data_2K9X # _entry.id 2K9X # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2K9X pdb_00002k9x 10.2210/pdb2k9x/pdb RCSB RCSB100860 ? ? WWPDB D_1000100860 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-03-10 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 4 'Structure model' 1 3 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Database references' 3 3 'Structure model' 'Derived calculations' 4 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_struct_assembly 3 3 'Structure model' pdbx_struct_oper_list 4 3 'Structure model' struct_ref_seq_dif 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2K9X _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2008-10-27 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Zhang, W.' 1 'Zhang, J.' 2 'Xu, C.' 3 'Wang, T.' 4 'Zhang, X.' 5 'Tu, X.' 6 # _citation.id primary _citation.title 'Solution structure of Urm1 from Trypanosoma brucei' _citation.journal_abbrev Proteins _citation.journal_volume 75 _citation.page_first 781 _citation.page_last 785 _citation.year 2009 _citation.journal_id_ASTM PSFGEY _citation.country US _citation.journal_id_ISSN 0887-3585 _citation.journal_id_CSD 0867 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19241476 _citation.pdbx_database_id_DOI 10.1002/prot.22371 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhang, W.' 1 ? primary 'Zhang, J.' 2 ? primary 'Xu, C.' 3 ? primary 'Wang, T.' 4 ? primary 'Zhang, X.' 5 ? primary 'Tu, X.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Uncharacterized protein' _entity.formula_weight 12005.501 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name TbUrm1 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSNHNHITVQFAGGCELLFAKQTSLQLDGVVPTGTNLNGLVQLLKTNYVKERPDLLVDQTGQTLRPGILVLVNSCDAEVV GGMDYVLNDGDTVEFISTLHGGLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MSNHNHITVQFAGGCELLFAKQTSLQLDGVVPTGTNLNGLVQLLKTNYVKERPDLLVDQTGQTLRPGILVLVNSCDAEVV GGMDYVLNDGDTVEFISTLHGGLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 ASN n 1 4 HIS n 1 5 ASN n 1 6 HIS n 1 7 ILE n 1 8 THR n 1 9 VAL n 1 10 GLN n 1 11 PHE n 1 12 ALA n 1 13 GLY n 1 14 GLY n 1 15 CYS n 1 16 GLU n 1 17 LEU n 1 18 LEU n 1 19 PHE n 1 20 ALA n 1 21 LYS n 1 22 GLN n 1 23 THR n 1 24 SER n 1 25 LEU n 1 26 GLN n 1 27 LEU n 1 28 ASP n 1 29 GLY n 1 30 VAL n 1 31 VAL n 1 32 PRO n 1 33 THR n 1 34 GLY n 1 35 THR n 1 36 ASN n 1 37 LEU n 1 38 ASN n 1 39 GLY n 1 40 LEU n 1 41 VAL n 1 42 GLN n 1 43 LEU n 1 44 LEU n 1 45 LYS n 1 46 THR n 1 47 ASN n 1 48 TYR n 1 49 VAL n 1 50 LYS n 1 51 GLU n 1 52 ARG n 1 53 PRO n 1 54 ASP n 1 55 LEU n 1 56 LEU n 1 57 VAL n 1 58 ASP n 1 59 GLN n 1 60 THR n 1 61 GLY n 1 62 GLN n 1 63 THR n 1 64 LEU n 1 65 ARG n 1 66 PRO n 1 67 GLY n 1 68 ILE n 1 69 LEU n 1 70 VAL n 1 71 LEU n 1 72 VAL n 1 73 ASN n 1 74 SER n 1 75 CYS n 1 76 ASP n 1 77 ALA n 1 78 GLU n 1 79 VAL n 1 80 VAL n 1 81 GLY n 1 82 GLY n 1 83 MET n 1 84 ASP n 1 85 TYR n 1 86 VAL n 1 87 LEU n 1 88 ASN n 1 89 ASP n 1 90 GLY n 1 91 ASP n 1 92 THR n 1 93 VAL n 1 94 GLU n 1 95 PHE n 1 96 ILE n 1 97 SER n 1 98 THR n 1 99 LEU n 1 100 HIS n 1 101 GLY n 1 102 GLY n 1 103 LEU n 1 104 GLU n 1 105 HIS n 1 106 HIS n 1 107 HIS n 1 108 HIS n 1 109 HIS n 1 110 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Tb927.4.1830 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Trypanosoma brucei' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 5691 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET22b(+)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 HIS 4 4 4 HIS HIS A . n A 1 5 ASN 5 5 5 ASN ASN A . n A 1 6 HIS 6 6 6 HIS HIS A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 ALA 20 20 21 ALA ALA A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 ASN 36 36 36 ASN ASN A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 ASN 47 47 47 ASN ASN A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 GLN 59 59 59 GLN GLN A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 PRO 66 66 66 PRO PRO A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 ASN 73 73 73 ASN ASN A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 CYS 75 75 75 CYS CYS A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 MET 83 83 83 MET MET A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 TYR 85 85 85 TYR TYR A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 ASN 88 88 88 ASN ASN A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 THR 92 92 92 THR THR A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 PHE 95 95 95 PHE PHE A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 SER 97 97 97 SER SER A . n A 1 98 THR 98 98 98 THR THR A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 HIS 100 100 100 HIS HIS A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 LEU 103 103 ? ? ? A . n A 1 104 GLU 104 104 ? ? ? A . n A 1 105 HIS 105 105 ? ? ? A . n A 1 106 HIS 106 106 ? ? ? A . n A 1 107 HIS 107 107 ? ? ? A . n A 1 108 HIS 108 108 ? ? ? A . n A 1 109 HIS 109 109 ? ? ? A . n A 1 110 HIS 110 110 ? ? ? A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2K9X _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2K9X _struct.title 'Solution structure of Urm1 from Trypanosoma brucei' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2K9X _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' _struct_keywords.text 'TbUrm1, UNKNOWN FUNCTION' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q583L0_9TRYP _struct_ref.pdbx_db_accession Q583L0 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSNHNHITVQFAGGCELLFAKQTSLQLDGVVPTGTNLNGLVQLLKTNYVKERPDLLVDQTGQTLRPGILVLVNSCDAEVV GGMDYVLNDGDTVEFISTLHGG ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2K9X _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 102 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q583L0 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 102 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 102 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2K9X LEU A 103 ? UNP Q583L0 ? ? 'expression tag' 103 1 1 2K9X GLU A 104 ? UNP Q583L0 ? ? 'expression tag' 104 2 1 2K9X HIS A 105 ? UNP Q583L0 ? ? 'expression tag' 105 3 1 2K9X HIS A 106 ? UNP Q583L0 ? ? 'expression tag' 106 4 1 2K9X HIS A 107 ? UNP Q583L0 ? ? 'expression tag' 107 5 1 2K9X HIS A 108 ? UNP Q583L0 ? ? 'expression tag' 108 6 1 2K9X HIS A 109 ? UNP Q583L0 ? ? 'expression tag' 109 7 1 2K9X HIS A 110 ? UNP Q583L0 ? ? 'expression tag' 110 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 VAL A 31 ? THR A 35 ? VAL A 31 THR A 35 5 ? 5 HELX_P HELX_P2 2 ASN A 36 ? LYS A 45 ? ASN A 36 LYS A 45 1 ? 10 HELX_P HELX_P3 3 ARG A 52 ? VAL A 57 ? ARG A 52 VAL A 57 1 ? 6 HELX_P HELX_P4 4 ASP A 76 ? GLY A 81 ? ASP A 76 GLY A 81 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 24 ? LEU A 25 ? SER A 24 LEU A 25 A 2 THR A 8 ? ALA A 12 ? THR A 8 ALA A 12 A 3 THR A 92 ? SER A 97 ? THR A 92 SER A 97 A 4 ILE A 68 ? VAL A 72 ? ILE A 68 VAL A 72 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O LEU A 25 ? O LEU A 25 N VAL A 9 ? N VAL A 9 A 2 3 N THR A 8 ? N THR A 8 O VAL A 93 ? O VAL A 93 A 3 4 O ILE A 96 ? O ILE A 96 N LEU A 69 ? N LEU A 69 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 13 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 LEU _pdbx_validate_close_contact.auth_seq_id_1 56 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 H _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 ARG _pdbx_validate_close_contact.auth_seq_id_2 65 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.57 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? -164.65 42.42 2 1 ASN A 5 ? ? 64.54 -85.23 3 1 HIS A 6 ? ? 68.19 140.77 4 1 PHE A 19 ? ? -147.32 -62.37 5 1 ALA A 20 ? ? -176.70 36.28 6 1 VAL A 30 ? ? -141.39 -47.36 7 1 LYS A 45 ? ? -92.36 -60.86 8 1 TYR A 48 ? ? -135.59 -75.04 9 1 VAL A 49 ? ? 40.41 89.58 10 1 GLN A 59 ? ? -176.52 -43.00 11 1 MET A 83 ? ? -142.50 23.74 12 1 ASP A 84 ? ? -140.35 26.75 13 1 ASN A 88 ? ? -158.21 31.16 14 1 ASP A 89 ? ? 69.60 120.62 15 1 THR A 98 ? ? -132.30 -50.36 16 2 HIS A 4 ? ? -158.44 82.07 17 2 HIS A 6 ? ? 179.35 153.44 18 2 PHE A 19 ? ? -143.07 -66.50 19 2 ALA A 20 ? ? -175.78 36.48 20 2 THR A 23 ? ? -112.11 -74.55 21 2 VAL A 30 ? ? 72.88 -63.51 22 2 TYR A 48 ? ? -146.43 -62.83 23 2 VAL A 49 ? ? 42.91 86.07 24 2 GLU A 51 ? ? -91.61 -156.23 25 2 GLN A 59 ? ? -171.08 -43.74 26 2 ASP A 84 ? ? -142.74 27.06 27 2 ASN A 88 ? ? -146.13 33.50 28 3 SER A 2 ? ? 63.96 -171.67 29 3 HIS A 6 ? ? -174.56 105.69 30 3 ALA A 12 ? ? -175.17 119.51 31 3 PHE A 19 ? ? -149.39 -63.58 32 3 ALA A 20 ? ? -174.84 38.40 33 3 THR A 23 ? ? -107.69 -74.65 34 3 LYS A 45 ? ? -84.16 -70.91 35 3 TYR A 48 ? ? -147.84 50.17 36 3 GLU A 51 ? ? -160.21 -161.79 37 3 GLN A 59 ? ? -162.96 -56.42 38 3 ASP A 76 ? ? 69.05 145.28 39 3 MET A 83 ? ? -157.69 27.94 40 3 ASN A 88 ? ? -155.23 -59.72 41 3 ASP A 89 ? ? -173.03 116.09 42 4 ASN A 3 ? ? -148.77 -58.81 43 4 HIS A 4 ? ? 63.73 -174.24 44 4 PHE A 19 ? ? -148.46 -59.11 45 4 ALA A 20 ? ? -178.67 36.49 46 4 VAL A 30 ? ? 69.60 -68.24 47 4 VAL A 31 ? ? -154.04 63.78 48 4 LYS A 45 ? ? -92.49 -61.05 49 4 TYR A 48 ? ? -146.63 48.45 50 4 GLN A 59 ? ? -175.08 -43.16 51 4 THR A 63 ? ? -118.74 -167.78 52 4 ASP A 84 ? ? -149.52 30.51 53 4 ASN A 88 ? ? -160.96 -82.77 54 4 ASP A 89 ? ? -173.91 33.57 55 4 THR A 98 ? ? -126.26 -61.84 56 4 HIS A 100 ? ? -155.13 72.29 57 5 SER A 2 ? ? 69.88 165.09 58 5 ASN A 5 ? ? 72.51 133.07 59 5 HIS A 6 ? ? -171.94 124.32 60 5 PHE A 19 ? ? -145.11 -64.11 61 5 ALA A 20 ? ? -175.59 38.80 62 5 THR A 23 ? ? -114.09 -80.06 63 5 VAL A 30 ? ? 36.25 83.77 64 5 THR A 33 ? ? -126.59 -59.23 65 5 GLN A 59 ? ? -171.59 -43.70 66 5 MET A 83 ? ? -157.42 29.35 67 5 ASP A 84 ? ? -145.84 22.11 68 5 ASP A 89 ? ? -57.23 103.08 69 5 LEU A 99 ? ? 51.56 -174.72 70 6 ASN A 5 ? ? 69.77 142.05 71 6 HIS A 6 ? ? 63.86 176.60 72 6 PHE A 19 ? ? -133.09 -60.01 73 6 ALA A 20 ? ? 174.27 36.07 74 6 THR A 23 ? ? -101.93 -74.24 75 6 LYS A 45 ? ? -89.33 -72.80 76 6 LYS A 50 ? ? -132.01 -40.48 77 6 GLU A 51 ? ? -79.94 -167.03 78 6 GLN A 59 ? ? -173.83 -43.91 79 6 ASP A 89 ? ? -56.73 108.32 80 6 THR A 98 ? ? -155.29 -46.68 81 7 HIS A 4 ? ? 69.49 166.47 82 7 PHE A 19 ? ? -147.91 -66.16 83 7 ALA A 20 ? ? -172.35 38.74 84 7 THR A 23 ? ? -91.06 -69.54 85 7 LYS A 45 ? ? -81.99 -70.18 86 7 TYR A 48 ? ? -142.45 58.73 87 7 LYS A 50 ? ? 73.32 -55.95 88 7 GLN A 59 ? ? -174.39 -44.68 89 7 ASN A 88 ? ? -156.85 32.90 90 7 ASP A 89 ? ? 64.66 111.39 91 7 THR A 98 ? ? -150.33 -63.78 92 8 ASN A 5 ? ? 82.84 -26.15 93 8 ALA A 12 ? ? -167.40 113.18 94 8 PHE A 19 ? ? -146.98 -63.56 95 8 ALA A 20 ? ? -175.94 36.78 96 8 VAL A 30 ? ? -132.56 -47.62 97 8 TYR A 48 ? ? -130.95 -71.56 98 8 VAL A 49 ? ? 34.49 89.04 99 8 GLN A 59 ? ? -172.44 -44.87 100 8 ASN A 88 ? ? -147.90 30.52 101 8 ASP A 89 ? ? 59.48 95.99 102 8 THR A 98 ? ? -137.58 -58.36 103 8 HIS A 100 ? ? -139.87 -65.15 104 9 SER A 2 ? ? -164.39 97.94 105 9 HIS A 4 ? ? 47.92 -169.66 106 9 PHE A 19 ? ? -153.57 -58.49 107 9 ALA A 20 ? ? -179.27 36.37 108 9 THR A 23 ? ? -88.14 -70.66 109 9 TYR A 48 ? ? -150.23 54.42 110 9 LYS A 50 ? ? 67.86 -59.06 111 9 GLU A 51 ? ? -73.22 -168.55 112 9 GLN A 59 ? ? -168.85 -44.66 113 9 MET A 83 ? ? -144.11 25.51 114 9 ASP A 84 ? ? -140.48 23.59 115 9 ASN A 88 ? ? -134.69 -64.78 116 9 THR A 98 ? ? -139.79 -55.25 117 10 HIS A 4 ? ? 72.99 135.42 118 10 PHE A 19 ? ? -143.07 -61.92 119 10 ALA A 20 ? ? -178.81 36.37 120 10 THR A 23 ? ? -102.46 -75.82 121 10 VAL A 31 ? ? -155.63 76.09 122 10 TYR A 48 ? ? -148.06 48.21 123 10 GLN A 59 ? ? -166.91 -48.95 124 10 ASN A 73 ? ? 64.23 -78.57 125 10 SER A 74 ? ? -151.55 32.01 126 10 ASN A 88 ? ? -168.33 43.58 127 10 ASP A 89 ? ? 64.36 96.43 128 10 THR A 98 ? ? -126.14 -50.95 129 11 SER A 2 ? ? 68.51 149.03 130 11 ASN A 3 ? ? -162.86 48.65 131 11 HIS A 6 ? ? -167.86 102.47 132 11 PHE A 19 ? ? -146.73 -61.94 133 11 ALA A 20 ? ? -178.07 36.34 134 11 VAL A 30 ? ? -137.12 -47.84 135 11 TYR A 48 ? ? -127.89 -68.26 136 11 VAL A 49 ? ? 37.77 66.88 137 11 GLN A 59 ? ? -169.93 -45.03 138 11 ASP A 84 ? ? -147.10 24.92 139 11 ASN A 88 ? ? -165.30 42.55 140 11 ASP A 89 ? ? 54.35 88.52 141 12 HIS A 6 ? ? -175.36 104.68 142 12 PHE A 19 ? ? -146.74 -61.80 143 12 ALA A 20 ? ? -177.31 36.93 144 12 TYR A 48 ? ? -123.88 -75.77 145 12 VAL A 49 ? ? 33.52 58.03 146 12 ARG A 52 ? ? -48.68 106.97 147 12 GLN A 59 ? ? -172.30 -45.32 148 12 ASP A 84 ? ? -150.20 29.86 149 12 ASN A 88 ? ? -158.40 36.84 150 12 ASP A 89 ? ? 61.17 93.13 151 13 HIS A 6 ? ? -176.91 137.93 152 13 PHE A 19 ? ? -147.99 -64.42 153 13 ALA A 20 ? ? -172.34 37.85 154 13 THR A 23 ? ? -101.49 -71.88 155 13 VAL A 30 ? ? -125.75 -56.53 156 13 VAL A 31 ? ? -151.15 62.62 157 13 LYS A 45 ? ? -87.31 -70.79 158 13 TYR A 48 ? ? -152.66 57.90 159 13 LYS A 50 ? ? -94.80 48.74 160 13 GLU A 51 ? ? -177.79 -175.11 161 13 GLN A 59 ? ? -171.15 -44.60 162 13 ASN A 88 ? ? -168.86 -62.18 163 13 ASP A 89 ? ? -178.91 108.15 164 13 THR A 98 ? ? -129.43 -54.43 165 14 ASN A 5 ? ? 69.21 162.66 166 14 HIS A 6 ? ? 63.83 -175.57 167 14 PHE A 19 ? ? -144.24 -65.97 168 14 ALA A 20 ? ? -172.19 40.00 169 14 LYS A 45 ? ? -87.64 -71.07 170 14 TYR A 48 ? ? -140.62 57.26 171 14 GLN A 59 ? ? -171.78 -43.92 172 14 CYS A 75 ? ? -141.32 -79.38 173 14 ASP A 76 ? ? 177.49 132.29 174 14 MET A 83 ? ? -142.92 21.72 175 14 ASN A 88 ? ? -161.02 30.33 176 14 ASP A 89 ? ? 58.97 103.93 177 14 THR A 98 ? ? -161.78 -41.54 178 14 LEU A 99 ? ? 51.49 -174.25 179 15 HIS A 4 ? ? 60.38 84.06 180 15 HIS A 6 ? ? -175.74 138.64 181 15 PHE A 19 ? ? -153.76 -60.80 182 15 ALA A 20 ? ? -177.40 37.49 183 15 TYR A 48 ? ? -155.58 55.01 184 15 LYS A 50 ? ? 57.79 13.48 185 15 GLN A 59 ? ? -174.22 -44.65 186 15 MET A 83 ? ? -148.52 27.51 187 15 ASN A 88 ? ? -154.16 36.16 188 15 THR A 98 ? ? -135.33 -50.26 189 16 ASN A 3 ? ? -170.17 95.55 190 16 HIS A 6 ? ? -175.17 115.02 191 16 PHE A 19 ? ? -148.18 -70.83 192 16 ALA A 20 ? ? -170.98 38.18 193 16 THR A 23 ? ? -107.12 -76.89 194 16 TYR A 48 ? ? -150.21 59.74 195 16 GLN A 59 ? ? -177.15 -43.84 196 16 CYS A 75 ? ? -130.04 -48.57 197 16 ASP A 76 ? ? 172.28 140.60 198 16 MET A 83 ? ? -152.89 26.99 199 16 THR A 98 ? ? -123.25 -54.07 200 17 HIS A 6 ? ? 71.52 124.73 201 17 PHE A 19 ? ? -149.58 -63.73 202 17 ALA A 20 ? ? -174.37 37.97 203 17 THR A 23 ? ? -115.70 -78.17 204 17 LYS A 45 ? ? -84.00 -71.69 205 17 TYR A 48 ? ? -142.25 51.60 206 17 GLN A 59 ? ? -177.43 -45.50 207 17 ASN A 88 ? ? -153.54 35.77 208 17 ASP A 89 ? ? 59.93 96.39 209 17 THR A 98 ? ? -142.34 -55.53 210 18 HIS A 4 ? ? 64.70 99.26 211 18 PHE A 19 ? ? -144.28 -64.51 212 18 ALA A 20 ? ? -174.64 38.66 213 18 THR A 33 ? ? -151.09 -53.68 214 18 LYS A 45 ? ? -83.95 -71.26 215 18 TYR A 48 ? ? -142.42 50.38 216 18 ARG A 52 ? ? -49.99 106.00 217 18 GLN A 59 ? ? -165.22 -45.36 218 18 ASN A 73 ? ? 67.03 -77.15 219 18 SER A 74 ? ? -153.32 33.70 220 18 ASP A 89 ? ? 63.10 104.83 221 18 THR A 98 ? ? -134.99 -48.84 222 19 HIS A 4 ? ? -157.59 31.81 223 19 HIS A 6 ? ? 179.07 172.51 224 19 PHE A 19 ? ? -144.95 -63.63 225 19 ALA A 20 ? ? -178.22 36.17 226 19 THR A 35 ? ? -117.74 -158.14 227 19 TYR A 48 ? ? -130.80 -68.32 228 19 VAL A 49 ? ? 44.72 72.31 229 19 GLN A 59 ? ? -173.76 -44.51 230 19 MET A 83 ? ? -147.63 25.13 231 19 ASP A 84 ? ? -148.74 25.40 232 19 ASP A 89 ? ? -64.45 96.16 233 20 SER A 2 ? ? -166.98 108.26 234 20 HIS A 4 ? ? 64.17 175.71 235 20 HIS A 6 ? ? 72.60 123.27 236 20 PHE A 19 ? ? -149.92 -65.11 237 20 ALA A 20 ? ? -172.09 39.14 238 20 THR A 23 ? ? -109.96 -77.42 239 20 TYR A 48 ? ? -150.24 59.76 240 20 GLN A 59 ? ? -168.47 -44.47 241 20 THR A 63 ? ? -110.77 -167.12 242 20 CYS A 75 ? ? -141.89 37.55 243 20 ASP A 76 ? ? 67.37 134.59 244 20 ASN A 88 ? ? -135.01 -67.06 245 20 ASP A 89 ? ? -178.52 79.40 246 20 THR A 98 ? ? -136.56 -53.18 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2K9X _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2K9X _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '0.8mM [U-13C; U-15N] TbUrm1, 1.5mM DTT, 50mM sodium phosphate, 100mM sodium chloride, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '0.8mM [U-13C; U-15N] TbUrm1, 1.5mM DTT, 50mM sodium phosphate, 100mM sodium chloride, 100% D2O' 2 '100% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id TbUrm1 0.8 mM '[U-13C; U-15N]' 1 DTT 1.5 mM ? 1 'sodium phosphate' 50 mM ? 1 'sodium chloride' 100 mM ? 1 TbUrm1 0.8 mM '[U-13C; U-15N]' 2 DTT 1.5 mM ? 2 'sodium phosphate' 50 mM ? 2 'sodium chloride' 100 mM ? 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D CBCA(CO)NH' 1 3 1 '3D C(CO)NH' 1 4 1 '3D HNCO' 1 5 1 '3D HNCA' 1 6 1 '3D HNCACB' 1 7 1 '3D HBHA(CO)NH' 1 8 2 '3D HCCH-TOCSY' 1 9 2 '3D HCCH-COSY' 1 10 2 '3D 1H-13C NOESY' # _pdbx_nmr_refine.entry_id 2K9X _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges, Read' 'structure solution' CNS ? 1 'Brunger, Adams, Clore, Gros, Nilges, Read' refinement CNS ? 2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LEU 103 ? A LEU 103 2 1 Y 1 A GLU 104 ? A GLU 104 3 1 Y 1 A HIS 105 ? A HIS 105 4 1 Y 1 A HIS 106 ? A HIS 106 5 1 Y 1 A HIS 107 ? A HIS 107 6 1 Y 1 A HIS 108 ? A HIS 108 7 1 Y 1 A HIS 109 ? A HIS 109 8 1 Y 1 A HIS 110 ? A HIS 110 9 2 Y 1 A LEU 103 ? A LEU 103 10 2 Y 1 A GLU 104 ? A GLU 104 11 2 Y 1 A HIS 105 ? A HIS 105 12 2 Y 1 A HIS 106 ? A HIS 106 13 2 Y 1 A HIS 107 ? A HIS 107 14 2 Y 1 A HIS 108 ? A HIS 108 15 2 Y 1 A HIS 109 ? A HIS 109 16 2 Y 1 A HIS 110 ? A HIS 110 17 3 Y 1 A LEU 103 ? A LEU 103 18 3 Y 1 A GLU 104 ? A GLU 104 19 3 Y 1 A HIS 105 ? A HIS 105 20 3 Y 1 A HIS 106 ? A HIS 106 21 3 Y 1 A HIS 107 ? A HIS 107 22 3 Y 1 A HIS 108 ? A HIS 108 23 3 Y 1 A HIS 109 ? A HIS 109 24 3 Y 1 A HIS 110 ? A HIS 110 25 4 Y 1 A LEU 103 ? A LEU 103 26 4 Y 1 A GLU 104 ? A GLU 104 27 4 Y 1 A HIS 105 ? A HIS 105 28 4 Y 1 A HIS 106 ? A HIS 106 29 4 Y 1 A HIS 107 ? A HIS 107 30 4 Y 1 A HIS 108 ? A HIS 108 31 4 Y 1 A HIS 109 ? A HIS 109 32 4 Y 1 A HIS 110 ? A HIS 110 33 5 Y 1 A LEU 103 ? A LEU 103 34 5 Y 1 A GLU 104 ? A GLU 104 35 5 Y 1 A HIS 105 ? A HIS 105 36 5 Y 1 A HIS 106 ? A HIS 106 37 5 Y 1 A HIS 107 ? A HIS 107 38 5 Y 1 A HIS 108 ? A HIS 108 39 5 Y 1 A HIS 109 ? A HIS 109 40 5 Y 1 A HIS 110 ? A HIS 110 41 6 Y 1 A LEU 103 ? A LEU 103 42 6 Y 1 A GLU 104 ? A GLU 104 43 6 Y 1 A HIS 105 ? A HIS 105 44 6 Y 1 A HIS 106 ? A HIS 106 45 6 Y 1 A HIS 107 ? A HIS 107 46 6 Y 1 A HIS 108 ? A HIS 108 47 6 Y 1 A HIS 109 ? A HIS 109 48 6 Y 1 A HIS 110 ? A HIS 110 49 7 Y 1 A LEU 103 ? A LEU 103 50 7 Y 1 A GLU 104 ? A GLU 104 51 7 Y 1 A HIS 105 ? A HIS 105 52 7 Y 1 A HIS 106 ? A HIS 106 53 7 Y 1 A HIS 107 ? A HIS 107 54 7 Y 1 A HIS 108 ? A HIS 108 55 7 Y 1 A HIS 109 ? A HIS 109 56 7 Y 1 A HIS 110 ? A HIS 110 57 8 Y 1 A LEU 103 ? A LEU 103 58 8 Y 1 A GLU 104 ? A GLU 104 59 8 Y 1 A HIS 105 ? A HIS 105 60 8 Y 1 A HIS 106 ? A HIS 106 61 8 Y 1 A HIS 107 ? A HIS 107 62 8 Y 1 A HIS 108 ? A HIS 108 63 8 Y 1 A HIS 109 ? A HIS 109 64 8 Y 1 A HIS 110 ? A HIS 110 65 9 Y 1 A LEU 103 ? A LEU 103 66 9 Y 1 A GLU 104 ? A GLU 104 67 9 Y 1 A HIS 105 ? A HIS 105 68 9 Y 1 A HIS 106 ? A HIS 106 69 9 Y 1 A HIS 107 ? A HIS 107 70 9 Y 1 A HIS 108 ? A HIS 108 71 9 Y 1 A HIS 109 ? A HIS 109 72 9 Y 1 A HIS 110 ? A HIS 110 73 10 Y 1 A LEU 103 ? A LEU 103 74 10 Y 1 A GLU 104 ? A GLU 104 75 10 Y 1 A HIS 105 ? A HIS 105 76 10 Y 1 A HIS 106 ? A HIS 106 77 10 Y 1 A HIS 107 ? A HIS 107 78 10 Y 1 A HIS 108 ? A HIS 108 79 10 Y 1 A HIS 109 ? A HIS 109 80 10 Y 1 A HIS 110 ? A HIS 110 81 11 Y 1 A LEU 103 ? A LEU 103 82 11 Y 1 A GLU 104 ? A GLU 104 83 11 Y 1 A HIS 105 ? A HIS 105 84 11 Y 1 A HIS 106 ? A HIS 106 85 11 Y 1 A HIS 107 ? A HIS 107 86 11 Y 1 A HIS 108 ? A HIS 108 87 11 Y 1 A HIS 109 ? A HIS 109 88 11 Y 1 A HIS 110 ? A HIS 110 89 12 Y 1 A LEU 103 ? A LEU 103 90 12 Y 1 A GLU 104 ? A GLU 104 91 12 Y 1 A HIS 105 ? A HIS 105 92 12 Y 1 A HIS 106 ? A HIS 106 93 12 Y 1 A HIS 107 ? A HIS 107 94 12 Y 1 A HIS 108 ? A HIS 108 95 12 Y 1 A HIS 109 ? A HIS 109 96 12 Y 1 A HIS 110 ? A HIS 110 97 13 Y 1 A LEU 103 ? A LEU 103 98 13 Y 1 A GLU 104 ? A GLU 104 99 13 Y 1 A HIS 105 ? A HIS 105 100 13 Y 1 A HIS 106 ? A HIS 106 101 13 Y 1 A HIS 107 ? A HIS 107 102 13 Y 1 A HIS 108 ? A HIS 108 103 13 Y 1 A HIS 109 ? A HIS 109 104 13 Y 1 A HIS 110 ? A HIS 110 105 14 Y 1 A LEU 103 ? A LEU 103 106 14 Y 1 A GLU 104 ? A GLU 104 107 14 Y 1 A HIS 105 ? A HIS 105 108 14 Y 1 A HIS 106 ? A HIS 106 109 14 Y 1 A HIS 107 ? A HIS 107 110 14 Y 1 A HIS 108 ? A HIS 108 111 14 Y 1 A HIS 109 ? A HIS 109 112 14 Y 1 A HIS 110 ? A HIS 110 113 15 Y 1 A LEU 103 ? A LEU 103 114 15 Y 1 A GLU 104 ? A GLU 104 115 15 Y 1 A HIS 105 ? A HIS 105 116 15 Y 1 A HIS 106 ? A HIS 106 117 15 Y 1 A HIS 107 ? A HIS 107 118 15 Y 1 A HIS 108 ? A HIS 108 119 15 Y 1 A HIS 109 ? A HIS 109 120 15 Y 1 A HIS 110 ? A HIS 110 121 16 Y 1 A LEU 103 ? A LEU 103 122 16 Y 1 A GLU 104 ? A GLU 104 123 16 Y 1 A HIS 105 ? A HIS 105 124 16 Y 1 A HIS 106 ? A HIS 106 125 16 Y 1 A HIS 107 ? A HIS 107 126 16 Y 1 A HIS 108 ? A HIS 108 127 16 Y 1 A HIS 109 ? A HIS 109 128 16 Y 1 A HIS 110 ? A HIS 110 129 17 Y 1 A LEU 103 ? A LEU 103 130 17 Y 1 A GLU 104 ? A GLU 104 131 17 Y 1 A HIS 105 ? A HIS 105 132 17 Y 1 A HIS 106 ? A HIS 106 133 17 Y 1 A HIS 107 ? A HIS 107 134 17 Y 1 A HIS 108 ? A HIS 108 135 17 Y 1 A HIS 109 ? A HIS 109 136 17 Y 1 A HIS 110 ? A HIS 110 137 18 Y 1 A LEU 103 ? A LEU 103 138 18 Y 1 A GLU 104 ? A GLU 104 139 18 Y 1 A HIS 105 ? A HIS 105 140 18 Y 1 A HIS 106 ? A HIS 106 141 18 Y 1 A HIS 107 ? A HIS 107 142 18 Y 1 A HIS 108 ? A HIS 108 143 18 Y 1 A HIS 109 ? A HIS 109 144 18 Y 1 A HIS 110 ? A HIS 110 145 19 Y 1 A LEU 103 ? A LEU 103 146 19 Y 1 A GLU 104 ? A GLU 104 147 19 Y 1 A HIS 105 ? A HIS 105 148 19 Y 1 A HIS 106 ? A HIS 106 149 19 Y 1 A HIS 107 ? A HIS 107 150 19 Y 1 A HIS 108 ? A HIS 108 151 19 Y 1 A HIS 109 ? A HIS 109 152 19 Y 1 A HIS 110 ? A HIS 110 153 20 Y 1 A LEU 103 ? A LEU 103 154 20 Y 1 A GLU 104 ? A GLU 104 155 20 Y 1 A HIS 105 ? A HIS 105 156 20 Y 1 A HIS 106 ? A HIS 106 157 20 Y 1 A HIS 107 ? A HIS 107 158 20 Y 1 A HIS 108 ? A HIS 108 159 20 Y 1 A HIS 109 ? A HIS 109 160 20 Y 1 A HIS 110 ? A HIS 110 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TYR N N N N 318 TYR CA C N S 319 TYR C C N N 320 TYR O O N N 321 TYR CB C N N 322 TYR CG C Y N 323 TYR CD1 C Y N 324 TYR CD2 C Y N 325 TYR CE1 C Y N 326 TYR CE2 C Y N 327 TYR CZ C Y N 328 TYR OH O N N 329 TYR OXT O N N 330 TYR H H N N 331 TYR H2 H N N 332 TYR HA H N N 333 TYR HB2 H N N 334 TYR HB3 H N N 335 TYR HD1 H N N 336 TYR HD2 H N N 337 TYR HE1 H N N 338 TYR HE2 H N N 339 TYR HH H N N 340 TYR HXT H N N 341 VAL N N N N 342 VAL CA C N S 343 VAL C C N N 344 VAL O O N N 345 VAL CB C N N 346 VAL CG1 C N N 347 VAL CG2 C N N 348 VAL OXT O N N 349 VAL H H N N 350 VAL H2 H N N 351 VAL HA H N N 352 VAL HB H N N 353 VAL HG11 H N N 354 VAL HG12 H N N 355 VAL HG13 H N N 356 VAL HG21 H N N 357 VAL HG22 H N N 358 VAL HG23 H N N 359 VAL HXT H N N 360 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TYR N CA sing N N 304 TYR N H sing N N 305 TYR N H2 sing N N 306 TYR CA C sing N N 307 TYR CA CB sing N N 308 TYR CA HA sing N N 309 TYR C O doub N N 310 TYR C OXT sing N N 311 TYR CB CG sing N N 312 TYR CB HB2 sing N N 313 TYR CB HB3 sing N N 314 TYR CG CD1 doub Y N 315 TYR CG CD2 sing Y N 316 TYR CD1 CE1 sing Y N 317 TYR CD1 HD1 sing N N 318 TYR CD2 CE2 doub Y N 319 TYR CD2 HD2 sing N N 320 TYR CE1 CZ doub Y N 321 TYR CE1 HE1 sing N N 322 TYR CE2 CZ sing Y N 323 TYR CE2 HE2 sing N N 324 TYR CZ OH sing N N 325 TYR OH HH sing N N 326 TYR OXT HXT sing N N 327 VAL N CA sing N N 328 VAL N H sing N N 329 VAL N H2 sing N N 330 VAL CA C sing N N 331 VAL CA CB sing N N 332 VAL CA HA sing N N 333 VAL C O doub N N 334 VAL C OXT sing N N 335 VAL CB CG1 sing N N 336 VAL CB CG2 sing N N 337 VAL CB HB sing N N 338 VAL CG1 HG11 sing N N 339 VAL CG1 HG12 sing N N 340 VAL CG1 HG13 sing N N 341 VAL CG2 HG21 sing N N 342 VAL CG2 HG22 sing N N 343 VAL CG2 HG23 sing N N 344 VAL OXT HXT sing N N 345 # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DMX _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker DMX' # _atom_sites.entry_id 2K9X _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_