data_2K8Y # _entry.id 2K8Y # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2K8Y pdb_00002k8y 10.2210/pdb2k8y/pdb RCSB RCSB100825 ? ? WWPDB D_1000100825 ? ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 1ZD0 PDB . unspecified MjT1 TargetDB . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2K8Y _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2008-09-25 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Rumpel, S.' 1 'Fares, C.' 2 'Neculai, D.' 3 'Arrowsmith, C.' 4 'Montelione, G.T.' 5 'Sicheri, F.' 6 'Northeast Structural Genomics Consortium (NESG)' 7 # _citation.id primary _citation.title 'Atomic structure of the KEOPS complex: an ancient protein kinase-containing molecular machine.' _citation.journal_abbrev Mol.Cell _citation.journal_volume 32 _citation.page_first 259 _citation.page_last 275 _citation.year 2008 _citation.journal_id_ASTM MOCEFL _citation.country US _citation.journal_id_ISSN 1097-2765 _citation.journal_id_CSD 2168 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18951093 _citation.pdbx_database_id_DOI 10.1016/j.molcel.2008.10.002 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Mao, D.Y.' 1 ? primary 'Neculai, D.' 2 ? primary 'Downey, M.' 3 ? primary 'Orlicky, S.' 4 ? primary 'Haffani, Y.Z.' 5 ? primary 'Ceccarelli, D.F.' 6 ? primary 'Ho, J.S.' 7 ? primary 'Szilard, R.K.' 8 ? primary 'Zhang, W.' 9 ? primary 'Ho, C.S.' 10 ? primary 'Wan, L.' 11 ? primary 'Fares, C.' 12 ? primary 'Rumpel, S.' 13 ? primary 'Kurinov, I.' 14 ? primary 'Arrowsmith, C.H.' 15 ? primary 'Durocher, D.' 16 ? primary 'Sicheri, F.' 17 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Uncharacterized protein MJ0187' _entity.formula_weight 17092.066 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GAMDPMIIRGIRGARINNEIFNLGLKFQILNADVVATKKHVLHAINQAKTKKPIAKSFWMEILVRASGQRQIHEAIKIIG AKDGNVCLICEDEETFRKIYELIGGEIDDSVLEINEDKERLIREIFKIRGFGNVVERVLEKIALIELKKE ; _entity_poly.pdbx_seq_one_letter_code_can ;GAMDPMIIRGIRGARINNEIFNLGLKFQILNADVVATKKHVLHAINQAKTKKPIAKSFWMEILVRASGQRQIHEAIKIIG AKDGNVCLICEDEETFRKIYELIGGEIDDSVLEINEDKERLIREIFKIRGFGNVVERVLEKIALIELKKE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier MjT1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 MET n 1 4 ASP n 1 5 PRO n 1 6 MET n 1 7 ILE n 1 8 ILE n 1 9 ARG n 1 10 GLY n 1 11 ILE n 1 12 ARG n 1 13 GLY n 1 14 ALA n 1 15 ARG n 1 16 ILE n 1 17 ASN n 1 18 ASN n 1 19 GLU n 1 20 ILE n 1 21 PHE n 1 22 ASN n 1 23 LEU n 1 24 GLY n 1 25 LEU n 1 26 LYS n 1 27 PHE n 1 28 GLN n 1 29 ILE n 1 30 LEU n 1 31 ASN n 1 32 ALA n 1 33 ASP n 1 34 VAL n 1 35 VAL n 1 36 ALA n 1 37 THR n 1 38 LYS n 1 39 LYS n 1 40 HIS n 1 41 VAL n 1 42 LEU n 1 43 HIS n 1 44 ALA n 1 45 ILE n 1 46 ASN n 1 47 GLN n 1 48 ALA n 1 49 LYS n 1 50 THR n 1 51 LYS n 1 52 LYS n 1 53 PRO n 1 54 ILE n 1 55 ALA n 1 56 LYS n 1 57 SER n 1 58 PHE n 1 59 TRP n 1 60 MET n 1 61 GLU n 1 62 ILE n 1 63 LEU n 1 64 VAL n 1 65 ARG n 1 66 ALA n 1 67 SER n 1 68 GLY n 1 69 GLN n 1 70 ARG n 1 71 GLN n 1 72 ILE n 1 73 HIS n 1 74 GLU n 1 75 ALA n 1 76 ILE n 1 77 LYS n 1 78 ILE n 1 79 ILE n 1 80 GLY n 1 81 ALA n 1 82 LYS n 1 83 ASP n 1 84 GLY n 1 85 ASN n 1 86 VAL n 1 87 CYS n 1 88 LEU n 1 89 ILE n 1 90 CYS n 1 91 GLU n 1 92 ASP n 1 93 GLU n 1 94 GLU n 1 95 THR n 1 96 PHE n 1 97 ARG n 1 98 LYS n 1 99 ILE n 1 100 TYR n 1 101 GLU n 1 102 LEU n 1 103 ILE n 1 104 GLY n 1 105 GLY n 1 106 GLU n 1 107 ILE n 1 108 ASP n 1 109 ASP n 1 110 SER n 1 111 VAL n 1 112 LEU n 1 113 GLU n 1 114 ILE n 1 115 ASN n 1 116 GLU n 1 117 ASP n 1 118 LYS n 1 119 GLU n 1 120 ARG n 1 121 LEU n 1 122 ILE n 1 123 ARG n 1 124 GLU n 1 125 ILE n 1 126 PHE n 1 127 LYS n 1 128 ILE n 1 129 ARG n 1 130 GLY n 1 131 PHE n 1 132 GLY n 1 133 ASN n 1 134 VAL n 1 135 VAL n 1 136 GLU n 1 137 ARG n 1 138 VAL n 1 139 LEU n 1 140 GLU n 1 141 LYS n 1 142 ILE n 1 143 ALA n 1 144 LEU n 1 145 ILE n 1 146 GLU n 1 147 LEU n 1 148 LYS n 1 149 LYS n 1 150 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Methanococcus jannaschii' _entity_src_gen.gene_src_genus Methanococcus _entity_src_gen.pdbx_gene_src_gene MJ0187 _entity_src_gen.gene_src_species jannaschii _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Methanocaldococcus jannaschii' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2190 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species coli _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pGEX _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Y187_METJA _struct_ref.pdbx_db_accession Q57646 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MIIRGIRGARINNEIFNLGLKFQILNADVVATKKHVLHAINQAKTKKPIAKSFWMEILVRASGQRQIHEAIKIIGAKDGN VCLICEDEETFRKIYELIGGEIDDSVLEINEDKERLIREIFKIRGFGNVVERVLEKIALIELKKE ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2K8Y _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 6 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 150 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q57646 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 145 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 6 _struct_ref_seq.pdbx_auth_seq_align_end 150 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2K8Y GLY A 1 ? UNP Q57646 ? ? 'expression tag' 1 1 1 2K8Y ALA A 2 ? UNP Q57646 ? ? 'expression tag' 2 2 1 2K8Y MET A 3 ? UNP Q57646 ? ? 'expression tag' 3 3 1 2K8Y ASP A 4 ? UNP Q57646 ? ? 'expression tag' 4 4 1 2K8Y PRO A 5 ? UNP Q57646 ? ? 'expression tag' 5 5 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D HNCO' 1 5 1 '3D HNCACB' 1 6 1 '3D HCCH-TOCSY' 1 7 1 '3D HBHA(CO)NH' 1 8 1 '3D 1H-15N NOESY' 1 9 1 '3D 1H-13C NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.1 _pdbx_nmr_exptl_sample_conditions.pH 6.3 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '1 mM [U-100% 13C; U-100% 15N] protein, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Bruker AVANCE 1 'Bruker Avance' 800 Bruker AVANCE 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2K8Y _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2K8Y _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2K8Y _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 1 'Guntert, Mumenthaler and Wuthrich' refinement CYANA ? 2 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2K8Y _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2K8Y _struct.title 'Solution NMR Structure of Cgi121 from Methanococcus jannaschii. Northeast Structural Genomics Consortium Target MJ0187' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2K8Y _struct_keywords.pdbx_keywords 'structural genomics, unknown function' _struct_keywords.text ;regulatory subunit of the Bud32 kinase, component of the KEOPS complex, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, unknown function ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 18 ? LEU A 23 ? ASN A 18 LEU A 23 1 ? 6 HELX_P HELX_P2 2 THR A 37 ? LYS A 51 ? THR A 37 LYS A 51 1 ? 15 HELX_P HELX_P3 3 SER A 57 ? ALA A 66 ? SER A 57 ALA A 66 1 ? 10 HELX_P HELX_P4 4 GLN A 71 ? GLY A 80 ? GLN A 71 GLY A 80 1 ? 10 HELX_P HELX_P5 5 ASP A 92 ? GLY A 104 ? ASP A 92 GLY A 104 1 ? 13 HELX_P HELX_P6 6 ASP A 109 ? GLU A 113 ? ASP A 109 GLU A 113 5 ? 5 HELX_P HELX_P7 7 ASN A 115 ? PHE A 126 ? ASN A 115 PHE A 126 1 ? 12 HELX_P HELX_P8 8 ASN A 133 ? GLU A 146 ? ASN A 133 GLU A 146 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 27 ? ASN A 31 ? PHE A 27 ASN A 31 A 2 GLY A 84 ? CYS A 90 ? GLY A 84 CYS A 90 A 3 ILE A 7 ? ALA A 14 ? ILE A 7 ALA A 14 A 4 GLU A 106 ? ILE A 107 ? GLU A 106 ILE A 107 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 30 ? N LEU A 30 O CYS A 87 ? O CYS A 87 A 2 3 O LEU A 88 ? O LEU A 88 N ARG A 9 ? N ARG A 9 A 3 4 N ARG A 12 ? N ARG A 12 O GLU A 106 ? O GLU A 106 # _atom_sites.entry_id 2K8Y _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 MET 3 3 3 MET MET A . n A 1 4 ASP 4 4 4 ASP ASP A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 MET 6 6 6 MET MET A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 PHE 21 21 21 PHE PHE A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 HIS 40 40 40 HIS HIS A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 HIS 43 43 43 HIS HIS A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 ASN 46 46 46 ASN ASN A . n A 1 47 GLN 47 47 47 GLN GLN A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 PHE 58 58 58 PHE PHE A . n A 1 59 TRP 59 59 59 TRP TRP A . n A 1 60 MET 60 60 60 MET MET A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 GLN 69 69 69 GLN GLN A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 HIS 73 73 73 HIS HIS A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 ALA 81 81 81 ALA ALA A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 ASN 85 85 85 ASN ASN A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 CYS 87 87 87 CYS CYS A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 CYS 90 90 90 CYS CYS A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 PHE 96 96 96 PHE PHE A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 ILE 99 99 99 ILE ILE A . n A 1 100 TYR 100 100 100 TYR TYR A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 ILE 103 103 103 ILE ILE A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 ILE 107 107 107 ILE ILE A . n A 1 108 ASP 108 108 108 ASP ASP A . n A 1 109 ASP 109 109 109 ASP ASP A . n A 1 110 SER 110 110 110 SER SER A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 GLU 113 113 113 GLU GLU A . n A 1 114 ILE 114 114 114 ILE ILE A . n A 1 115 ASN 115 115 115 ASN ASN A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 ASP 117 117 117 ASP ASP A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 GLU 119 119 119 GLU GLU A . n A 1 120 ARG 120 120 120 ARG ARG A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 ILE 122 122 122 ILE ILE A . n A 1 123 ARG 123 123 123 ARG ARG A . n A 1 124 GLU 124 124 124 GLU GLU A . n A 1 125 ILE 125 125 125 ILE ILE A . n A 1 126 PHE 126 126 126 PHE PHE A . n A 1 127 LYS 127 127 127 LYS LYS A . n A 1 128 ILE 128 128 128 ILE ILE A . n A 1 129 ARG 129 129 129 ARG ARG A . n A 1 130 GLY 130 130 130 GLY GLY A . n A 1 131 PHE 131 131 131 PHE PHE A . n A 1 132 GLY 132 132 132 GLY GLY A . n A 1 133 ASN 133 133 133 ASN ASN A . n A 1 134 VAL 134 134 134 VAL VAL A . n A 1 135 VAL 135 135 135 VAL VAL A . n A 1 136 GLU 136 136 136 GLU GLU A . n A 1 137 ARG 137 137 137 ARG ARG A . n A 1 138 VAL 138 138 138 VAL VAL A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 LYS 141 141 141 LYS LYS A . n A 1 142 ILE 142 142 142 ILE ILE A . n A 1 143 ALA 143 143 143 ALA ALA A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 ILE 145 145 145 ILE ILE A . n A 1 146 GLU 146 146 146 GLU GLU A . n A 1 147 LEU 147 147 147 LEU LEU A . n A 1 148 LYS 148 148 148 LYS LYS A . n A 1 149 LYS 149 149 149 LYS LYS A . n A 1 150 GLU 150 150 150 GLU GLU A . n # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-11-04 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_spectrometer 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_spectrometer.model' # _pdbx_nmr_exptl_sample.component protein _pdbx_nmr_exptl_sample.concentration 1 _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-100% 13C; U-100% 15N]' _pdbx_nmr_exptl_sample.solution_id 1 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 4 ? ? 57.24 74.36 2 1 ALA A 36 ? ? -76.10 -72.25 3 1 PRO A 53 ? ? -71.61 -81.68 4 1 ILE A 54 ? ? -150.67 11.22 5 1 GLN A 69 ? ? 57.37 96.94 6 1 ARG A 70 ? ? -121.18 -160.97 7 1 ILE A 114 ? ? 76.97 139.88 8 1 LYS A 127 ? ? 59.05 76.09 9 1 PHE A 131 ? ? -107.62 -169.72 10 1 LEU A 147 ? ? 81.59 18.79 11 1 LYS A 148 ? ? 171.91 128.20 12 1 LYS A 149 ? ? -77.46 35.83 13 2 ALA A 36 ? ? 59.79 -84.61 14 2 PRO A 53 ? ? -57.18 177.43 15 2 ILE A 114 ? ? 78.83 133.57 16 2 LYS A 127 ? ? 63.78 72.38 17 3 ASP A 4 ? ? 64.28 94.52 18 3 GLN A 69 ? ? 57.78 97.50 19 3 ARG A 70 ? ? -137.84 -158.11 20 3 ILE A 114 ? ? 78.71 131.46 21 3 LYS A 127 ? ? 66.13 82.53 22 3 LEU A 144 ? ? -66.89 3.97 23 3 LEU A 147 ? ? -85.76 31.74 24 3 LYS A 149 ? ? 66.99 76.18 25 4 ALA A 36 ? ? 58.29 -84.99 26 4 PRO A 53 ? ? -90.57 -115.26 27 4 ARG A 70 ? ? 66.58 -10.61 28 4 ILE A 114 ? ? 73.07 127.22 29 4 LYS A 127 ? ? 63.60 76.32 30 4 ARG A 129 ? ? -61.72 -90.82 31 4 PHE A 131 ? ? 67.00 101.21 32 4 LEU A 147 ? ? 81.36 67.30 33 5 ALA A 2 ? ? -162.49 118.23 34 5 ASP A 4 ? ? 60.10 91.68 35 5 PRO A 53 ? ? -85.19 -142.94 36 5 ILE A 114 ? ? 93.57 123.89 37 5 LYS A 127 ? ? 57.88 79.11 38 6 MET A 3 ? ? 115.29 12.79 39 6 ASP A 4 ? ? -166.01 68.24 40 6 ILE A 16 ? ? -69.02 92.41 41 6 PRO A 53 ? ? -68.41 -119.10 42 6 ILE A 114 ? ? 78.63 127.50 43 6 LYS A 127 ? ? 61.53 69.55 44 6 ARG A 129 ? ? -86.35 39.00 45 7 PRO A 53 ? ? -87.73 -78.98 46 7 ILE A 114 ? ? 77.74 138.21 47 7 LYS A 127 ? ? 63.84 75.86 48 7 LEU A 147 ? ? -170.73 -60.37 49 7 LYS A 148 ? ? 14.48 -145.00 50 8 PRO A 53 ? ? -57.23 -78.34 51 8 ARG A 70 ? ? -165.18 -34.06 52 8 ILE A 114 ? ? 84.82 135.64 53 8 LYS A 127 ? ? 62.03 66.60 54 8 LEU A 147 ? ? 71.27 49.79 55 9 PRO A 53 ? ? -79.15 -107.72 56 9 GLN A 69 ? ? 55.99 113.91 57 9 ILE A 114 ? ? 76.02 124.21 58 9 LYS A 127 ? ? 61.97 74.66 59 9 PHE A 131 ? ? -136.72 -61.58 60 9 GLU A 146 ? ? -93.91 -61.74 61 9 LEU A 147 ? ? -91.31 36.08 62 9 LYS A 149 ? ? -92.67 31.94 63 10 MET A 3 ? ? 95.97 21.57 64 10 ASP A 4 ? ? -153.61 81.59 65 10 ALA A 14 ? ? -67.80 94.37 66 10 ASN A 22 ? ? -91.35 47.05 67 10 THR A 37 ? ? 62.69 162.25 68 10 ILE A 54 ? ? -37.04 -22.07 69 10 ILE A 114 ? ? 76.15 138.88 70 10 LYS A 127 ? ? 63.42 75.51 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 7 _pdbx_validate_peptide_omega.auth_comp_id_1 LYS _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 148 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 LYS _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 149 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega 149.31 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 4 _pdbx_validate_planes.auth_comp_id ARG _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 70 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.085 _pdbx_validate_planes.type 'SIDE CHAIN' #