data_2KCM # _entry.id 2KCM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KCM pdb_00002kcm 10.2210/pdb2kcm/pdb RCSB RCSB100953 ? ? BMRB 16086 ? 10.13018/BMR16086 WWPDB D_1000100953 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-02-10 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2024-05-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Source and taxonomy' 2 2 'Structure model' 'Version format compliance' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' chem_comp_atom 2 3 'Structure model' chem_comp_bond 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_nmr_software 5 3 'Structure model' pdbx_nmr_spectrometer 6 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KCM _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2008-12-23 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 16086 BMRB unspecified . SoR210A TargetDB unspecified . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ramelot, T.A.' 1 'Maglaqui, M.' 2 'Jiang, M.' 3 'Ciccosanti, C.' 4 'Xiao, R.' 5 'Lui, J.' 6 'Everett, J.K.' 7 'Swapna, G.' 8 'Acton, T.B.' 9 'Rost, B.' 10 'Montelione, G.T.' 11 'Kennedy, M.A.' 12 'Northeast Structural Genomics Consortium (NESG)' 13 # _citation.id primary _citation.title ;Solution NMR structure of the N-terminal OB-domain of SO_1732 from Shewanella oneidensis. Northeast Structural Genomics Consortium Target SoR210A. ; _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kennedy, M.A.' 1 ? primary 'Ramelot, T.A.' 2 ? primary 'Ding, K.' 3 ? primary 'Maglaqui, M.' 4 ? primary 'Jiang, M.' 5 ? primary 'Ciccosanti, C.' 6 ? primary 'Xiao, R.' 7 ? primary 'Lui, J.' 8 ? primary 'Everett, J.K.' 9 ? primary 'Swapna, G.' 10 ? primary 'Acton, T.B.' 11 ? primary 'Rost, B.' 12 ? primary 'Montelione, G.T.' 13 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Cold shock domain family protein' _entity.formula_weight 8284.524 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP residues 1-66' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MKGKVVSYLAAKKYGFIQGDDGESYFLHFSELLDKKDEGKLVKGSMVHFDPTPTPKGLAAKAISLPLEHHHHHH _entity_poly.pdbx_seq_one_letter_code_can MKGKVVSYLAAKKYGFIQGDDGESYFLHFSELLDKKDEGKLVKGSMVHFDPTPTPKGLAAKAISLPLEHHHHHH _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier SoR210A # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 GLY n 1 4 LYS n 1 5 VAL n 1 6 VAL n 1 7 SER n 1 8 TYR n 1 9 LEU n 1 10 ALA n 1 11 ALA n 1 12 LYS n 1 13 LYS n 1 14 TYR n 1 15 GLY n 1 16 PHE n 1 17 ILE n 1 18 GLN n 1 19 GLY n 1 20 ASP n 1 21 ASP n 1 22 GLY n 1 23 GLU n 1 24 SER n 1 25 TYR n 1 26 PHE n 1 27 LEU n 1 28 HIS n 1 29 PHE n 1 30 SER n 1 31 GLU n 1 32 LEU n 1 33 LEU n 1 34 ASP n 1 35 LYS n 1 36 LYS n 1 37 ASP n 1 38 GLU n 1 39 GLY n 1 40 LYS n 1 41 LEU n 1 42 VAL n 1 43 LYS n 1 44 GLY n 1 45 SER n 1 46 MET n 1 47 VAL n 1 48 HIS n 1 49 PHE n 1 50 ASP n 1 51 PRO n 1 52 THR n 1 53 PRO n 1 54 THR n 1 55 PRO n 1 56 LYS n 1 57 GLY n 1 58 LEU n 1 59 ALA n 1 60 ALA n 1 61 LYS n 1 62 ALA n 1 63 ILE n 1 64 SER n 1 65 LEU n 1 66 PRO n 1 67 LEU n 1 68 GLU n 1 69 HIS n 1 70 HIS n 1 71 HIS n 1 72 HIS n 1 73 HIS n 1 74 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene SO_1732 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain MR-1 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Shewanella oneidensis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 211586 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET21-23C _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 TYR 8 8 8 TYR TYR A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 PHE 16 16 16 PHE PHE A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 HIS 28 28 28 HIS HIS A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 MET 46 46 46 MET MET A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 HIS 48 48 48 HIS HIS A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 PRO 53 53 53 PRO PRO A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 PRO 66 66 66 PRO PRO A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 HIS 69 69 69 HIS HIS A . n A 1 70 HIS 70 70 70 HIS HIS A . n A 1 71 HIS 71 71 71 HIS HIS A . n A 1 72 HIS 72 72 72 HIS HIS A . n A 1 73 HIS 73 73 73 HIS HIS A . n A 1 74 HIS 74 74 74 HIS HIS A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KCM _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KCM _struct.title ;Solution NMR structure of the N-terminal OB-domain of SO_1732 from Shewanella oneidensis. Northeast Structural Genomics Consortium Target SoR210A. ; _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KCM _struct_keywords.pdbx_keywords 'NUCLEIC ACID BINDING PROTEIN' _struct_keywords.text ;nucleic acid binding protein, beta barrel, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8EG75_SHEON _struct_ref.pdbx_db_accession Q8EG75 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MKGKVVSYLAAKKYGFIQGDDGESYFLHFSELLDKKDEGKLVKGSMVHFDPTPTPKGLAAKAISLP _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KCM _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 66 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8EG75 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 66 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 66 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2KCM LEU A 67 ? UNP Q8EG75 ? ? 'expression tag' 67 1 1 2KCM GLU A 68 ? UNP Q8EG75 ? ? 'expression tag' 68 2 1 2KCM HIS A 69 ? UNP Q8EG75 ? ? 'expression tag' 69 3 1 2KCM HIS A 70 ? UNP Q8EG75 ? ? 'expression tag' 70 4 1 2KCM HIS A 71 ? UNP Q8EG75 ? ? 'expression tag' 71 5 1 2KCM HIS A 72 ? UNP Q8EG75 ? ? 'expression tag' 72 6 1 2KCM HIS A 73 ? UNP Q8EG75 ? ? 'expression tag' 73 7 1 2KCM HIS A 74 ? UNP Q8EG75 ? ? 'expression tag' 74 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 HIS A 28 ? LEU A 32 ? HIS A 28 LEU A 32 5 ? 5 HELX_P HELX_P2 2 LYS A 35 ? GLY A 39 ? LYS A 35 GLY A 39 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 SER A 24 ? TYR A 25 ? SER A 24 TYR A 25 A 2 TYR A 14 ? GLY A 19 ? TYR A 14 GLY A 19 A 3 LYS A 2 ? LEU A 9 ? LYS A 2 LEU A 9 A 4 MET A 46 ? THR A 52 ? MET A 46 THR A 52 A 5 ALA A 59 ? SER A 64 ? ALA A 59 SER A 64 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O TYR A 25 ? O TYR A 25 N ILE A 17 ? N ILE A 17 A 2 3 O PHE A 16 ? O PHE A 16 N SER A 7 ? N SER A 7 A 3 4 N GLY A 3 ? N GLY A 3 O VAL A 47 ? O VAL A 47 A 4 5 N HIS A 48 ? N HIS A 48 O SER A 64 ? O SER A 64 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 HD1 A HIS 28 ? ? H A SER 30 ? ? 1.33 2 3 HD1 A HIS 28 ? ? H A SER 30 ? ? 1.22 3 3 HD1 A HIS 71 ? ? H A HIS 73 ? ? 1.29 4 10 HD1 A HIS 28 ? ? H A SER 30 ? ? 1.28 5 13 HD1 A HIS 28 ? ? H A SER 30 ? ? 1.27 6 13 HG A SER 45 ? ? H A MET 46 ? ? 1.27 7 15 HD1 A HIS 28 ? ? H A SER 30 ? ? 1.34 8 16 HG1 A THR 54 ? ? H A LEU 58 ? ? 1.32 9 16 HG A SER 45 ? ? H A MET 46 ? ? 1.32 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 13 ? ? 34.95 27.35 2 1 ASP A 37 ? ? -51.10 -9.46 3 1 PRO A 53 ? ? -73.09 -71.52 4 1 THR A 54 ? ? 58.38 149.29 5 2 LYS A 2 ? ? -168.20 -164.22 6 2 LYS A 13 ? ? 47.08 15.73 7 2 THR A 54 ? ? -178.01 145.27 8 2 LYS A 56 ? ? -173.24 131.72 9 2 LEU A 58 ? ? 59.18 146.15 10 2 GLU A 68 ? ? -72.35 -151.17 11 2 HIS A 69 ? ? 59.15 73.43 12 2 HIS A 70 ? ? -164.12 76.21 13 2 HIS A 72 ? ? -166.10 119.14 14 3 TYR A 8 ? ? -162.76 102.08 15 3 LEU A 27 ? ? 70.40 96.77 16 3 THR A 52 ? ? -154.17 88.54 17 3 ALA A 62 ? ? 57.33 71.09 18 3 GLU A 68 ? ? 54.49 166.62 19 4 LYS A 13 ? ? 56.29 4.52 20 4 THR A 54 ? ? -35.37 99.43 21 4 LEU A 58 ? ? 58.40 128.38 22 4 ALA A 62 ? ? 51.56 74.75 23 4 HIS A 71 ? ? -153.29 -36.65 24 5 LYS A 13 ? ? 69.33 -17.65 25 5 LYS A 35 ? ? -54.91 -6.64 26 5 LEU A 41 ? ? -55.14 -168.95 27 5 LEU A 58 ? ? 60.56 145.61 28 5 GLU A 68 ? ? 59.17 87.40 29 5 HIS A 70 ? ? 55.18 108.22 30 6 LYS A 13 ? ? 65.61 -8.46 31 6 PRO A 66 ? ? -73.43 41.09 32 6 HIS A 72 ? ? 48.94 179.53 33 6 HIS A 73 ? ? 44.43 83.61 34 7 LYS A 13 ? ? 35.06 30.97 35 7 THR A 52 ? ? -154.29 88.76 36 7 THR A 54 ? ? 52.55 157.18 37 7 ALA A 60 ? ? -99.87 -83.04 38 7 LYS A 61 ? ? 60.31 144.79 39 7 GLU A 68 ? ? -144.56 10.38 40 8 TYR A 8 ? ? -161.06 117.63 41 8 LYS A 35 ? ? -52.23 -7.27 42 8 THR A 52 ? ? -150.52 87.96 43 8 GLU A 68 ? ? -105.21 -161.02 44 8 HIS A 72 ? ? 42.64 -89.30 45 9 LYS A 13 ? ? 61.47 -7.00 46 9 THR A 54 ? ? -35.65 99.55 47 9 LEU A 58 ? ? 58.81 146.30 48 9 HIS A 70 ? ? -147.46 -129.70 49 9 HIS A 71 ? ? 50.11 79.88 50 10 TYR A 8 ? ? -160.28 -74.65 51 10 LEU A 9 ? ? 57.80 116.41 52 10 LYS A 13 ? ? 57.86 -4.09 53 10 LYS A 35 ? ? -46.30 -14.71 54 10 THR A 52 ? ? -152.42 87.84 55 10 ALA A 62 ? ? 66.20 61.15 56 10 GLU A 68 ? ? 48.93 98.52 57 10 HIS A 70 ? ? 53.81 75.66 58 10 HIS A 72 ? ? -155.49 -44.01 59 11 LYS A 13 ? ? 55.19 6.61 60 11 THR A 54 ? ? -41.98 152.48 61 11 PRO A 55 ? ? -38.54 -22.25 62 11 LYS A 56 ? ? -145.29 -76.22 63 11 LEU A 58 ? ? 41.58 20.55 64 11 LEU A 67 ? ? -70.50 -106.61 65 12 LYS A 13 ? ? 58.83 -3.94 66 12 LYS A 35 ? ? -45.84 -15.13 67 12 PRO A 53 ? ? -46.95 88.80 68 12 PRO A 55 ? ? -66.06 12.43 69 12 LEU A 58 ? ? 62.70 147.03 70 12 LYS A 61 ? ? 59.12 129.08 71 12 ALA A 62 ? ? 48.14 87.21 72 12 GLU A 68 ? ? 53.89 110.52 73 13 LYS A 13 ? ? 64.22 -17.76 74 13 PRO A 53 ? ? -66.49 88.62 75 13 THR A 54 ? ? -170.98 82.30 76 13 LEU A 58 ? ? 58.43 128.84 77 13 PRO A 66 ? ? -71.61 -84.07 78 13 LEU A 67 ? ? 42.36 21.18 79 13 GLU A 68 ? ? 52.92 -110.20 80 13 HIS A 72 ? ? 46.57 88.97 81 14 TYR A 8 ? ? -162.99 93.90 82 14 LEU A 33 ? ? 59.27 -70.42 83 15 TYR A 8 ? ? -165.75 93.98 84 15 LYS A 40 ? ? -149.92 58.08 85 15 THR A 52 ? ? -153.55 87.91 86 15 THR A 54 ? ? 53.58 161.02 87 15 HIS A 70 ? ? 52.88 168.38 88 15 HIS A 72 ? ? -139.44 -109.25 89 15 HIS A 73 ? ? 43.18 87.71 90 16 LYS A 2 ? ? -71.37 -80.98 91 16 LYS A 13 ? ? 59.10 2.95 92 16 THR A 54 ? ? 56.87 146.73 93 16 LYS A 56 ? ? 58.59 88.75 94 16 LEU A 58 ? ? 60.92 152.28 95 16 HIS A 70 ? ? 47.47 179.50 96 16 HIS A 71 ? ? -58.38 -80.22 97 16 HIS A 72 ? ? 38.83 82.17 98 17 TYR A 8 ? ? -161.02 117.18 99 17 LYS A 13 ? ? 57.67 6.54 100 17 LYS A 35 ? ? -49.00 -19.50 101 17 LYS A 56 ? ? -171.75 111.58 102 17 LEU A 58 ? ? 60.92 163.09 103 17 LEU A 65 ? ? -119.73 79.63 104 17 HIS A 72 ? ? -76.90 42.08 105 18 LYS A 13 ? ? 54.21 6.80 106 18 LYS A 40 ? ? -90.87 -88.92 107 18 LEU A 41 ? ? 44.81 -175.63 108 18 THR A 52 ? ? -153.56 87.76 109 18 HIS A 70 ? ? 57.88 167.19 110 19 LEU A 9 ? ? 45.93 75.22 111 19 LYS A 13 ? ? 55.44 5.66 112 19 THR A 54 ? ? 33.11 87.25 113 19 LYS A 56 ? ? 78.12 67.14 114 19 LEU A 58 ? ? 59.49 138.36 115 19 LEU A 67 ? ? 40.41 95.79 116 19 GLU A 68 ? ? -89.53 -98.32 117 19 HIS A 69 ? ? -171.45 84.66 118 20 TYR A 8 ? ? -125.14 -68.53 119 20 LEU A 9 ? ? 57.93 109.46 120 20 LYS A 13 ? ? 52.19 9.35 121 20 THR A 54 ? ? -172.38 149.74 122 20 LEU A 67 ? ? 33.67 -151.47 123 20 GLU A 68 ? ? -164.15 26.27 124 20 HIS A 73 ? ? 53.30 10.17 # _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.id 1 _pdbx_SG_project.initial_of_center NESG _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 25 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KCM _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KCM _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;0.84 mM [U-100% 13C; U-100% 15N] OB domain-1, 20 mM MES-2, 100 mM sodium chloride-3, 10 mM DTT-4, 5 mM calcium chloride-5, 0.02 % sodium azide-6, 95% H2O/5% D2O ; 1 '95% H2O/5% D2O' ;.85 mM [U-5% 13C; U-99% 15N] OB domain-7, 20 mM MES-8, 100 mM sodium chloride-9, 10 mM DTT-10, 5 mM calcium chloride-11, 0.02 % sodium azide-12, 95% H2O/5% D2O ; 2 '95% H2O/5% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'OB domain-1' 0.84 ? mM '[U-100% 13C; U-100% 15N]' 1 MES-2 20 ? mM ? 1 'sodium chloride-3' 100 ? mM ? 1 DTT-4 10 ? mM ? 1 'calcium chloride-5' 5 ? mM ? 1 'sodium azide-6' 0.02 ? % ? 1 'OB domain-7' 0.85 ? mM '[U-5% 13C; U-99% 15N]' 2 MES-8 20 ? mM ? 2 'sodium chloride-9' 100 ? mM ? 2 DTT-10 10 ? mM ? 2 'calcium chloride-11' 5 ? mM ? 2 'sodium azide-12' 0.02 ? % ? 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.1 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D HNCO' 1 2 1 '3D HNCA' 1 3 1 '3D HNCACB' 1 4 1 '3D CBCA(CO)NH' 1 5 1 '3D HCCH-TOCSY' 1 6 1 '3D H(CCO)NH' 1 7 1 '3D C(CO)NH' 1 8 1 '3D 1H-15N NOESY' 1 9 1 '3D 1H-13C NOESY' 1 10 1 '2D 1H-15N HSQC' 1 11 1 '2D 1H-13C HSQC' 1 12 2 '2D 1H-13C HSQC' # _pdbx_nmr_refine.entry_id 2KCM _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ;autostructure and cyana were used to automatically assign NOE crosspeaks. xplor-NIH and CNS were used to perform hydrogen bond refinement and refinement in the presence of water. ; _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Bruker Biospin' collection TopSpin 2.1 1 Goddard 'data analysis' Sparky 3.113 2 'Zimmerman, Moseley, Kulikowski and Montelione' 'chemical shift assignment' AutoAssign 2.3.0 3 'Huang, Tejero, Powers and Montelione' 'structure solution' AutoStructure 2.2.1 4 'Guntert, Mumenthaler and Wuthrich' 'data analysis' CYANA 2.1 5 'Bhattacharya and Montelione' 'data analysis' PSVS 1.3 6 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS 1.2 7 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' 2.2.1 8 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASP N N N N 14 ASP CA C N S 15 ASP C C N N 16 ASP O O N N 17 ASP CB C N N 18 ASP CG C N N 19 ASP OD1 O N N 20 ASP OD2 O N N 21 ASP OXT O N N 22 ASP H H N N 23 ASP H2 H N N 24 ASP HA H N N 25 ASP HB2 H N N 26 ASP HB3 H N N 27 ASP HD2 H N N 28 ASP HXT H N N 29 GLN N N N N 30 GLN CA C N S 31 GLN C C N N 32 GLN O O N N 33 GLN CB C N N 34 GLN CG C N N 35 GLN CD C N N 36 GLN OE1 O N N 37 GLN NE2 N N N 38 GLN OXT O N N 39 GLN H H N N 40 GLN H2 H N N 41 GLN HA H N N 42 GLN HB2 H N N 43 GLN HB3 H N N 44 GLN HG2 H N N 45 GLN HG3 H N N 46 GLN HE21 H N N 47 GLN HE22 H N N 48 GLN HXT H N N 49 GLU N N N N 50 GLU CA C N S 51 GLU C C N N 52 GLU O O N N 53 GLU CB C N N 54 GLU CG C N N 55 GLU CD C N N 56 GLU OE1 O N N 57 GLU OE2 O N N 58 GLU OXT O N N 59 GLU H H N N 60 GLU H2 H N N 61 GLU HA H N N 62 GLU HB2 H N N 63 GLU HB3 H N N 64 GLU HG2 H N N 65 GLU HG3 H N N 66 GLU HE2 H N N 67 GLU HXT H N N 68 GLY N N N N 69 GLY CA C N N 70 GLY C C N N 71 GLY O O N N 72 GLY OXT O N N 73 GLY H H N N 74 GLY H2 H N N 75 GLY HA2 H N N 76 GLY HA3 H N N 77 GLY HXT H N N 78 HIS N N N N 79 HIS CA C N S 80 HIS C C N N 81 HIS O O N N 82 HIS CB C N N 83 HIS CG C Y N 84 HIS ND1 N Y N 85 HIS CD2 C Y N 86 HIS CE1 C Y N 87 HIS NE2 N Y N 88 HIS OXT O N N 89 HIS H H N N 90 HIS H2 H N N 91 HIS HA H N N 92 HIS HB2 H N N 93 HIS HB3 H N N 94 HIS HD1 H N N 95 HIS HD2 H N N 96 HIS HE1 H N N 97 HIS HE2 H N N 98 HIS HXT H N N 99 ILE N N N N 100 ILE CA C N S 101 ILE C C N N 102 ILE O O N N 103 ILE CB C N S 104 ILE CG1 C N N 105 ILE CG2 C N N 106 ILE CD1 C N N 107 ILE OXT O N N 108 ILE H H N N 109 ILE H2 H N N 110 ILE HA H N N 111 ILE HB H N N 112 ILE HG12 H N N 113 ILE HG13 H N N 114 ILE HG21 H N N 115 ILE HG22 H N N 116 ILE HG23 H N N 117 ILE HD11 H N N 118 ILE HD12 H N N 119 ILE HD13 H N N 120 ILE HXT H N N 121 LEU N N N N 122 LEU CA C N S 123 LEU C C N N 124 LEU O O N N 125 LEU CB C N N 126 LEU CG C N N 127 LEU CD1 C N N 128 LEU CD2 C N N 129 LEU OXT O N N 130 LEU H H N N 131 LEU H2 H N N 132 LEU HA H N N 133 LEU HB2 H N N 134 LEU HB3 H N N 135 LEU HG H N N 136 LEU HD11 H N N 137 LEU HD12 H N N 138 LEU HD13 H N N 139 LEU HD21 H N N 140 LEU HD22 H N N 141 LEU HD23 H N N 142 LEU HXT H N N 143 LYS N N N N 144 LYS CA C N S 145 LYS C C N N 146 LYS O O N N 147 LYS CB C N N 148 LYS CG C N N 149 LYS CD C N N 150 LYS CE C N N 151 LYS NZ N N N 152 LYS OXT O N N 153 LYS H H N N 154 LYS H2 H N N 155 LYS HA H N N 156 LYS HB2 H N N 157 LYS HB3 H N N 158 LYS HG2 H N N 159 LYS HG3 H N N 160 LYS HD2 H N N 161 LYS HD3 H N N 162 LYS HE2 H N N 163 LYS HE3 H N N 164 LYS HZ1 H N N 165 LYS HZ2 H N N 166 LYS HZ3 H N N 167 LYS HXT H N N 168 MET N N N N 169 MET CA C N S 170 MET C C N N 171 MET O O N N 172 MET CB C N N 173 MET CG C N N 174 MET SD S N N 175 MET CE C N N 176 MET OXT O N N 177 MET H H N N 178 MET H2 H N N 179 MET HA H N N 180 MET HB2 H N N 181 MET HB3 H N N 182 MET HG2 H N N 183 MET HG3 H N N 184 MET HE1 H N N 185 MET HE2 H N N 186 MET HE3 H N N 187 MET HXT H N N 188 PHE N N N N 189 PHE CA C N S 190 PHE C C N N 191 PHE O O N N 192 PHE CB C N N 193 PHE CG C Y N 194 PHE CD1 C Y N 195 PHE CD2 C Y N 196 PHE CE1 C Y N 197 PHE CE2 C Y N 198 PHE CZ C Y N 199 PHE OXT O N N 200 PHE H H N N 201 PHE H2 H N N 202 PHE HA H N N 203 PHE HB2 H N N 204 PHE HB3 H N N 205 PHE HD1 H N N 206 PHE HD2 H N N 207 PHE HE1 H N N 208 PHE HE2 H N N 209 PHE HZ H N N 210 PHE HXT H N N 211 PRO N N N N 212 PRO CA C N S 213 PRO C C N N 214 PRO O O N N 215 PRO CB C N N 216 PRO CG C N N 217 PRO CD C N N 218 PRO OXT O N N 219 PRO H H N N 220 PRO HA H N N 221 PRO HB2 H N N 222 PRO HB3 H N N 223 PRO HG2 H N N 224 PRO HG3 H N N 225 PRO HD2 H N N 226 PRO HD3 H N N 227 PRO HXT H N N 228 SER N N N N 229 SER CA C N S 230 SER C C N N 231 SER O O N N 232 SER CB C N N 233 SER OG O N N 234 SER OXT O N N 235 SER H H N N 236 SER H2 H N N 237 SER HA H N N 238 SER HB2 H N N 239 SER HB3 H N N 240 SER HG H N N 241 SER HXT H N N 242 THR N N N N 243 THR CA C N S 244 THR C C N N 245 THR O O N N 246 THR CB C N R 247 THR OG1 O N N 248 THR CG2 C N N 249 THR OXT O N N 250 THR H H N N 251 THR H2 H N N 252 THR HA H N N 253 THR HB H N N 254 THR HG1 H N N 255 THR HG21 H N N 256 THR HG22 H N N 257 THR HG23 H N N 258 THR HXT H N N 259 TYR N N N N 260 TYR CA C N S 261 TYR C C N N 262 TYR O O N N 263 TYR CB C N N 264 TYR CG C Y N 265 TYR CD1 C Y N 266 TYR CD2 C Y N 267 TYR CE1 C Y N 268 TYR CE2 C Y N 269 TYR CZ C Y N 270 TYR OH O N N 271 TYR OXT O N N 272 TYR H H N N 273 TYR H2 H N N 274 TYR HA H N N 275 TYR HB2 H N N 276 TYR HB3 H N N 277 TYR HD1 H N N 278 TYR HD2 H N N 279 TYR HE1 H N N 280 TYR HE2 H N N 281 TYR HH H N N 282 TYR HXT H N N 283 VAL N N N N 284 VAL CA C N S 285 VAL C C N N 286 VAL O O N N 287 VAL CB C N N 288 VAL CG1 C N N 289 VAL CG2 C N N 290 VAL OXT O N N 291 VAL H H N N 292 VAL H2 H N N 293 VAL HA H N N 294 VAL HB H N N 295 VAL HG11 H N N 296 VAL HG12 H N N 297 VAL HG13 H N N 298 VAL HG21 H N N 299 VAL HG22 H N N 300 VAL HG23 H N N 301 VAL HXT H N N 302 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASP N CA sing N N 13 ASP N H sing N N 14 ASP N H2 sing N N 15 ASP CA C sing N N 16 ASP CA CB sing N N 17 ASP CA HA sing N N 18 ASP C O doub N N 19 ASP C OXT sing N N 20 ASP CB CG sing N N 21 ASP CB HB2 sing N N 22 ASP CB HB3 sing N N 23 ASP CG OD1 doub N N 24 ASP CG OD2 sing N N 25 ASP OD2 HD2 sing N N 26 ASP OXT HXT sing N N 27 GLN N CA sing N N 28 GLN N H sing N N 29 GLN N H2 sing N N 30 GLN CA C sing N N 31 GLN CA CB sing N N 32 GLN CA HA sing N N 33 GLN C O doub N N 34 GLN C OXT sing N N 35 GLN CB CG sing N N 36 GLN CB HB2 sing N N 37 GLN CB HB3 sing N N 38 GLN CG CD sing N N 39 GLN CG HG2 sing N N 40 GLN CG HG3 sing N N 41 GLN CD OE1 doub N N 42 GLN CD NE2 sing N N 43 GLN NE2 HE21 sing N N 44 GLN NE2 HE22 sing N N 45 GLN OXT HXT sing N N 46 GLU N CA sing N N 47 GLU N H sing N N 48 GLU N H2 sing N N 49 GLU CA C sing N N 50 GLU CA CB sing N N 51 GLU CA HA sing N N 52 GLU C O doub N N 53 GLU C OXT sing N N 54 GLU CB CG sing N N 55 GLU CB HB2 sing N N 56 GLU CB HB3 sing N N 57 GLU CG CD sing N N 58 GLU CG HG2 sing N N 59 GLU CG HG3 sing N N 60 GLU CD OE1 doub N N 61 GLU CD OE2 sing N N 62 GLU OE2 HE2 sing N N 63 GLU OXT HXT sing N N 64 GLY N CA sing N N 65 GLY N H sing N N 66 GLY N H2 sing N N 67 GLY CA C sing N N 68 GLY CA HA2 sing N N 69 GLY CA HA3 sing N N 70 GLY C O doub N N 71 GLY C OXT sing N N 72 GLY OXT HXT sing N N 73 HIS N CA sing N N 74 HIS N H sing N N 75 HIS N H2 sing N N 76 HIS CA C sing N N 77 HIS CA CB sing N N 78 HIS CA HA sing N N 79 HIS C O doub N N 80 HIS C OXT sing N N 81 HIS CB CG sing N N 82 HIS CB HB2 sing N N 83 HIS CB HB3 sing N N 84 HIS CG ND1 sing Y N 85 HIS CG CD2 doub Y N 86 HIS ND1 CE1 doub Y N 87 HIS ND1 HD1 sing N N 88 HIS CD2 NE2 sing Y N 89 HIS CD2 HD2 sing N N 90 HIS CE1 NE2 sing Y N 91 HIS CE1 HE1 sing N N 92 HIS NE2 HE2 sing N N 93 HIS OXT HXT sing N N 94 ILE N CA sing N N 95 ILE N H sing N N 96 ILE N H2 sing N N 97 ILE CA C sing N N 98 ILE CA CB sing N N 99 ILE CA HA sing N N 100 ILE C O doub N N 101 ILE C OXT sing N N 102 ILE CB CG1 sing N N 103 ILE CB CG2 sing N N 104 ILE CB HB sing N N 105 ILE CG1 CD1 sing N N 106 ILE CG1 HG12 sing N N 107 ILE CG1 HG13 sing N N 108 ILE CG2 HG21 sing N N 109 ILE CG2 HG22 sing N N 110 ILE CG2 HG23 sing N N 111 ILE CD1 HD11 sing N N 112 ILE CD1 HD12 sing N N 113 ILE CD1 HD13 sing N N 114 ILE OXT HXT sing N N 115 LEU N CA sing N N 116 LEU N H sing N N 117 LEU N H2 sing N N 118 LEU CA C sing N N 119 LEU CA CB sing N N 120 LEU CA HA sing N N 121 LEU C O doub N N 122 LEU C OXT sing N N 123 LEU CB CG sing N N 124 LEU CB HB2 sing N N 125 LEU CB HB3 sing N N 126 LEU CG CD1 sing N N 127 LEU CG CD2 sing N N 128 LEU CG HG sing N N 129 LEU CD1 HD11 sing N N 130 LEU CD1 HD12 sing N N 131 LEU CD1 HD13 sing N N 132 LEU CD2 HD21 sing N N 133 LEU CD2 HD22 sing N N 134 LEU CD2 HD23 sing N N 135 LEU OXT HXT sing N N 136 LYS N CA sing N N 137 LYS N H sing N N 138 LYS N H2 sing N N 139 LYS CA C sing N N 140 LYS CA CB sing N N 141 LYS CA HA sing N N 142 LYS C O doub N N 143 LYS C OXT sing N N 144 LYS CB CG sing N N 145 LYS CB HB2 sing N N 146 LYS CB HB3 sing N N 147 LYS CG CD sing N N 148 LYS CG HG2 sing N N 149 LYS CG HG3 sing N N 150 LYS CD CE sing N N 151 LYS CD HD2 sing N N 152 LYS CD HD3 sing N N 153 LYS CE NZ sing N N 154 LYS CE HE2 sing N N 155 LYS CE HE3 sing N N 156 LYS NZ HZ1 sing N N 157 LYS NZ HZ2 sing N N 158 LYS NZ HZ3 sing N N 159 LYS OXT HXT sing N N 160 MET N CA sing N N 161 MET N H sing N N 162 MET N H2 sing N N 163 MET CA C sing N N 164 MET CA CB sing N N 165 MET CA HA sing N N 166 MET C O doub N N 167 MET C OXT sing N N 168 MET CB CG sing N N 169 MET CB HB2 sing N N 170 MET CB HB3 sing N N 171 MET CG SD sing N N 172 MET CG HG2 sing N N 173 MET CG HG3 sing N N 174 MET SD CE sing N N 175 MET CE HE1 sing N N 176 MET CE HE2 sing N N 177 MET CE HE3 sing N N 178 MET OXT HXT sing N N 179 PHE N CA sing N N 180 PHE N H sing N N 181 PHE N H2 sing N N 182 PHE CA C sing N N 183 PHE CA CB sing N N 184 PHE CA HA sing N N 185 PHE C O doub N N 186 PHE C OXT sing N N 187 PHE CB CG sing N N 188 PHE CB HB2 sing N N 189 PHE CB HB3 sing N N 190 PHE CG CD1 doub Y N 191 PHE CG CD2 sing Y N 192 PHE CD1 CE1 sing Y N 193 PHE CD1 HD1 sing N N 194 PHE CD2 CE2 doub Y N 195 PHE CD2 HD2 sing N N 196 PHE CE1 CZ doub Y N 197 PHE CE1 HE1 sing N N 198 PHE CE2 CZ sing Y N 199 PHE CE2 HE2 sing N N 200 PHE CZ HZ sing N N 201 PHE OXT HXT sing N N 202 PRO N CA sing N N 203 PRO N CD sing N N 204 PRO N H sing N N 205 PRO CA C sing N N 206 PRO CA CB sing N N 207 PRO CA HA sing N N 208 PRO C O doub N N 209 PRO C OXT sing N N 210 PRO CB CG sing N N 211 PRO CB HB2 sing N N 212 PRO CB HB3 sing N N 213 PRO CG CD sing N N 214 PRO CG HG2 sing N N 215 PRO CG HG3 sing N N 216 PRO CD HD2 sing N N 217 PRO CD HD3 sing N N 218 PRO OXT HXT sing N N 219 SER N CA sing N N 220 SER N H sing N N 221 SER N H2 sing N N 222 SER CA C sing N N 223 SER CA CB sing N N 224 SER CA HA sing N N 225 SER C O doub N N 226 SER C OXT sing N N 227 SER CB OG sing N N 228 SER CB HB2 sing N N 229 SER CB HB3 sing N N 230 SER OG HG sing N N 231 SER OXT HXT sing N N 232 THR N CA sing N N 233 THR N H sing N N 234 THR N H2 sing N N 235 THR CA C sing N N 236 THR CA CB sing N N 237 THR CA HA sing N N 238 THR C O doub N N 239 THR C OXT sing N N 240 THR CB OG1 sing N N 241 THR CB CG2 sing N N 242 THR CB HB sing N N 243 THR OG1 HG1 sing N N 244 THR CG2 HG21 sing N N 245 THR CG2 HG22 sing N N 246 THR CG2 HG23 sing N N 247 THR OXT HXT sing N N 248 TYR N CA sing N N 249 TYR N H sing N N 250 TYR N H2 sing N N 251 TYR CA C sing N N 252 TYR CA CB sing N N 253 TYR CA HA sing N N 254 TYR C O doub N N 255 TYR C OXT sing N N 256 TYR CB CG sing N N 257 TYR CB HB2 sing N N 258 TYR CB HB3 sing N N 259 TYR CG CD1 doub Y N 260 TYR CG CD2 sing Y N 261 TYR CD1 CE1 sing Y N 262 TYR CD1 HD1 sing N N 263 TYR CD2 CE2 doub Y N 264 TYR CD2 HD2 sing N N 265 TYR CE1 CZ doub Y N 266 TYR CE1 HE1 sing N N 267 TYR CE2 CZ sing Y N 268 TYR CE2 HE2 sing N N 269 TYR CZ OH sing N N 270 TYR OH HH sing N N 271 TYR OXT HXT sing N N 272 VAL N CA sing N N 273 VAL N H sing N N 274 VAL N H2 sing N N 275 VAL CA C sing N N 276 VAL CA CB sing N N 277 VAL CA HA sing N N 278 VAL C O doub N N 279 VAL C OXT sing N N 280 VAL CB CG1 sing N N 281 VAL CB CG2 sing N N 282 VAL CB HB sing N N 283 VAL CG1 HG11 sing N N 284 VAL CG1 HG12 sing N N 285 VAL CG1 HG13 sing N N 286 VAL CG2 HG21 sing N N 287 VAL CG2 HG22 sing N N 288 VAL CG2 HG23 sing N N 289 VAL OXT HXT sing N N 290 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 850 Bruker AVANCE 1 'Bruker Avance' 600 Varian INOVA 2 'Varian INOVA' # _atom_sites.entry_id 2KCM _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_