 135.88 128 9 HIS A 74 ? ? 54.76 94.14 129 9 SER A 92 ? ? -167.53 103.62 130 9 LYS A 108 ? ? -165.50 -157.56 131 9 ASP A 122 ? ? -160.48 96.58 132 9 GLU A 123 ? ? -173.76 -175.78 133 9 PRO A 129 ? ? -52.12 108.31 134 9 ASP A 133 ? ? -166.69 90.47 135 9 ASP A 147 ? ? -148.53 -48.98 136 9 VAL A 148 ? ? 55.12 -102.54 137 9 ALA A 149 ? ? -158.51 -41.11 138 10 ALA A 29 ? ? -165.93 -167.01 139 10 ILE A 48 ? ? -137.11 -64.63 140 10 LYS A 62 ? ? -159.48 62.63 141 10 ASN A 63 ? ? 48.97 87.65 142 10 HIS A 74 ? ? 62.03 74.53 143 10 GLU A 84 ? ? 58.79 16.55 144 10 SER A 92 ? ? -167.50 99.02 145 10 LYS A 108 ? ? 47.23 -163.43 146 10 LEU A 109 ? ? -151.66 64.61 147 10 ASN A 110 ? ? -146.20 58.78 148 10 GLU A 123 ? ? -173.75 -152.95 149 10 ASP A 133 ? ? -170.82 88.45 150 10 PRO A 145 ? ? -58.91 -172.25 151 10 THR A 146 ? ? -149.65 -58.53 152 10 ASP A 147 ? ? -168.84 -63.00 153 11 ALA A 26 ? ? -154.66 87.15 154 11 ALA A 29 ? ? 42.89 -164.00 155 11 THR A 43 ? ? -133.14 -154.67 156 11 ILE A 48 ? ? -137.63 -71.08 157 11 LYS A 62 ? ? -105.06 62.11 158 11 ASN A 63 ? ? 46.99 98.15 159 11 VAL A 68 ? ? -170.18 129.63 160 11 HIS A 74 ? ? 55.85 102.09 161 11 SER A 92 ? ? -166.71 98.54 162 11 LYS A 108 ? ? 51.88 -178.60 163 11 LEU A 109 ? ? -150.00 58.13 164 11 ASN A 110 ? ? -145.28 58.83 165 11 ASP A 122 ? ? -160.38 102.35 166 11 GLU A 123 ? ? -174.11 -170.72 167 11 ASP A 133 ? ? -158.77 84.44 168 11 PRO A 145 ? ? -61.52 -177.25 169 11 THR A 146 ? ? -149.18 -56.92 170 11 ASP A 147 ? ? -143.72 -66.53 171 11 ALA A 149 ? ? -158.25 41.89 172 12 ALA A 29 ? ? -74.10 -161.01 173 12 ILE A 48 ? ? -137.74 -68.81 174 12 LYS A 62 ? ? -155.53 62.15 175 12 ASN A 63 ? ? 47.96 84.30 176 12 VAL A 68 ? ? -170.68 138.88 177 12 HIS A 74 ? ? 57.38 99.63 178 12 ILE A 83 ? ? -171.76 131.51 179 12 LYS A 87 ? ? -70.68 -167.17 180 12 SER A 92 ? ? -166.77 105.34 181 12 LYS A 108 ? ? 47.48 -158.60 182 12 LEU A 109 ? ? -151.02 53.72 183 12 GLU A 123 ? ? -172.66 -158.73 184 12 ASN A 126 ? ? 49.48 29.06 185 12 ASP A 133 ? ? -173.39 94.14 186 12 LYS A 141 ? ? -162.21 101.54 187 12 PRO A 145 ? ? -59.45 172.86 188 12 THR A 146 ? ? -149.89 -60.12 189 13 ALA A 29 ? ? 43.32 -163.68 190 13 ILE A 48 ? ? -137.78 -64.31 191 13 TYR A 52 ? ? -143.05 11.56 192 13 LYS A 62 ? ? -162.03 61.66 193 13 ASN A 63 ? ? 60.91 91.66 194 13 LEU A 66 ? ? -172.51 149.45 195 13 HIS A 74 ? ? 54.80 98.81 196 13 LYS A 87 ? ? -69.87 -162.41 197 13 SER A 92 ? ? -167.15 103.89 198 13 SER A 107 ? ? -57.68 101.53 199 13 LYS A 108 ? ? 53.65 176.46 200 13 LEU A 109 ? ? -150.18 83.22 201 13 ASP A 122 ? ? -160.46 95.28 202 13 GLU A 123 ? ? -174.26 -176.46 203 13 ASP A 133 ? ? -168.53 85.45 204 13 PRO A 145 ? ? -62.76 -170.44 205 13 THR A 146 ? ? -149.08 -42.60 206 13 ASP A 147 ? ? -144.75 -53.60 207 14 ALA A 26 ? ? -171.92 61.99 208 14 ILE A 48 ? ? -138.10 -50.29 209 14 LYS A 62 ? ? -155.98 62.43 210 14 ASN A 63 ? ? 52.23 92.74 211 14 LEU A 66 ? ? -170.72 147.11 212 14 HIS A 74 ? ? 57.70 94.79 213 14 SER A 92 ? ? -166.77 101.04 214 14 LYS A 108 ? ? 50.23 -178.97 215 14 LEU A 109 ? ? -151.22 81.93 216 14 ASP A 122 ? ? -160.34 95.38 217 14 GLU A 123 ? ? -174.81 -156.38 218 14 ASP A 133 ? ? -174.44 89.56 219 14 ASP A 147 ? ? -133.82 -155.03 220 14 VAL A 148 ? ? 56.99 86.91 221 15 ALA A 26 ? ? 60.64 103.94 222 15 ALA A 29 ? ? -165.90 -72.09 223 15 ILE A 48 ? ? -137.50 -75.61 224 15 LYS A 62 ? ? -109.21 62.42 225 15 ASN A 63 ? ? 49.62 100.80 226 15 HIS A 74 ? ? 60.40 102.20 227 15 GLU A 84 ? ? 59.74 15.02 228 15 SER A 92 ? ? -166.73 95.21 229 15 LYS A 108 ? ? -164.50 -148.90 230 15 LEU A 109 ? ? -150.06 51.92 231 15 ASP A 122 ? ? -160.57 98.45 232 15 GLU A 123 ? ? -173.75 -156.95 233 15 ASP A 133 ? ? -177.37 87.57 234 15 PRO A 145 ? ? -57.56 -165.63 235 15 THR A 146 ? ? -149.54 -52.58 236 16 ALA A 26 ? ? -167.60 65.75 237 16 ALA A 29 ? ? 43.72 -160.54 238 16 ILE A 48 ? ? -136.18 -64.41 239 16 TYR A 52 ? ? -142.44 17.30 240 16 ASN A 63 ? ? 46.62 99.17 241 16 VAL A 68 ? ? -170.56 134.12 242 16 HIS A 74 ? ? 62.36 99.79 243 16 SER A 92 ? ? -167.33 107.41 244 16 LYS A 108 ? ? 46.26 -165.55 245 16 LEU A 109 ? ? -151.91 60.20 246 16 ASP A 122 ? ? -160.08 95.43 247 16 GLU A 123 ? ? -173.81 -173.95 248 16 ASP A 133 ? ? -177.08 86.09 249 16 PRO A 145 ? ? -64.44 -175.68 250 16 THR A 146 ? ? -149.13 -61.47 251 16 ASP A 147 ? ? -98.30 -71.62 252 17 ALA A 29 ? ? -165.45 -153.97 253 17 ILE A 48 ? ? -137.98 -74.61 254 17 ASN A 63 ? ? 49.62 101.66 255 17 HIS A 74 ? ? 62.14 116.99 256 17 GLU A 84 ? ? 73.35 -1.07 257 17 SER A 92 ? ? -167.53 105.21 258 17 LYS A 108 ? ? 50.33 -156.49 259 17 LEU A 109 ? ? -150.86 59.83 260 17 GLU A 123 ? ? -173.62 -176.93 261 17 ASP A 133 ? ? -166.37 77.48 262 17 THR A 146 ? ? -150.49 30.44 263 17 ASP A 147 ? ? -121.85 -52.22 264 18 ALA A 26 ? ? -98.83 55.61 265 18 ALA A 28 ? ? -110.60 56.11 266 18 ALA A 29 ? ? 42.15 -162.68 267 18 ILE A 48 ? ? -138.88 -76.96 268 18 LYS A 62 ? ? -157.05 62.15 269 18 ASN A 63 ? ? 51.05 87.20 270 18 HIS A 74 ? ? 64.23 113.55 271 18 GLU A 84 ? ? 72.26 -0.35 272 18 SER A 92 ? ? -167.35 104.88 273 18 LYS A 108 ? ? 46.69 -162.25 274 18 LEU A 109 ? ? -149.84 56.92 275 18 ASP A 133 ? ? -165.92 88.33 276 18 PRO A 145 ? ? -63.19 -172.09 277 18 THR A 146 ? ? -149.37 -46.28 278 18 ASP A 147 ? ? -132.04 -48.58 279 18 ALA A 149 ? ? -158.10 25.74 280 19 ALA A 29 ? ? -166.02 -72.50 281 19 ILE A 48 ? ? -139.45 -78.14 282 19 TYR A 52 ? ? -140.08 10.39 283 19 LYS A 62 ? ? -155.93 62.33 284 19 ASN A 63 ? ? 53.97 85.86 285 19 TYR A 67 ? ? -139.27 -153.84 286 19 VAL A 68 ? ? -170.17 135.16 287 19 HIS A 74 ? ? 52.42 96.67 288 19 SER A 92 ? ? -167.43 104.91 289 19 ARG A 100 ? ? 179.22 162.32 290 19 LYS A 108 ? ? 48.40 -174.15 291 19 LEU A 109 ? ? -150.13 75.45 292 19 ASN A 110 ? ? -146.09 43.22 293 19 ASP A 133 ? ? -175.99 81.04 294 19 ASP A 147 ? ? -155.29 -43.81 295 20 ALA A 29 ? ? -165.67 -160.61 296 20 ASN A 42 ? ? 72.77 -0.01 297 20 ILE A 48 ? ? -137.98 -76.82 298 20 LYS A 62 ? ? -158.53 62.23 299 20 ASN A 63 ? ? 45.11 82.60 300 20 LEU A 66 ? ? -172.68 144.67 301 20 HIS A 74 ? ? 50.61 87.39 302 20 LYS A 87 ? ? -70.15 -164.23 303 20 SER A 92 ? ? -167.38 99.48 304 20 LYS A 108 ? ? -165.50 -165.43 305 20 ASN A 110 ? ? -146.17 55.49 306 20 GLU A 123 ? ? -173.54 -179.73 307 20 ASP A 133 ? ? -165.98 75.36 308 20 ASP A 147 ? ? -165.02 29.28 309 21 ALA A 26 ? ? -170.30 134.58 310 21 ALA A 29 ? ? -74.54 -164.58 311 21 ILE A 48 ? ? -138.19 -49.95 312 21 LYS A 62 ? ? -108.37 63.63 313 21 ASN A 63 ? ? 46.03 96.32 314 21 VAL A 68 ? ? -170.14 131.06 315 21 HIS A 74 ? ? 62.72 113.37 316 21 LYS A 87 ? ? -70.80 -160.49 317 21 SER A 92 ? ? -167.05 105.10 318 21 LYS A 108 ? ? 47.41 -158.90 319 21 LEU A 109 ? ? -151.27 59.93 320 21 ASN A 110 ? ? -146.22 56.96 321 21 ASP A 122 ? ? -160.94 96.80 322 21 GLU A 123 ? ? -173.90 -168.38 323 21 ASP A 133 ? ? -163.40 84.59 324 21 PRO A 145 ? ? -60.27 -169.45 325 21 THR A 146 ? ? -149.55 -43.50 326 21 ALA A 149 ? ? -158.30 47.88 327 22 ALA A 29 ? ? -165.47 -160.11 328 22 ASN A 42 ? ? 73.77 -2.47 329 22 ILE A 48 ? ? -138.92 -77.01 330 22 ASN A 63 ? ? 46.03 99.53 331 22 LEU A 66 ? ? -171.62 145.46 332 22 HIS A 74 ? ? 52.43 92.40 333 22 TRP A 77 ? ? -51.71 -70.43 334 22 SER A 92 ? ? -167.03 100.86 335 22 LYS A 108 ? ? 55.10 174.62 336 22 GLU A 123 ? ? -173.47 -178.97 337 22 ASP A 133 ? ? -174.27 82.28 338 22 ASP A 147 ? ? -154.64 -65.90 339 23 ALA A 29 ? ? -165.74 -46.04 340 23 ILE A 48 ? ? -138.55 -78.50 341 23 TYR A 52 ? ? -141.87 10.74 342 23 LYS A 62 ? ? -101.46 61.97 343 23 ASN A 63 ? ? 47.78 100.53 344 23 HIS A 74 ? ? 61.24 115.39 345 23 TRP A 77 ? ? -64.77 -73.45 346 23 LYS A 87 ? ? -70.55 -164.24 347 23 SER A 92 ? ? -167.03 103.35 348 23 LYS A 108 ? ? 54.39 176.85 349 23 ASN A 110 ? ? -145.59 44.58 350 23 ASP A 122 ? ? -160.89 96.54 351 23 GLU A 123 ? ? -173.50 -170.67 352 23 ASP A 133 ? ? -170.29 88.04 353 23 PRO A 145 ? ? -59.03 -173.94 354 23 THR A 146 ? ? -149.84 -42.41 355 23 ASP A 147 ? ? -160.77 -40.27 356 24 ALA A 26 ? ? -144.61 54.15 357 24 ALA A 28 ? ? -60.92 -179.39 358 24 ALA A 29 ? ? -165.67 -69.72 359 24 THR A 43 ? ? -136.05 -155.98 360 24 ILE A 48 ? ? -137.96 -71.54 361 24 ASN A 63 ? ? 45.69 78.07 362 24 VAL A 68 ? ? -170.17 144.01 363 24 HIS A 74 ? ? 53.62 92.50 364 24 SER A 92 ? ? -167.06 100.18 365 24 LYS A 108 ? ? 45.70 -163.42 366 24 LEU A 109 ? ? -151.03 56.88 367 24 ASP A 122 ? ? -160.48 98.07 368 24 GLU A 123 ? ? -173.20 -168.52 369 24 ASP A 133 ? ? -171.03 86.47 370 24 ASP A 147 ? ? -154.35 -46.60 371 25 ALA A 26 ? ? 179.59 172.20 372 25 ALA A 29 ? ? -165.61 -39.34 373 25 ILE A 48 ? ? -137.94 -50.20 374 25 TYR A 52 ? ? -144.78 28.78 375 25 ASN A 63 ? ? 45.41 96.18 376 25 HIS A 74 ? ? 51.49 86.20 377 25 LYS A 87 ? ? -70.33 -169.54 378 25 SER A 92 ? ? -166.39 98.88 379 25 LYS A 108 ? ? 54.16 175.46 380 25 ASN A 110 ? ? -146.14 40.33 381 25 GLU A 123 ? ? -174.48 -155.77 382 25 ASP A 133 ? ? -169.43 84.62 383 25 PRO A 145 ? ? -54.72 -173.42 384 25 THR A 146 ? ? -150.18 -58.06 385 25 ASP A 147 ? ? -121.44 -65.29 386 26 ALA A 26 ? ? -150.50 80.67 387 26 ALA A 28 ? ? -56.90 -179.99 388 26 ALA A 29 ? ? -165.73 -68.35 389 26 ILE A 48 ? ? -138.99 -78.82 390 26 LYS A 62 ? ? -108.59 62.33 391 26 ASN A 63 ? ? 52.68 103.95 392 26 HIS A 74 ? ? 58.10 92.12 393 26 TRP A 77 ? ? -72.24 -73.32 394 26 GLU A 84 ? ? 57.73 17.69 395 26 SER A 92 ? ? -166.86 101.75 396 26 LYS A 108 ? ? -164.05 -146.23 397 26 LEU A 109 ? ? -151.81 56.35 398 26 GLU A 123 ? ? -173.55 -169.11 399 26 PRO A 129 ? ? -51.13 109.80 400 26 ASP A 133 ? ? -174.62 81.09 401 26 PRO A 145 ? ? -64.92 -161.39 402 26 THR A 146 ? ? -148.44 -47.91 403 26 ASP A 147 ? ? -147.41 -49.59 404 26 ALA A 149 ? ? -158.34 44.81 405 27 ALA A 26 ? ? -169.28 100.28 406 27 ALA A 28 ? ? -162.61 109.67 407 27 ALA A 29 ? ? -165.94 -49.86 408 27 ILE A 48 ? ? -137.57 -69.73 409 27 TYR A 52 ? ? -142.27 11.61 410 27 ASN A 63 ? ? 45.97 97.67 411 27 HIS A 74 ? ? 55.97 97.46 412 27 GLU A 84 ? ? 72.67 -0.25 413 27 SER A 92 ? ? -166.48 96.10 414 27 ARG A 100 ? ? 179.87 159.63 415 27 LYS A 108 ? ? 56.58 171.27 416 27 GLU A 123 ? ? -173.23 -165.14 417 27 ASP A 133 ? ? -170.24 84.39 418 27 ASP A 147 ? ? -165.24 -79.38 419 28 ILE A 48 ? ? -137.46 -73.77 420 28 LYS A 62 ? ? -111.37 62.08 421 28 ASN A 63 ? ? 49.85 101.38 422 28 TYR A 67 ? ? -141.57 -159.32 423 28 HIS A 74 ? ? 63.32 69.93 424 28 SER A 92 ? ? -167.73 95.07 425 28 ASP A 98 ? ? 51.87 70.82 426 28 LYS A 108 ? ? 48.84 -159.66 427 28 LEU A 109 ? ? -150.59 60.72 428 28 GLU A 123 ? ? -174.12 -170.69 429 28 ASP A 133 ? ? -174.39 83.66 430 28 PRO A 145 ? ? -58.96 178.13 431 28 THR A 146 ? ? -148.61 -60.38 432 29 ALA A 26 ? ? -159.46 78.96 433 29 ALA A 29 ? ? -73.87 -73.50 434 29 ILE A 48 ? ? -137.78 -71.64 435 29 ASN A 63 ? ? 49.16 101.54 436 29 HIS A 74 ? ? 53.94 84.17 437 29 SER A 92 ? ? -165.34 94.66 438 29 LYS A 108 ? ? 47.87 -153.51 439 29 LEU A 109 ? ? -151.41 61.23 440 29 ASP A 122 ? ? -160.31 106.65 441 29 GLU A 123 ? ? -172.28 -179.48 442 29 PRO A 129 ? ? -55.86 108.94 443 29 ASP A 133 ? ? -164.83 82.56 444 29 THR A 146 ? ? -149.49 -62.48 445 29 ASP A 147 ? ? -120.37 -60.81 446 30 ALA A 29 ? ? 43.04 -164.78 447 30 ILE A 48 ? ? -137.54 -71.08 448 30 TYR A 52 ? ? -141.61 16.27 449 30 LYS A 62 ? ? -155.06 62.91 450 30 ASN A 63 ? ? 48.61 86.05 451 30 LEU A 66 ? ? -172.19 149.49 452 30 HIS A 74 ? ? 62.14 77.32 453 30 SER A 92 ? ? -166.91 100.21 454 30 LYS A 108 ? ? 50.45 -177.71 455 30 LEU A 109 ? ? -150.42 82.49 456 30 GLU A 123 ? ? -173.88 -149.57 457 30 ASP A 133 ? ? -166.68 89.63 458 30 PRO A 145 ? ? -58.50 -172.36 459 30 THR A 146 ? ? -149.15 -51.92 460 30 ASP A 147 ? ? -131.23 -51.25 461 30 ALA A 149 ? ? -158.31 30.76 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLY 150 ? O ? A GLY 147 O 2 2 Y 1 A GLY 150 ? O ? A GLY 147 O 3 3 Y 1 A GLY 150 ? O ? A GLY 147 O 4 4 Y 1 A GLY 150 ? O ? A GLY 147 O 5 5 Y 1 A GLY 150 ? O ? A GLY 147 O 6 6 Y 1 A GLY 150 ? O ? A GLY 147 O 7 7 Y 1 A GLY 150 ? O ? A GLY 147 O 8 8 Y 1 A GLY 150 ? O ? A GLY 147 O 9 9 Y 1 A GLY 150 ? O ? A GLY 147 O 10 10 Y 1 A GLY 150 ? O ? A GLY 147 O 11 11 Y 1 A GLY 150 ? O ? A GLY 147 O 12 12 Y 1 A GLY 150 ? O ? A GLY 147 O 13 13 Y 1 A GLY 150 ? O ? A GLY 147 O 14 14 Y 1 A GLY 150 ? O ? A GLY 147 O 15 15 Y 1 A GLY 150 ? O ? A GLY 147 O 16 16 Y 1 A GLY 150 ? O ? A GLY 147 O 17 17 Y 1 A GLY 150 ? O ? A GLY 147 O 18 18 Y 1 A GLY 150 ? O ? A GLY 147 O 19 19 Y 1 A GLY 150 ? O ? A GLY 147 O 20 20 Y 1 A GLY 150 ? O ? A GLY 147 O 21 21 Y 1 A GLY 150 ? O ? A GLY 147 O 22 22 Y 1 A GLY 150 ? O ? A GLY 147 O 23 23 Y 1 A GLY 150 ? O ? A GLY 147 O 24 24 Y 1 A GLY 150 ? O ? A GLY 147 O 25 25 Y 1 A GLY 150 ? O ? A GLY 147 O 26 26 Y 1 A GLY 150 ? O ? A GLY 147 O 27 27 Y 1 A GLY 150 ? O ? A GLY 147 O 28 28 Y 1 A GLY 150 ? O ? A GLY 147 O 29 29 Y 1 A GLY 150 ? O ? A GLY 147 O 30 30 Y 1 A GLY 150 ? O ? A GLY 147 O # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 4 ? A MET 1 2 1 Y 1 A GLY 5 ? A GLY 2 3 1 Y 1 A SER 6 ? A SER 3 4 1 Y 1 A SER 7 ? A SER 4 5 1 Y 1 A HIS 8 ? A HIS 5 6 1 Y 1 A HIS 9 ? A HIS 6 7 1 Y 1 A HIS 10 ? A HIS 7 8 1 Y 1 A HIS 11 ? A HIS 8 9 1 Y 1 A HIS 12 ? A HIS 9 10 1 Y 1 A HIS 13 ? A HIS 10 11 1 Y 1 A SER 14 ? A SER 11 12 1 Y 1 A SER 15 ? A SER 12 13 1 Y 1 A GLY 16 ? A GLY 13 14 1 Y 1 A LEU 17 ? A LEU 14 15 1 Y 1 A VAL 18 ? A VAL 15 16 1 Y 1 A PRO 19 ? A PRO 16 17 1 Y 1 A ARG 20 ? A ARG 17 18 1 Y 1 A GLY 21 ? A GLY 18 19 1 Y 1 A SER 22 ? A SER 19 20 1 Y 1 A HIS 23 ? A HIS 20 21 1 Y 1 A MET 24 ? A MET 21 22 2 Y 1 A MET 4 ? A MET 1 23 2 Y 1 A GLY 5 ? A GLY 2 24 2 Y 1 A SER 6 ? A SER 3 25 2 Y 1 A SER 7 ? A SER 4 26 2 Y 1 A HIS 8 ? A HIS 5 27 2 Y 1 A HIS 9 ? A HIS 6 28 2 Y 1 A HIS 10 ? A HIS 7 29 2 Y 1 A HIS 11 ? A HIS 8 30 2 Y 1 A HIS 12 ? A HIS 9 31 2 Y 1 A HIS 13 ? A HIS 10 32 2 Y 1 A SER 14 ? A SER 11 33 2 Y 1 A SER 15 ? A SER 12 34 2 Y 1 A GLY 16 ? A GLY 13 35 2 Y 1 A LEU 17 ? A LEU 14 36 2 Y 1 A VAL 18 ? A VAL 15 37 2 Y 1 A PRO 19 ? A PRO 16 38 2 Y 1 A ARG 20 ? A ARG 17 39 2 Y 1 A GLY 21 ? A GLY 18 40 2 Y 1 A SER 22 ? A SER 19 41 2 Y 1 A HIS 23 ? A HIS 20 42 2 Y 1 A MET 24 ? A MET 21 43 3 Y 1 A MET 4 ? A MET 1 44 3 Y 1 A GLY 5 ? A GLY 2 45 3 Y 1 A SER 6 ? A SER 3 46 3 Y 1 A SER 7 ? A SER 4 47 3 Y 1 A HIS 8 ? A HIS 5 48 3 Y 1 A HIS 9 ? A HIS 6 49 3 Y 1 A HIS 10 ? A HIS 7 50 3 Y 1 A HIS 11 ? A HIS 8 51 3 Y 1 A HIS 12 ? A HIS 9 52 3 Y 1 A HIS 13 ? A HIS 10 53 3 Y 1 A SER 14 ? A SER 11 54 3 Y 1 A SER 15 ? A SER 12 55 3 Y 1 A GLY 16 ? A GLY 13 56 3 Y 1 A LEU 17 ? A LEU 14 57 3 Y 1 A VAL 18 ? A VAL 15 58 3 Y 1 A PRO 19 ? A PRO 16 59 3 Y 1 A ARG 20 ? A ARG 17 60 3 Y 1 A GLY 21 ? A GLY 18 61 3 Y 1 A SER 22 ? A SER 19 62 3 Y 1 A HIS 23 ? A HIS 20 63 3 Y 1 A MET 24 ? A MET 21 64 4 Y 1 A MET 4 ? A MET 1 65 4 Y 1 A GLY 5 ? A GLY 2 66 4 Y 1 A SER 6 ? A SER 3 67 4 Y 1 A SER 7 ? A SER 4 68 4 Y 1 A HIS 8 ? A HIS 5 69 4 Y 1 A HIS 9 ? A HIS 6 70 4 Y 1 A HIS 10 ? A HIS 7 71 4 Y 1 A HIS 11 ? A HIS 8 72 4 Y 1 A HIS 12 ? A HIS 9 73 4 Y 1 A HIS 13 ? A HIS 10 74 4 Y 1 A SER 14 ? A SER 11 75 4 Y 1 A SER 15 ? A SER 12 76 4 Y 1 A GLY 16 ? A GLY 13 77 4 Y 1 A LEU 17 ? A LEU 14 78 4 Y 1 A VAL 18 ? A VAL 15 79 4 Y 1 A PRO 19 ? A PRO 16 80 4 Y 1 A ARG 20 ? A ARG 17 81 4 Y 1 A GLY 21 ? A GLY 18 82 4 Y 1 A SER 22 ? A SER 19 83 4 Y 1 A HIS 23 ? A HIS 20 84 4 Y 1 A MET 24 ? A MET 21 85 5 Y 1 A MET 4 ? A MET 1 86 5 Y 1 A GLY 5 ? A GLY 2 87 5 Y 1 A SER 6 ? A SER 3 88 5 Y 1 A SER 7 ? A SER 4 89 5 Y 1 A HIS 8 ? A HIS 5 90 5 Y 1 A HIS 9 ? A HIS 6 91 5 Y 1 A HIS 10 ? A HIS 7 92 5 Y 1 A HIS 11 ? A HIS 8 93 5 Y 1 A HIS 12 ? A HIS 9 94 5 Y 1 A HIS 13 ? A HIS 10 95 5 Y 1 A SER 14 ? A SER 11 96 5 Y 1 A SER 15 ? A SER 12 97 5 Y 1 A GLY 16 ? A GLY 13 98 5 Y 1 A LEU 17 ? A LEU 14 99 5 Y 1 A VAL 18 ? A VAL 15 100 5 Y 1 A PRO 19 ? A PRO 16 101 5 Y 1 A ARG 20 ? A ARG 17 102 5 Y 1 A GLY 21 ? A GLY 18 103 5 Y 1 A SER 22 ? A SER 19 104 5 Y 1 A HIS 23 ? A HIS 20 105 5 Y 1 A MET 24 ? A MET 21 106 6 Y 1 A MET 4 ? A MET 1 107 6 Y 1 A GLY 5 ? A GLY 2 108 6 Y 1 A SER 6 ? A SER 3 109 6 Y 1 A SER 7 ? A SER 4 110 6 Y 1 A HIS 8 ? A HIS 5 111 6 Y 1 A HIS 9 ? A HIS 6 112 6 Y 1 A HIS 10 ? A HIS 7 113 6 Y 1 A HIS 11 ? A HIS 8 114 6 Y 1 A HIS 12 ? A HIS 9 115 6 Y 1 A HIS 13 ? A HIS 10 116 6 Y 1 A SER 14 ? A SER 11 117 6 Y 1 A SER 15 ? A SER 12 118 6 Y 1 A GLY 16 ? A GLY 13 119 6 Y 1 A LEU 17 ? A LEU 14 120 6 Y 1 A VAL 18 ? A VAL 15 121 6 Y 1 A PRO 19 ? A PRO 16 122 6 Y 1 A ARG 20 ? A ARG 17 123 6 Y 1 A GLY 21 ? A GLY 18 124 6 Y 1 A SER 22 ? A SER 19 125 6 Y 1 A HIS 23 ? A HIS 20 126 6 Y 1 A MET 24 ? A MET 21 127 7 Y 1 A MET 4 ? A MET 1 128 7 Y 1 A GLY 5 ? A GLY 2 129 7 Y 1 A SER 6 ? A SER 3 130 7 Y 1 A SER 7 ? A SER 4 131 7 Y 1 A HIS 8 ? A HIS 5 132 7 Y 1 A HIS 9 ? A HIS 6 133 7 Y 1 A HIS 10 ? A HIS 7 134 7 Y 1 A HIS 11 ? A HIS 8 135 7 Y 1 A HIS 12 ? A HIS 9 136 7 Y 1 A HIS 13 ? A HIS 10 137 7 Y 1 A SER 14 ? A SER 11 138 7 Y 1 A SER 15 ? A SER 12 139 7 Y 1 A GLY 16 ? A GLY 13 140 7 Y 1 A LEU 17 ? A LEU 14 141 7 Y 1 A VAL 18 ? A VAL 15 142 7 Y 1 A PRO 19 ? A PRO 16 143 7 Y 1 A ARG 20 ? A ARG 17 144 7 Y 1 A GLY 21 ? A GLY 18 145 7 Y 1 A SER 22 ? A SER 19 146 7 Y 1 A HIS 23 ? A HIS 20 147 7 Y 1 A MET 24 ? A MET 21 148 8 Y 1 A MET 4 ? A MET 1 149 8 Y 1 A GLY 5 ? A GLY 2 150 8 Y 1 A SER 6 ? A SER 3 151 8 Y 1 A SER 7 ? A SER 4 152 8 Y 1 A HIS 8 ? A HIS 5 153 8 Y 1 A HIS 9 ? A HIS 6 154 8 Y 1 A HIS 10 ? A HIS 7 155 8 Y 1 A HIS 11 ? A HIS 8 156 8 Y 1 A HIS 12 ? A HIS 9 157 8 Y 1 A HIS 13 ? A HIS 10 158 8 Y 1 A SER 14 ? A SER 11 159 8 Y 1 A SER 15 ? A SER 12 160 8 Y 1 A GLY 16 ? A GLY 13 161 8 Y 1 A LEU 17 ? A LEU 14 162 8 Y 1 A VAL 18 ? A VAL 15 163 8 Y 1 A PRO 19 ? A PRO 16 164 8 Y 1 A ARG 20 ? A ARG 17 165 8 Y 1 A GLY 21 ? A GLY 18 166 8 Y 1 A SER 22 ? A SER 19 167 8 Y 1 A HIS 23 ? A HIS 20 168 8 Y 1 A MET 24 ? A MET 21 169 9 Y 1 A MET 4 ? A MET 1 170 9 Y 1 A GLY 5 ? A GLY 2 171 9 Y 1 A SER 6 ? A SER 3 172 9 Y 1 A SER 7 ? A SER 4 173 9 Y 1 A HIS 8 ? A HIS 5 174 9 Y 1 A HIS 9 ? A HIS 6 175 9 Y 1 A HIS 10 ? A HIS 7 176 9 Y 1 A HIS 11 ? A HIS 8 177 9 Y 1 A HIS 12 ? A HIS 9 178 9 Y 1 A HIS 13 ? A HIS 10 179 9 Y 1 A SER 14 ? A SER 11 180 9 Y 1 A SER 15 ? A SER 12 181 9 Y 1 A GLY 16 ? A GLY 13 182 9 Y 1 A LEU 17 ? A LEU 14 183 9 Y 1 A VAL 18 ? A VAL 15 184 9 Y 1 A PRO 19 ? A PRO 16 185 9 Y 1 A ARG 20 ? A ARG 17 186 9 Y 1 A GLY 21 ? A GLY 18 187 9 Y 1 A SER 22 ? A SER 19 188 9 Y 1 A HIS 23 ? A HIS 20 189 9 Y 1 A MET 24 ? A MET 21 190 10 Y 1 A MET 4 ? A MET 1 191 10 Y 1 A GLY 5 ? A GLY 2 192 10 Y 1 A SER 6 ? A SER 3 193 10 Y 1 A SER 7 ? A SER 4 194 10 Y 1 A HIS 8 ? A HIS 5 195 10 Y 1 A HIS 9 ? A HIS 6 196 10 Y 1 A HIS 10 ? A HIS 7 197 10 Y 1 A HIS 11 ? A HIS 8 198 10 Y 1 A HIS 12 ? A HIS 9 199 10 Y 1 A HIS 13 ? A HIS 10 200 10 Y 1 A SER 14 ? A SER 11 201 10 Y 1 A SER 15 ? A SER 12 202 10 Y 1 A GLY 16 ? A GLY 13 203 10 Y 1 A LEU 17 ? A LEU 14 204 10 Y 1 A VAL 18 ? A VAL 15 205 10 Y 1 A PRO 19 ? A PRO 16 206 10 Y 1 A ARG 20 ? A ARG 17 207 10 Y 1 A GLY 21 ? A GLY 18 208 10 Y 1 A SER 22 ? A SER 19 209 10 Y 1 A HIS 23 ? A HIS 20 210 10 Y 1 A MET 24 ? A MET 21 211 11 Y 1 A MET 4 ? A MET 1 212 11 Y 1 A GLY 5 ? A GLY 2 213 11 Y 1 A SER 6 ? A SER 3 214 11 Y 1 A SER 7 ? A SER 4 215 11 Y 1 A HIS 8 ? A HIS 5 216 11 Y 1 A HIS 9 ? A HIS 6 217 11 Y 1 A HIS 10 ? A HIS 7 218 11 Y 1 A HIS 11 ? A HIS 8 219 11 Y 1 A HIS 12 ? A HIS 9 220 11 Y 1 A HIS 13 ? A HIS 10 221 11 Y 1 A SER 14 ? A SER 11 222 11 Y 1 A SER 15 ? A SER 12 223 11 Y 1 A GLY 16 ? A GLY 13 224 11 Y 1 A LEU 17 ? A LEU 14 225 11 Y 1 A VAL 18 ? A VAL 15 226 11 Y 1 A PRO 19 ? A PRO 16 227 11 Y 1 A ARG 20 ? A ARG 17 228 11 Y 1 A GLY 21 ? A GLY 18 229 11 Y 1 A SER 22 ? A SER 19 230 11 Y 1 A HIS 23 ? A HIS 20 231 11 Y 1 A MET 24 ? A MET 21 232 12 Y 1 A MET 4 ? A MET 1 233 12 Y 1 A GLY 5 ? A GLY 2 234 12 Y 1 A SER 6 ? A SER 3 235 12 Y 1 A SER 7 ? A SER 4 236 12 Y 1 A HIS 8 ? A HIS 5 237 12 Y 1 A HIS 9 ? A HIS 6 238 12 Y 1 A HIS 10 ? A HIS 7 239 12 Y 1 A HIS 11 ? A HIS 8 240 12 Y 1 A HIS 12 ? A HIS 9 241 12 Y 1 A HIS 13 ? A HIS 10 242 12 Y 1 A SER 14 ? A SER 11 243 12 Y 1 A SER 15 ? A SER 12 244 12 Y 1 A GLY 16 ? A GLY 13 245 12 Y 1 A LEU 17 ? A LEU 14 246 12 Y 1 A VAL 18 ? A VAL 15 247 12 Y 1 A PRO 19 ? A PRO 16 248 12 Y 1 A ARG 20 ? A ARG 17 249 12 Y 1 A GLY 21 ? A GLY 18 250 12 Y 1 A SER 22 ? A SER 19 251 12 Y 1 A HIS 23 ? A HIS 20 252 12 Y 1 A MET 24 ? A MET 21 253 13 Y 1 A MET 4 ? A MET 1 254 13 Y 1 A GLY 5 ? A GLY 2 255 13 Y 1 A SER 6 ? A SER 3 256 13 Y 1 A SER 7 ? A SER 4 257 13 Y 1 A HIS 8 ? A HIS 5 258 13 Y 1 A HIS 9 ? A HIS 6 259 13 Y 1 A HIS 10 ? A HIS 7 260 13 Y 1 A HIS 11 ? A HIS 8 261 13 Y 1 A HIS 12 ? A HIS 9 262 13 Y 1 A HIS 13 ? A HIS 10 263 13 Y 1 A SER 14 ? A SER 11 264 13 Y 1 A SER 15 ? A SER 12 265 13 Y 1 A GLY 16 ? A GLY 13 266 13 Y 1 A LEU 17 ? A LEU 14 267 13 Y 1 A VAL 18 ? A VAL 15 268 13 Y 1 A PRO 19 ? A PRO 16 269 13 Y 1 A ARG 20 ? A ARG 17 270 13 Y 1 A GLY 21 ? A GLY 18 271 13 Y 1 A SER 22 ? A SER 19 272 13 Y 1 A HIS 23 ? A HIS 20 273 13 Y 1 A MET 24 ? A MET 21 274 14 Y 1 A MET 4 ? A MET 1 275 14 Y 1 A GLY 5 ? A GLY 2 276 14 Y 1 A SER 6 ? A SER 3 277 14 Y 1 A SER 7 ? A SER 4 278 14 Y 1 A HIS 8 ? A HIS 5 279 14 Y 1 A HIS 9 ? A HIS 6 280 14 Y 1 A HIS 10 ? A HIS 7 281 14 Y 1 A HIS 11 ? A HIS 8 282 14 Y 1 A HIS 12 ? A HIS 9 283 14 Y 1 A HIS 13 ? A HIS 10 284 14 Y 1 A SER 14 ? A SER 11 285 14 Y 1 A SER 15 ? A SER 12 286 14 Y 1 A GLY 16 ? A GLY 13 287 14 Y 1 A LEU 17 ? A LEU 14 288 14 Y 1 A VAL 18 ? A VAL 15 289 14 Y 1 A PRO 19 ? A PRO 16 290 14 Y 1 A ARG 20 ? A ARG 17 291 14 Y 1 A GLY 21 ? A GLY 18 292 14 Y 1 A SER 22 ? A SER 19 293 14 Y 1 A HIS 23 ? A HIS 20 294 14 Y 1 A MET 24 ? A MET 21 295 15 Y 1 A MET 4 ? A MET 1 296 15 Y 1 A GLY 5 ? A GLY 2 297 15 Y 1 A SER 6 ? A SER 3 298 15 Y 1 A SER 7 ? A SER 4 299 15 Y 1 A HIS 8 ? A HIS 5 300 15 Y 1 A HIS 9 ? A HIS 6 301 15 Y 1 A HIS 10 ? A HIS 7 302 15 Y 1 A HIS 11 ? A HIS 8 303 15 Y 1 A HIS 12 ? A HIS 9 304 15 Y 1 A HIS 13 ? A HIS 10 305 15 Y 1 A SER 14 ? A SER 11 306 15 Y 1 A SER 15 ? A SER 12 307 15 Y 1 A GLY 16 ? A GLY 13 308 15 Y 1 A LEU 17 ? A LEU 14 309 15 Y 1 A VAL 18 ? A VAL 15 310 15 Y 1 A PRO 19 ? A PRO 16 311 15 Y 1 A ARG 20 ? A ARG 17 312 15 Y 1 A GLY 21 ? A GLY 18 313 15 Y 1 A SER 22 ? A SER 19 314 15 Y 1 A HIS 23 ? A HIS 20 315 15 Y 1 A MET 24 ? A MET 21 316 16 Y 1 A MET 4 ? A MET 1 317 16 Y 1 A GLY 5 ? A GLY 2 318 16 Y 1 A SER 6 ? A SER 3 319 16 Y 1 A SER 7 ? A SER 4 320 16 Y 1 A HIS 8 ? A HIS 5 321 16 Y 1 A HIS 9 ? A HIS 6 322 16 Y 1 A HIS 10 ? A HIS 7 323 16 Y 1 A HIS 11 ? A HIS 8 324 16 Y 1 A HIS 12 ? A HIS 9 325 16 Y 1 A HIS 13 ? A HIS 10 326 16 Y 1 A SER 14 ? A SER 11 327 16 Y 1 A SER 15 ? A SER 12 328 16 Y 1 A GLY 16 ? A GLY 13 329 16 Y 1 A LEU 17 ? A LEU 14 330 16 Y 1 A VAL 18 ? A VAL 15 331 16 Y 1 A PRO 19 ? A PRO 16 332 16 Y 1 A ARG 20 ? A ARG 17 333 16 Y 1 A GLY 21 ? A GLY 18 334 16 Y 1 A SER 22 ? A SER 19 335 16 Y 1 A HIS 23 ? A HIS 20 336 16 Y 1 A MET 24 ? A MET 21 337 17 Y 1 A MET 4 ? A MET 1 338 17 Y 1 A GLY 5 ? A GLY 2 339 17 Y 1 A SER 6 ? A SER 3 340 17 Y 1 A SER 7 ? A SER 4 341 17 Y 1 A HIS 8 ? A HIS 5 342 17 Y 1 A HIS 9 ? A HIS 6 343 17 Y 1 A HIS 10 ? A HIS 7 344 17 Y 1 A HIS 11 ? A HIS 8 345 17 Y 1 A HIS 12 ? A HIS 9 346 17 Y 1 A HIS 13 ? A HIS 10 347 17 Y 1 A SER 14 ? A SER 11 348 17 Y 1 A SER 15 ? A SER 12 349 17 Y 1 A GLY 16 ? A GLY 13 350 17 Y 1 A LEU 17 ? A LEU 14 351 17 Y 1 A VAL 18 ? A VAL 15 352 17 Y 1 A PRO 19 ? A PRO 16 353 17 Y 1 A ARG 20 ? A ARG 17 354 17 Y 1 A GLY 21 ? A GLY 18 355 17 Y 1 A SER 22 ? A SER 19 356 17 Y 1 A HIS 23 ? A HIS 20 357 17 Y 1 A MET 24 ? A MET 21 358 18 Y 1 A MET 4 ? A MET 1 359 18 Y 1 A GLY 5 ? A GLY 2 360 18 Y 1 A SER 6 ? A SER 3 361 18 Y 1 A SER 7 ? A SER 4 362 18 Y 1 A HIS 8 ? A HIS 5 363 18 Y 1 A HIS 9 ? A HIS 6 364 18 Y 1 A HIS 10 ? A HIS 7 365 18 Y 1 A HIS 11 ? A HIS 8 366 18 Y 1 A HIS 12 ? A HIS 9 367 18 Y 1 A HIS 13 ? A HIS 10 368 18 Y 1 A SER 14 ? A SER 11 369 18 Y 1 A SER 15 ? A SER 12 370 18 Y 1 A GLY 16 ? A GLY 13 371 18 Y 1 A LEU 17 ? A LEU 14 372 18 Y 1 A VAL 18 ? A VAL 15 373 18 Y 1 A PRO 19 ? A PRO 16 374 18 Y 1 A ARG 20 ? A ARG 17 375 18 Y 1 A GLY 21 ? A GLY 18 376 18 Y 1 A SER 22 ? A SER 19 377 18 Y 1 A HIS 23 ? A HIS 20 378 18 Y 1 A MET 24 ? A MET 21 379 19 Y 1 A MET 4 ? A MET 1 380 19 Y 1 A GLY 5 ? A GLY 2 381 19 Y 1 A SER 6 ? A SER 3 382 19 Y 1 A SER 7 ? A SER 4 383 19 Y 1 A HIS 8 ? A HIS 5 384 19 Y 1 A HIS 9 ? A HIS 6 385 19 Y 1 A HIS 10 ? A HIS 7 386 19 Y 1 A HIS 11 ? A HIS 8 387 19 Y 1 A HIS 12 ? A HIS 9 388 19 Y 1 A HIS 13 ? A HIS 10 389 19 Y 1 A SER 14 ? A SER 11 390 19 Y 1 A SER 15 ? A SER 12 391 19 Y 1 A GLY 16 ? A GLY 13 392 19 Y 1 A LEU 17 ? A LEU 14 393 19 Y 1 A VAL 18 ? A VAL 15 394 19 Y 1 A PRO 19 ? A PRO 16 395 19 Y 1 A ARG 20 ? A ARG 17 396 19 Y 1 A GLY 21 ? A GLY 18 397 19 Y 1 A SER 22 ? A SER 19 398 19 Y 1 A HIS 23 ? A HIS 20 399 19 Y 1 A MET 24 ? A MET 21 400 20 Y 1 A MET 4 ? A MET 1 401 20 Y 1 A GLY 5 ? A GLY 2 402 20 Y 1 A SER 6 ? A SER 3 403 20 Y 1 A SER 7 ? A SER 4 404 20 Y 1 A HIS 8 ? A HIS 5 405 20 Y 1 A HIS 9 ? A HIS 6 406 20 Y 1 A HIS 10 ? A HIS 7 407 20 Y 1 A HIS 11 ? A HIS 8 408 20 Y 1 A HIS 12 ? A HIS 9 409 20 Y 1 A HIS 13 ? A HIS 10 410 20 Y 1 A SER 14 ? A SER 11 411 20 Y 1 A SER 15 ? A SER 12 412 20 Y 1 A GLY 16 ? A GLY 13 413 20 Y 1 A LEU 17 ? A LEU 14 414 20 Y 1 A VAL 18 ? A VAL 15 415 20 Y 1 A PRO 19 ? A PRO 16 416 20 Y 1 A ARG 20 ? A ARG 17 417 20 Y 1 A GLY 21 ? A GLY 18 418 20 Y 1 A SER 22 ? A SER 19 419 20 Y 1 A HIS 23 ? A HIS 20 420 20 Y 1 A MET 24 ? A MET 21 421 21 Y 1 A MET 4 ? A MET 1 422 21 Y 1 A GLY 5 ? A GLY 2 423 21 Y 1 A SER 6 ? A SER 3 424 21 Y 1 A SER 7 ? A SER 4 425 21 Y 1 A HIS 8 ? A HIS 5 426 21 Y 1 A HIS 9 ? A HIS 6 427 21 Y 1 A HIS 10 ? A HIS 7 428 21 Y 1 A HIS 11 ? A HIS 8 429 21 Y 1 A HIS 12 ? A HIS 9 430 21 Y 1 A HIS 13 ? A HIS 10 431 21 Y 1 A SER 14 ? A SER 11 432 21 Y 1 A SER 15 ? A SER 12 433 21 Y 1 A GLY 16 ? A GLY 13 434 21 Y 1 A LEU 17 ? A LEU 14 435 21 Y 1 A VAL 18 ? A VAL 15 436 21 Y 1 A PRO 19 ? A PRO 16 437 21 Y 1 A ARG 20 ? A ARG 17 438 21 Y 1 A GLY 21 ? A GLY 18 439 21 Y 1 A SER 22 ? A SER 19 440 21 Y 1 A HIS 23 ? A HIS 20 441 21 Y 1 A MET 24 ? A MET 21 442 22 Y 1 A MET 4 ? A MET 1 443 22 Y 1 A GLY 5 ? A GLY 2 444 22 Y 1 A SER 6 ? A SER 3 445 22 Y 1 A SER 7 ? A SER 4 446 22 Y 1 A HIS 8 ? A HIS 5 447 22 Y 1 A HIS 9 ? A HIS 6 448 22 Y 1 A HIS 10 ? A HIS 7 449 22 Y 1 A HIS 11 ? A HIS 8 450 22 Y 1 A HIS 12 ? A HIS 9 451 22 Y 1 A HIS 13 ? A HIS 10 452 22 Y 1 A SER 14 ? A SER 11 453 22 Y 1 A SER 15 ? A SER 12 454 22 Y 1 A GLY 16 ? A GLY 13 455 22 Y 1 A LEU 17 ? A LEU 14 456 22 Y 1 A VAL 18 ? A VAL 15 457 22 Y 1 A PRO 19 ? A PRO 16 458 22 Y 1 A ARG 20 ? A ARG 17 459 22 Y 1 A GLY 21 ? A GLY 18 460 22 Y 1 A SER 22 ? A SER 19 461 22 Y 1 A HIS 23 ? A HIS 20 462 22 Y 1 A MET 24 ? A MET 21 463 23 Y 1 A MET 4 ? A MET 1 464 23 Y 1 A GLY 5 ? A GLY 2 465 23 Y 1 A SER 6 ? A SER 3 466 23 Y 1 A SER 7 ? A SER 4 467 23 Y 1 A HIS 8 ? A HIS 5 468 23 Y 1 A HIS 9 ? A HIS 6 469 23 Y 1 A HIS 10 ? A HIS 7 470 23 Y 1 A HIS 11 ? A HIS 8 471 23 Y 1 A HIS 12 ? A HIS 9 472 23 Y 1 A HIS 13 ? A HIS 10 473 23 Y 1 A SER 14 ? A SER 11 474 23 Y 1 A SER 15 ? A SER 12 475 23 Y 1 A GLY 16 ? A GLY 13 476 23 Y 1 A LEU 17 ? A LEU 14 477 23 Y 1 A VAL 18 ? A VAL 15 478 23 Y 1 A PRO 19 ? A PRO 16 479 23 Y 1 A ARG 20 ? A ARG 17 480 23 Y 1 A GLY 21 ? A GLY 18 481 23 Y 1 A SER 22 ? A SER 19 482 23 Y 1 A HIS 23 ? A HIS 20 483 23 Y 1 A MET 24 ? A MET 21 484 24 Y 1 A MET 4 ? A MET 1 485 24 Y 1 A GLY 5 ? A GLY 2 486 24 Y 1 A SER 6 ? A SER 3 487 24 Y 1 A SER 7 ? A SER 4 488 24 Y 1 A HIS 8 ? A HIS 5 489 24 Y 1 A HIS 9 ? A HIS 6 490 24 Y 1 A HIS 10 ? A HIS 7 491 24 Y 1 A HIS 11 ? A HIS 8 492 24 Y 1 A HIS 12 ? A HIS 9 493 24 Y 1 A HIS 13 ? A HIS 10 494 24 Y 1 A SER 14 ? A SER 11 495 24 Y 1 A SER 15 ? A SER 12 496 24 Y 1 A GLY 16 ? A GLY 13 497 24 Y 1 A LEU 17 ? A LEU 14 498 24 Y 1 A VAL 18 ? A VAL 15 499 24 Y 1 A PRO 19 ? A PRO 16 500 24 Y 1 A ARG 20 ? A ARG 17 501 24 Y 1 A GLY 21 ? A GLY 18 502 24 Y 1 A SER 22 ? A SER 19 503 24 Y 1 A HIS 23 ? A HIS 20 504 24 Y 1 A MET 24 ? A MET 21 505 25 Y 1 A MET 4 ? A MET 1 506 25 Y 1 A GLY 5 ? A GLY 2 507 25 Y 1 A SER 6 ? A SER 3 508 25 Y 1 A SER 7 ? A SER 4 509 25 Y 1 A HIS 8 ? A HIS 5 510 25 Y 1 A HIS 9 ? A HIS 6 511 25 Y 1 A HIS 10 ? A HIS 7 512 25 Y 1 A HIS 11 ? A HIS 8 513 25 Y 1 A HIS 12 ? A HIS 9 514 25 Y 1 A HIS 13 ? A HIS 10 515 25 Y 1 A SER 14 ? A SER 11 516 25 Y 1 A SER 15 ? A SER 12 517 25 Y 1 A GLY 16 ? A GLY 13 518 25 Y 1 A LEU 17 ? A LEU 14 519 25 Y 1 A VAL 18 ? A VAL 15 520 25 Y 1 A PRO 19 ? A PRO 16 521 25 Y 1 A ARG 20 ? A ARG 17 522 25 Y 1 A GLY 21 ? A GLY 18 523 25 Y 1 A SER 22 ? A SER 19 524 25 Y 1 A HIS 23 ? A HIS 20 525 25 Y 1 A MET 24 ? A MET 21 526 26 Y 1 A MET 4 ? A MET 1 527 26 Y 1 A GLY 5 ? A GLY 2 528 26 Y 1 A SER 6 ? A SER 3 529 26 Y 1 A SER 7 ? A SER 4 530 26 Y 1 A HIS 8 ? A HIS 5 531 26 Y 1 A HIS 9 ? A HIS 6 532 26 Y 1 A HIS 10 ? A HIS 7 533 26 Y 1 A HIS 11 ? A HIS 8 534 26 Y 1 A HIS 12 ? A HIS 9 535 26 Y 1 A HIS 13 ? A HIS 10 536 26 Y 1 A SER 14 ? A SER 11 537 26 Y 1 A SER 15 ? A SER 12 538 26 Y 1 A GLY 16 ? A GLY 13 539 26 Y 1 A LEU 17 ? A LEU 14 540 26 Y 1 A VAL 18 ? A VAL 15 541 26 Y 1 A PRO 19 ? A PRO 16 542 26 Y 1 A ARG 20 ? A ARG 17 543 26 Y 1 A GLY 21 ? A GLY 18 544 26 Y 1 A SER 22 ? A SER 19 545 26 Y 1 A HIS 23 ? A HIS 20 546 26 Y 1 A MET 24 ? A MET 21 547 27 Y 1 A MET 4 ? A MET 1 548 27 Y 1 A GLY 5 ? A GLY 2 549 27 Y 1 A SER 6 ? A SER 3 550 27 Y 1 A SER 7 ? A SER 4 551 27 Y 1 A HIS 8 ? A HIS 5 552 27 Y 1 A HIS 9 ? A HIS 6 553 27 Y 1 A HIS 10 ? A HIS 7 554 27 Y 1 A HIS 11 ? A HIS 8 555 27 Y 1 A HIS 12 ? A HIS 9 556 27 Y 1 A HIS 13 ? A HIS 10 557 27 Y 1 A SER 14 ? A SER 11 558 27 Y 1 A SER 15 ? A SER 12 559 27 Y 1 A GLY 16 ? A GLY 13 560 27 Y 1 A LEU 17 ? A LEU 14 561 27 Y 1 A VAL 18 ? A VAL 15 562 27 Y 1 A PRO 19 ? A PRO 16 563 27 Y 1 A ARG 20 ? A ARG 17 564 27 Y 1 A GLY 21 ? A GLY 18 565 27 Y 1 A SER 22 ? A SER 19 566 27 Y 1 A HIS 23 ? A HIS 20 567 27 Y 1 A MET 24 ? A MET 21 568 28 Y 1 A MET 4 ? A MET 1 569 28 Y 1 A GLY 5 ? A GLY 2 570 28 Y 1 A SER 6 ? A SER 3 571 28 Y 1 A SER 7 ? A SER 4 572 28 Y 1 A HIS 8 ? A HIS 5 573 28 Y 1 A HIS 9 ? A HIS 6 574 28 Y 1 A HIS 10 ? A HIS 7 575 28 Y 1 A HIS 11 ? A HIS 8 576 28 Y 1 A HIS 12 ? A HIS 9 577 28 Y 1 A HIS 13 ? A HIS 10 578 28 Y 1 A SER 14 ? A SER 11 579 28 Y 1 A SER 15 ? A SER 12 580 28 Y 1 A GLY 16 ? A GLY 13 581 28 Y 1 A LEU 17 ? A LEU 14 582 28 Y 1 A VAL 18 ? A VAL 15 583 28 Y 1 A PRO 19 ? A PRO 16 584 28 Y 1 A ARG 20 ? A ARG 17 585 28 Y 1 A GLY 21 ? A GLY 18 586 28 Y 1 A SER 22 ? A SER 19 587 28 Y 1 A HIS 23 ? A HIS 20 588 28 Y 1 A MET 24 ? A MET 21 589 29 Y 1 A MET 4 ? A MET 1 590 29 Y 1 A GLY 5 ? A GLY 2 591 29 Y 1 A SER 6 ? A SER 3 592 29 Y 1 A SER 7 ? A SER 4 593 29 Y 1 A HIS 8 ? A HIS 5 594 29 Y 1 A HIS 9 ? A HIS 6 595 29 Y 1 A HIS 10 ? A HIS 7 596 29 Y 1 A HIS 11 ? A HIS 8 597 29 Y 1 A HIS 12 ? A HIS 9 598 29 Y 1 A HIS 13 ? A HIS 10 599 29 Y 1 A SER 14 ? A SER 11 600 29 Y 1 A SER 15 ? A SER 12 601 29 Y 1 A GLY 16 ? A GLY 13 602 29 Y 1 A LEU 17 ? A LEU 14 603 29 Y 1 A VAL 18 ? A VAL 15 604 29 Y 1 A PRO 19 ? A PRO 16 605 29 Y 1 A ARG 20 ? A ARG 17 606 29 Y 1 A GLY 21 ? A GLY 18 607 29 Y 1 A SER 22 ? A SER 19 608 29 Y 1 A HIS 23 ? A HIS 20 609 29 Y 1 A MET 24 ? A MET 21 610 30 Y 1 A MET 4 ? A MET 1 611 30 Y 1 A GLY 5 ? A GLY 2 612 30 Y 1 A SER 6 ? A SER 3 613 30 Y 1 A SER 7 ? A SER 4 614 30 Y 1 A HIS 8 ? A HIS 5 615 30 Y 1 A HIS 9 ? A HIS 6 616 30 Y 1 A HIS 10 ? A HIS 7 617 30 Y 1 A HIS 11 ? A HIS 8 618 30 Y 1 A HIS 12 ? A HIS 9 619 30 Y 1 A HIS 13 ? A HIS 10 620 30 Y 1 A SER 14 ? A SER 11 621 30 Y 1 A SER 15 ? A SER 12 622 30 Y 1 A GLY 16 ? A GLY 13 623 30 Y 1 A LEU 17 ? A LEU 14 624 30 Y 1 A VAL 18 ? A VAL 15 625 30 Y 1 A PRO 19 ? A PRO 16 626 30 Y 1 A ARG 20 ? A ARG 17 627 30 Y 1 A GLY 21 ? A GLY 18 628 30 Y 1 A SER 22 ? A SER 19 629 30 Y 1 A HIS 23 ? A HIS 20 630 30 Y 1 A MET 24 ? A MET 21 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'PROTOPORPHYRIN IX CONTAINING ZN' _pdbx_entity_nonpoly.comp_id ZNH #