data_2KCR
# 
_entry.id   2KCR 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.397 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2KCR         pdb_00002kcr 10.2210/pdb2kcr/pdb 
RCSB  RCSB100958   ?            ?                   
BMRB  16094        ?            10.13018/BMR16094   
WWPDB D_1000100958 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-06-16 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2020-02-26 
4 'Structure model' 1 3 2023-06-14 
5 'Structure model' 1 4 2024-10-16 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Data collection'           
3 3 'Structure model' 'Derived calculations'      
4 3 'Structure model' Other                       
5 4 'Structure model' 'Database references'       
6 4 'Structure model' Other                       
7 5 'Structure model' 'Data collection'           
8 5 'Structure model' 'Database references'       
9 5 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  3 'Structure model' pdbx_database_status      
2  3 'Structure model' pdbx_nmr_software         
3  3 'Structure model' pdbx_struct_assembly      
4  3 'Structure model' pdbx_struct_oper_list     
5  4 'Structure model' database_2                
6  4 'Structure model' pdbx_database_status      
7  5 'Structure model' chem_comp_atom            
8  5 'Structure model' chem_comp_bond            
9  5 'Structure model' database_2                
10 5 'Structure model' pdbx_entry_details        
11 5 'Structure model' pdbx_modification_feature 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_pdbx_database_status.status_code_cs'         
2 3 'Structure model' '_pdbx_nmr_software.name'                      
3 4 'Structure model' '_database_2.pdbx_DOI'                         
4 4 'Structure model' '_database_2.pdbx_database_accession'          
5 4 'Structure model' '_pdbx_database_status.status_code_nmr_data'   
6 5 'Structure model' '_database_2.pdbx_DOI'                         
7 5 'Structure model' '_pdbx_entry_details.has_protein_modification' 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2KCR 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2008-12-29 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            REL 
# 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.db_id          16094 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        . 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hong, J.' 1 
'You, D.'  2 
'Lai, R.'  3 
'Lin, D.'  4 
# 
_citation.id                        primary 
_citation.title                     'Solution structure of anntoxin' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Hong, J.' 1 ? 
primary 'You, D.'  2 ? 
primary 'Lai, R.'  3 ? 
primary 'Lin, D.'  4 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           anntoxin 
_entity.formula_weight             6834.436 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       PAQDYRCQLSRNYGKGSGSFTNYYYDKATSSCKTFRYRGSGGNGNRFKTLEDCEATCVTAE 
_entity_poly.pdbx_seq_one_letter_code_can   PAQDYRCQLSRNYGKGSGSFTNYYYDKATSSCKTFRYRGSGGNGNRFKTLEDCEATCVTAE 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  PRO n 
1 2  ALA n 
1 3  GLN n 
1 4  ASP n 
1 5  TYR n 
1 6  ARG n 
1 7  CYS n 
1 8  GLN n 
1 9  LEU n 
1 10 SER n 
1 11 ARG n 
1 12 ASN n 
1 13 TYR n 
1 14 GLY n 
1 15 LYS n 
1 16 GLY n 
1 17 SER n 
1 18 GLY n 
1 19 SER n 
1 20 PHE n 
1 21 THR n 
1 22 ASN n 
1 23 TYR n 
1 24 TYR n 
1 25 TYR n 
1 26 ASP n 
1 27 LYS n 
1 28 ALA n 
1 29 THR n 
1 30 SER n 
1 31 SER n 
1 32 CYS n 
1 33 LYS n 
1 34 THR n 
1 35 PHE n 
1 36 ARG n 
1 37 TYR n 
1 38 ARG n 
1 39 GLY n 
1 40 SER n 
1 41 GLY n 
1 42 GLY n 
1 43 ASN n 
1 44 GLY n 
1 45 ASN n 
1 46 ARG n 
1 47 PHE n 
1 48 LYS n 
1 49 THR n 
1 50 LEU n 
1 51 GLU n 
1 52 ASP n 
1 53 CYS n 
1 54 GLU n 
1 55 ALA n 
1 56 THR n 
1 57 CYS n 
1 58 VAL n 
1 59 THR n 
1 60 ALA n 
1 61 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Hyla annectans' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     317325 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET32a+ 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  PRO 1  1  1  PRO PRO A . n 
A 1 2  ALA 2  2  2  ALA ALA A . n 
A 1 3  GLN 3  3  3  GLN GLN A . n 
A 1 4  ASP 4  4  4  ASP ASP A . n 
A 1 5  TYR 5  5  5  TYR TYR A . n 
A 1 6  ARG 6  6  6  ARG ARG A . n 
A 1 7  CYS 7  7  7  CYS CYS A . n 
A 1 8  GLN 8  8  8  GLN GLN A . n 
A 1 9  LEU 9  9  9  LEU LEU A . n 
A 1 10 SER 10 10 10 SER SER A . n 
A 1 11 ARG 11 11 11 ARG ARG A . n 
A 1 12 ASN 12 12 12 ASN ASN A . n 
A 1 13 TYR 13 13 13 TYR TYR A . n 
A 1 14 GLY 14 14 14 GLY GLY A . n 
A 1 15 LYS 15 15 15 LYS LYS A . n 
A 1 16 GLY 16 16 16 GLY GLY A . n 
A 1 17 SER 17 17 17 SER SER A . n 
A 1 18 GLY 18 18 18 GLY GLY A . n 
A 1 19 SER 19 19 19 SER SER A . n 
A 1 20 PHE 20 20 20 PHE PHE A . n 
A 1 21 THR 21 21 21 THR THR A . n 
A 1 22 ASN 22 22 22 ASN ASN A . n 
A 1 23 TYR 23 23 23 TYR TYR A . n 
A 1 24 TYR 24 24 24 TYR TYR A . n 
A 1 25 TYR 25 25 25 TYR TYR A . n 
A 1 26 ASP 26 26 26 ASP ASP A . n 
A 1 27 LYS 27 27 27 LYS LYS A . n 
A 1 28 ALA 28 28 28 ALA ALA A . n 
A 1 29 THR 29 29 29 THR THR A . n 
A 1 30 SER 30 30 30 SER SER A . n 
A 1 31 SER 31 31 31 SER SER A . n 
A 1 32 CYS 32 32 32 CYS CYS A . n 
A 1 33 LYS 33 33 33 LYS LYS A . n 
A 1 34 THR 34 34 34 THR THR A . n 
A 1 35 PHE 35 35 35 PHE PHE A . n 
A 1 36 ARG 36 36 36 ARG ARG A . n 
A 1 37 TYR 37 37 37 TYR TYR A . n 
A 1 38 ARG 38 38 38 ARG ARG A . n 
A 1 39 GLY 39 39 39 GLY GLY A . n 
A 1 40 SER 40 40 40 SER SER A . n 
A 1 41 GLY 41 41 41 GLY GLY A . n 
A 1 42 GLY 42 42 42 GLY GLY A . n 
A 1 43 ASN 43 43 43 ASN ASN A . n 
A 1 44 GLY 44 44 44 GLY GLY A . n 
A 1 45 ASN 45 45 45 ASN ASN A . n 
A 1 46 ARG 46 46 46 ARG ARG A . n 
A 1 47 PHE 47 47 47 PHE PHE A . n 
A 1 48 LYS 48 48 48 LYS LYS A . n 
A 1 49 THR 49 49 49 THR THR A . n 
A 1 50 LEU 50 50 50 LEU LEU A . n 
A 1 51 GLU 51 51 51 GLU GLU A . n 
A 1 52 ASP 52 52 52 ASP ASP A . n 
A 1 53 CYS 53 53 53 CYS CYS A . n 
A 1 54 GLU 54 54 54 GLU GLU A . n 
A 1 55 ALA 55 55 55 ALA ALA A . n 
A 1 56 THR 56 56 56 THR THR A . n 
A 1 57 CYS 57 57 57 CYS CYS A . n 
A 1 58 VAL 58 58 58 VAL VAL A . n 
A 1 59 THR 59 59 59 THR THR A . n 
A 1 60 ALA 60 60 60 ALA ALA A . n 
A 1 61 GLU 61 61 61 GLU GLU A . n 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    'kunitz type' 
_exptl.entry_id                   2KCR 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2KCR 
_struct.title                     'Solution structure of anntoxin' 
_struct.pdbx_model_details        'lowest energy, model 1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2KCR 
_struct_keywords.pdbx_keywords   TOXIN 
_struct_keywords.text            'Protein, TOXIN' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_ref.id                         1 
_struct_ref.db_code                    2KCR 
_struct_ref.db_name                    PDB 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          2KCR 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   PAQDYRCQLSRNYGKGSGSFTNYYYDKATSSCKTFRYRGSGGNGNRFKTLEDCEATCVTAE 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2KCR 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 61 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             2KCR 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  61 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       61 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   ? 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASP A 4  ? GLN A 8  ? ASP A 4  GLN A 8  5 ? 5  
HELX_P HELX_P2 2 THR A 49 ? GLU A 61 ? THR A 49 GLU A 61 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ? ? A CYS 7  SG ? ? ? 1_555 A CYS 57 SG ? ? A CYS 7  A CYS 57 1_555 ? ? ? ? ? ? ? 2.030 ? ? 
disulf2 disulf ? ? A CYS 32 SG ? ? ? 1_555 A CYS 53 SG ? ? A CYS 32 A CYS 53 1_555 ? ? ? ? ? ? ? 2.025 ? ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_pdbx_modification_feature.ordinal 
_pdbx_modification_feature.label_comp_id 
_pdbx_modification_feature.label_asym_id 
_pdbx_modification_feature.label_seq_id 
_pdbx_modification_feature.label_alt_id 
_pdbx_modification_feature.modified_residue_label_comp_id 
_pdbx_modification_feature.modified_residue_label_asym_id 
_pdbx_modification_feature.modified_residue_label_seq_id 
_pdbx_modification_feature.modified_residue_label_alt_id 
_pdbx_modification_feature.auth_comp_id 
_pdbx_modification_feature.auth_asym_id 
_pdbx_modification_feature.auth_seq_id 
_pdbx_modification_feature.PDB_ins_code 
_pdbx_modification_feature.symmetry 
_pdbx_modification_feature.modified_residue_auth_comp_id 
_pdbx_modification_feature.modified_residue_auth_asym_id 
_pdbx_modification_feature.modified_residue_auth_seq_id 
_pdbx_modification_feature.modified_residue_PDB_ins_code 
_pdbx_modification_feature.modified_residue_symmetry 
_pdbx_modification_feature.comp_id_linking_atom 
_pdbx_modification_feature.modified_residue_id_linking_atom 
_pdbx_modification_feature.modified_residue_id 
_pdbx_modification_feature.ref_pcm_id 
_pdbx_modification_feature.ref_comp_id 
_pdbx_modification_feature.type 
_pdbx_modification_feature.category 
1 CYS A 7  ? CYS A 57 ? CYS A 7  ? 1_555 CYS A 57 ? 1_555 SG SG . . . None 'Disulfide bridge' 
2 CYS A 32 ? CYS A 53 ? CYS A 32 ? 1_555 CYS A 53 ? 1_555 SG SG . . . None 'Disulfide bridge' 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ASN A 22 ? ASP A 26 ? ASN A 22 ASP A 26 
A 2 SER A 31 ? PHE A 35 ? SER A 31 PHE A 35 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   TYR 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    24 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    TYR 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     24 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   LYS 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    33 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    LYS 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     33 
# 
_pdbx_entry_details.entry_id                   2KCR 
_pdbx_entry_details.compound_details           ? 
_pdbx_entry_details.source_details             ? 
_pdbx_entry_details.nonpolymer_details         ? 
_pdbx_entry_details.sequence_details           
;A SEQUENCE DATABASE REFERENCE FOR THIS PROTEIN 
DOES NOT CURRENTLY EXIST.
THIS SEQUENCE WILL BE DEPOSITED IN THE SEQUENCE DATABASE.
;
_pdbx_entry_details.has_ligand_of_interest     ? 
_pdbx_entry_details.has_protein_modification   Y 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1  HB2 A GLN 8  ? ? H   A LEU 9  ? ? 1.31 
2  1  O   A LEU 50 ? ? H   A GLU 54 ? ? 1.59 
3  2  O   A ALA 55 ? ? HG1 A THR 59 ? ? 1.54 
4  3  O   A ALA 55 ? ? HG1 A THR 59 ? ? 1.53 
5  3  O   A LEU 50 ? ? H   A GLU 54 ? ? 1.59 
6  4  HG3 A LYS 33 ? ? H   A THR 34 ? ? 1.26 
7  4  O   A ALA 55 ? ? HG1 A THR 59 ? ? 1.54 
8  5  HG3 A LYS 33 ? ? H   A THR 34 ? ? 1.31 
9  5  O   A ALA 55 ? ? HG1 A THR 59 ? ? 1.51 
10 5  O   A LEU 50 ? ? H   A GLU 54 ? ? 1.58 
11 6  O   A ALA 55 ? ? HG1 A THR 59 ? ? 1.55 
12 6  O   A LEU 50 ? ? H   A GLU 54 ? ? 1.57 
13 7  HG3 A LYS 33 ? ? H   A THR 34 ? ? 1.21 
14 7  HA2 A GLY 16 ? ? HG2 A ARG 38 ? ? 1.29 
15 7  O   A ALA 55 ? ? HG1 A THR 59 ? ? 1.53 
16 7  H   A TYR 23 ? ? O   A PHE 47 ? ? 1.59 
17 8  HA2 A GLY 16 ? ? HG2 A ARG 38 ? ? 1.17 
18 8  HG3 A LYS 33 ? ? H   A THR 34 ? ? 1.33 
19 8  O   A ALA 55 ? ? HG1 A THR 59 ? ? 1.54 
20 8  O   A LEU 50 ? ? H   A GLU 54 ? ? 1.59 
21 9  HG3 A LYS 33 ? ? H   A THR 34 ? ? 1.22 
22 9  O   A ALA 55 ? ? HG1 A THR 59 ? ? 1.55 
23 9  H   A TYR 23 ? ? O   A PHE 47 ? ? 1.58 
24 10 HG3 A LYS 33 ? ? H   A THR 34 ? ? 1.21 
25 10 HG3 A GLN 8  ? ? H   A LEU 9  ? ? 1.34 
26 10 O   A ALA 55 ? ? HG1 A THR 59 ? ? 1.53 
27 10 O   A LEU 50 ? ? H   A GLU 54 ? ? 1.58 
28 10 OD1 A ASP 4  ? ? H   A TYR 5  ? ? 1.59 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1  ALA A 2  ? ? -178.03 44.44   
2   1  GLN A 8  ? ? -121.18 -98.47  
3   1  LEU A 9  ? ? 50.22   -163.63 
4   1  ASN A 12 ? ? 66.48   -90.47  
5   1  TYR A 13 ? ? -177.74 -72.72  
6   1  LYS A 15 ? ? -53.41  -70.76  
7   1  SER A 19 ? ? 55.19   114.36  
8   1  THR A 21 ? ? 69.45   98.22   
9   1  TYR A 37 ? ? 70.57   -9.08   
10  1  ARG A 38 ? ? 76.07   -63.35  
11  1  SER A 40 ? ? -105.89 68.28   
12  2  GLN A 3  ? ? -54.59  -72.27  
13  2  ASP A 4  ? ? 172.05  -176.05 
14  2  GLN A 8  ? ? -167.06 -66.78  
15  2  LEU A 9  ? ? 49.37   -106.54 
16  2  ASN A 12 ? ? 52.48   -88.61  
17  2  TYR A 13 ? ? 179.28  -39.98  
18  2  LYS A 15 ? ? -64.88  -72.95  
19  2  SER A 17 ? ? -158.61 -72.91  
20  2  SER A 19 ? ? 52.83   -171.79 
21  2  PHE A 20 ? ? 174.54  -47.73  
22  2  THR A 21 ? ? 77.39   104.17  
23  2  TYR A 37 ? ? 69.44   -32.61  
24  2  SER A 40 ? ? -170.26 92.06   
25  2  ASN A 43 ? ? 70.17   132.29  
26  3  ALA A 2  ? ? -166.29 75.60   
27  3  GLN A 3  ? ? -86.12  -84.95  
28  3  ASP A 4  ? ? -178.81 -172.56 
29  3  GLN A 8  ? ? -157.67 -77.71  
30  3  LEU A 9  ? ? 52.17   -156.52 
31  3  ASN A 12 ? ? 58.41   -99.60  
32  3  TYR A 13 ? ? 179.05  -57.63  
33  3  SER A 19 ? ? 52.88   112.66  
34  3  THR A 21 ? ? 79.49   103.50  
35  3  LYS A 33 ? ? -113.07 -165.64 
36  3  TYR A 37 ? ? 77.15   -8.38   
37  3  ARG A 38 ? ? 73.09   -65.01  
38  3  SER A 40 ? ? 66.08   97.94   
39  3  ASN A 43 ? ? 57.29   80.77   
40  4  ALA A 2  ? ? 64.50   101.64  
41  4  GLN A 8  ? ? -146.26 -98.71  
42  4  LEU A 9  ? ? 45.57   -104.79 
43  4  ASN A 12 ? ? -71.37  -164.51 
44  4  TYR A 13 ? ? -165.66 -39.26  
45  4  LYS A 15 ? ? -110.76 -95.88  
46  4  SER A 17 ? ? -117.32 -91.19  
47  4  PHE A 20 ? ? -138.21 -150.96 
48  4  LYS A 33 ? ? -102.55 -167.65 
49  4  TYR A 37 ? ? 77.12   -36.54  
50  4  SER A 40 ? ? -176.86 -75.03  
51  5  GLN A 3  ? ? -87.42  -74.87  
52  5  ASP A 4  ? ? -159.77 -158.35 
53  5  GLN A 8  ? ? -120.67 -71.27  
54  5  LEU A 9  ? ? 52.95   -161.92 
55  5  SER A 19 ? ? 57.05   114.32  
56  5  THR A 21 ? ? 70.37   91.75   
57  5  TYR A 37 ? ? 71.87   -9.87   
58  5  ARG A 38 ? ? 73.23   -56.66  
59  5  SER A 40 ? ? -101.37 57.53   
60  6  GLN A 3  ? ? -75.19  -78.55  
61  6  ASP A 4  ? ? -152.99 -148.53 
62  6  SER A 10 ? ? 55.46   -91.79  
63  6  ARG A 11 ? ? -87.45  -152.28 
64  6  ASN A 12 ? ? -158.96 -97.56  
65  6  TYR A 13 ? ? 174.39  -43.19  
66  6  LYS A 15 ? ? -72.81  -85.73  
67  6  SER A 17 ? ? -107.67 -87.75  
68  6  SER A 19 ? ? -168.64 116.37  
69  6  THR A 21 ? ? 65.57   82.32   
70  6  TYR A 37 ? ? 81.04   -8.72   
71  6  ARG A 38 ? ? -113.54 77.93   
72  6  ARG A 46 ? ? 66.61   118.97  
73  7  GLN A 3  ? ? -78.78  -102.27 
74  7  ASP A 4  ? ? -133.44 -142.10 
75  7  GLN A 8  ? ? -137.98 -49.01  
76  7  LEU A 9  ? ? 59.21   -169.68 
77  7  ASN A 12 ? ? -171.96 -95.24  
78  7  TYR A 13 ? ? -178.64 -43.38  
79  7  PHE A 20 ? ? -127.33 -145.11 
80  7  SER A 31 ? ? -158.70 -158.45 
81  7  LYS A 33 ? ? -106.44 -164.71 
82  7  SER A 40 ? ? -140.79 22.53   
83  7  ASN A 45 ? ? 71.93   -43.49  
84  7  ARG A 46 ? ? 70.46   117.07  
85  8  GLN A 3  ? ? 65.75   -4.28   
86  8  TYR A 5  ? ? -148.95 -15.51  
87  8  TYR A 13 ? ? 170.47  -58.65  
88  8  LYS A 15 ? ? -87.94  -75.86  
89  8  SER A 19 ? ? -37.24  115.27  
90  8  PHE A 20 ? ? -124.51 -148.16 
91  8  TYR A 37 ? ? 76.03   -11.38  
92  8  ARG A 38 ? ? -108.33 72.89   
93  9  ALA A 2  ? ? 69.28   147.40  
94  9  GLN A 8  ? ? -162.11 -86.88  
95  9  LEU A 9  ? ? 53.01   -162.54 
96  9  ARG A 11 ? ? -74.51  -168.55 
97  9  ASN A 12 ? ? -166.67 -166.63 
98  9  TYR A 13 ? ? -154.14 -66.02  
99  9  THR A 21 ? ? 65.92   93.48   
100 9  LYS A 33 ? ? -126.23 -168.27 
101 9  TYR A 37 ? ? 72.30   -10.71  
102 9  ARG A 38 ? ? 77.00   -49.87  
103 9  SER A 40 ? ? -91.85  55.81   
104 10 GLN A 3  ? ? -86.88  -103.89 
105 10 ASP A 4  ? ? -177.90 -162.99 
106 10 GLN A 8  ? ? -97.98  -94.78  
107 10 LEU A 9  ? ? 48.23   -153.95 
108 10 ARG A 11 ? ? -77.18  -163.69 
109 10 LYS A 15 ? ? -106.84 -91.29  
110 10 SER A 17 ? ? -109.59 -85.09  
111 10 PHE A 20 ? ? -171.22 -154.37 
112 10 LYS A 33 ? ? -115.09 -164.07 
113 10 TYR A 37 ? ? 68.26   -33.71  
114 10 SER A 40 ? ? -157.68 86.61   
115 10 ASN A 45 ? ? 70.44   -45.83  
116 10 ARG A 46 ? ? 73.62   132.97  
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            200 
_pdbx_nmr_ensemble.conformers_submitted_total_number             10 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2KCR 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.representative_conformer                      1 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2KCR 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
'2mM protein-1, 90% H2O-2, 10% [U-2H] D2O-3, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' 
'2mM protein-4, 100% [U-2H] D2O-5, 100% D2O'                  2 '100% D2O'        
# 
loop_
_pdbx_nmr_exptl_sample.component 
_pdbx_nmr_exptl_sample.concentration 
_pdbx_nmr_exptl_sample.concentration_range 
_pdbx_nmr_exptl_sample.concentration_units 
_pdbx_nmr_exptl_sample.isotopic_labeling 
_pdbx_nmr_exptl_sample.solution_id 
protein-1 2   ? mM ?        1 
H2O-2     90  ? %  ?        1 
D2O-3     10  ? %  '[U-2H]' 1 
protein-4 2   ? mM ?        2 
D2O-5     100 ? %  '[U-2H]' 2 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      0 
_pdbx_nmr_exptl_sample_conditions.pH                  6.5 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1 1 '2D 1H-1H TOCSY' 
1 2 1 '2D 1H-1H NOESY' 
1 3 1 '2D DQF-COSY'    
1 4 2 '2D 1H-1H TOCSY' 
1 5 2 '2D 1H-1H NOESY' 
1 6 2 '2D 1H-1H COSY'  
# 
_pdbx_nmr_refine.entry_id           2KCR 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
;Linge, O'Donoghue, Nilges
;
'chemical shift assignment' ARIA   ? 1 
'Brunger, Adams, Clore, Gros, Nilges, Read' 'structure solution'        CNS    ? 2 
Goddard                                     'peak picking'              Sparky ? 3 
Goddard                                     'chemical shift assignment' Sparky ? 4 
'Brunger, Adams, Clore, Gros, Nilges, Read' refinement                  CNS    ? 5 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASN N    N N N 41  
ASN CA   C N S 42  
ASN C    C N N 43  
ASN O    O N N 44  
ASN CB   C N N 45  
ASN CG   C N N 46  
ASN OD1  O N N 47  
ASN ND2  N N N 48  
ASN OXT  O N N 49  
ASN H    H N N 50  
ASN H2   H N N 51  
ASN HA   H N N 52  
ASN HB2  H N N 53  
ASN HB3  H N N 54  
ASN HD21 H N N 55  
ASN HD22 H N N 56  
ASN HXT  H N N 57  
ASP N    N N N 58  
ASP CA   C N S 59  
ASP C    C N N 60  
ASP O    O N N 61  
ASP CB   C N N 62  
ASP CG   C N N 63  
ASP OD1  O N N 64  
ASP OD2  O N N 65  
ASP OXT  O N N 66  
ASP H    H N N 67  
ASP H2   H N N 68  
ASP HA   H N N 69  
ASP HB2  H N N 70  
ASP HB3  H N N 71  
ASP HD2  H N N 72  
ASP HXT  H N N 73  
CYS N    N N N 74  
CYS CA   C N R 75  
CYS C    C N N 76  
CYS O    O N N 77  
CYS CB   C N N 78  
CYS SG   S N N 79  
CYS OXT  O N N 80  
CYS H    H N N 81  
CYS H2   H N N 82  
CYS HA   H N N 83  
CYS HB2  H N N 84  
CYS HB3  H N N 85  
CYS HG   H N N 86  
CYS HXT  H N N 87  
GLN N    N N N 88  
GLN CA   C N S 89  
GLN C    C N N 90  
GLN O    O N N 91  
GLN CB   C N N 92  
GLN CG   C N N 93  
GLN CD   C N N 94  
GLN OE1  O N N 95  
GLN NE2  N N N 96  
GLN OXT  O N N 97  
GLN H    H N N 98  
GLN H2   H N N 99  
GLN HA   H N N 100 
GLN HB2  H N N 101 
GLN HB3  H N N 102 
GLN HG2  H N N 103 
GLN HG3  H N N 104 
GLN HE21 H N N 105 
GLN HE22 H N N 106 
GLN HXT  H N N 107 
GLU N    N N N 108 
GLU CA   C N S 109 
GLU C    C N N 110 
GLU O    O N N 111 
GLU CB   C N N 112 
GLU CG   C N N 113 
GLU CD   C N N 114 
GLU OE1  O N N 115 
GLU OE2  O N N 116 
GLU OXT  O N N 117 
GLU H    H N N 118 
GLU H2   H N N 119 
GLU HA   H N N 120 
GLU HB2  H N N 121 
GLU HB3  H N N 122 
GLU HG2  H N N 123 
GLU HG3  H N N 124 
GLU HE2  H N N 125 
GLU HXT  H N N 126 
GLY N    N N N 127 
GLY CA   C N N 128 
GLY C    C N N 129 
GLY O    O N N 130 
GLY OXT  O N N 131 
GLY H    H N N 132 
GLY H2   H N N 133 
GLY HA2  H N N 134 
GLY HA3  H N N 135 
GLY HXT  H N N 136 
LEU N    N N N 137 
LEU CA   C N S 138 
LEU C    C N N 139 
LEU O    O N N 140 
LEU CB   C N N 141 
LEU CG   C N N 142 
LEU CD1  C N N 143 
LEU CD2  C N N 144 
LEU OXT  O N N 145 
LEU H    H N N 146 
LEU H2   H N N 147 
LEU HA   H N N 148 
LEU HB2  H N N 149 
LEU HB3  H N N 150 
LEU HG   H N N 151 
LEU HD11 H N N 152 
LEU HD12 H N N 153 
LEU HD13 H N N 154 
LEU HD21 H N N 155 
LEU HD22 H N N 156 
LEU HD23 H N N 157 
LEU HXT  H N N 158 
LYS N    N N N 159 
LYS CA   C N S 160 
LYS C    C N N 161 
LYS O    O N N 162 
LYS CB   C N N 163 
LYS CG   C N N 164 
LYS CD   C N N 165 
LYS CE   C N N 166 
LYS NZ   N N N 167 
LYS OXT  O N N 168 
LYS H    H N N 169 
LYS H2   H N N 170 
LYS HA   H N N 171 
LYS HB2  H N N 172 
LYS HB3  H N N 173 
LYS HG2  H N N 174 
LYS HG3  H N N 175 
LYS HD2  H N N 176 
LYS HD3  H N N 177 
LYS HE2  H N N 178 
LYS HE3  H N N 179 
LYS HZ1  H N N 180 
LYS HZ2  H N N 181 
LYS HZ3  H N N 182 
LYS HXT  H N N 183 
PHE N    N N N 184 
PHE CA   C N S 185 
PHE C    C N N 186 
PHE O    O N N 187 
PHE CB   C N N 188 
PHE CG   C Y N 189 
PHE CD1  C Y N 190 
PHE CD2  C Y N 191 
PHE CE1  C Y N 192 
PHE CE2  C Y N 193 
PHE CZ   C Y N 194 
PHE OXT  O N N 195 
PHE H    H N N 196 
PHE H2   H N N 197 
PHE HA   H N N 198 
PHE HB2  H N N 199 
PHE HB3  H N N 200 
PHE HD1  H N N 201 
PHE HD2  H N N 202 
PHE HE1  H N N 203 
PHE HE2  H N N 204 
PHE HZ   H N N 205 
PHE HXT  H N N 206 
PRO N    N N N 207 
PRO CA   C N S 208 
PRO C    C N N 209 
PRO O    O N N 210 
PRO CB   C N N 211 
PRO CG   C N N 212 
PRO CD   C N N 213 
PRO OXT  O N N 214 
PRO H    H N N 215 
PRO HA   H N N 216 
PRO HB2  H N N 217 
PRO HB3  H N N 218 
PRO HG2  H N N 219 
PRO HG3  H N N 220 
PRO HD2  H N N 221 
PRO HD3  H N N 222 
PRO HXT  H N N 223 
SER N    N N N 224 
SER CA   C N S 225 
SER C    C N N 226 
SER O    O N N 227 
SER CB   C N N 228 
SER OG   O N N 229 
SER OXT  O N N 230 
SER H    H N N 231 
SER H2   H N N 232 
SER HA   H N N 233 
SER HB2  H N N 234 
SER HB3  H N N 235 
SER HG   H N N 236 
SER HXT  H N N 237 
THR N    N N N 238 
THR CA   C N S 239 
THR C    C N N 240 
THR O    O N N 241 
THR CB   C N R 242 
THR OG1  O N N 243 
THR CG2  C N N 244 
THR OXT  O N N 245 
THR H    H N N 246 
THR H2   H N N 247 
THR HA   H N N 248 
THR HB   H N N 249 
THR HG1  H N N 250 
THR HG21 H N N 251 
THR HG22 H N N 252 
THR HG23 H N N 253 
THR HXT  H N N 254 
TYR N    N N N 255 
TYR CA   C N S 256 
TYR C    C N N 257 
TYR O    O N N 258 
TYR CB   C N N 259 
TYR CG   C Y N 260 
TYR CD1  C Y N 261 
TYR CD2  C Y N 262 
TYR CE1  C Y N 263 
TYR CE2  C Y N 264 
TYR CZ   C Y N 265 
TYR OH   O N N 266 
TYR OXT  O N N 267 
TYR H    H N N 268 
TYR H2   H N N 269 
TYR HA   H N N 270 
TYR HB2  H N N 271 
TYR HB3  H N N 272 
TYR HD1  H N N 273 
TYR HD2  H N N 274 
TYR HE1  H N N 275 
TYR HE2  H N N 276 
TYR HH   H N N 277 
TYR HXT  H N N 278 
VAL N    N N N 279 
VAL CA   C N S 280 
VAL C    C N N 281 
VAL O    O N N 282 
VAL CB   C N N 283 
VAL CG1  C N N 284 
VAL CG2  C N N 285 
VAL OXT  O N N 286 
VAL H    H N N 287 
VAL H2   H N N 288 
VAL HA   H N N 289 
VAL HB   H N N 290 
VAL HG11 H N N 291 
VAL HG12 H N N 292 
VAL HG13 H N N 293 
VAL HG21 H N N 294 
VAL HG22 H N N 295 
VAL HG23 H N N 296 
VAL HXT  H N N 297 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
GLN N   CA   sing N N 83  
GLN N   H    sing N N 84  
GLN N   H2   sing N N 85  
GLN CA  C    sing N N 86  
GLN CA  CB   sing N N 87  
GLN CA  HA   sing N N 88  
GLN C   O    doub N N 89  
GLN C   OXT  sing N N 90  
GLN CB  CG   sing N N 91  
GLN CB  HB2  sing N N 92  
GLN CB  HB3  sing N N 93  
GLN CG  CD   sing N N 94  
GLN CG  HG2  sing N N 95  
GLN CG  HG3  sing N N 96  
GLN CD  OE1  doub N N 97  
GLN CD  NE2  sing N N 98  
GLN NE2 HE21 sing N N 99  
GLN NE2 HE22 sing N N 100 
GLN OXT HXT  sing N N 101 
GLU N   CA   sing N N 102 
GLU N   H    sing N N 103 
GLU N   H2   sing N N 104 
GLU CA  C    sing N N 105 
GLU CA  CB   sing N N 106 
GLU CA  HA   sing N N 107 
GLU C   O    doub N N 108 
GLU C   OXT  sing N N 109 
GLU CB  CG   sing N N 110 
GLU CB  HB2  sing N N 111 
GLU CB  HB3  sing N N 112 
GLU CG  CD   sing N N 113 
GLU CG  HG2  sing N N 114 
GLU CG  HG3  sing N N 115 
GLU CD  OE1  doub N N 116 
GLU CD  OE2  sing N N 117 
GLU OE2 HE2  sing N N 118 
GLU OXT HXT  sing N N 119 
GLY N   CA   sing N N 120 
GLY N   H    sing N N 121 
GLY N   H2   sing N N 122 
GLY CA  C    sing N N 123 
GLY CA  HA2  sing N N 124 
GLY CA  HA3  sing N N 125 
GLY C   O    doub N N 126 
GLY C   OXT  sing N N 127 
GLY OXT HXT  sing N N 128 
LEU N   CA   sing N N 129 
LEU N   H    sing N N 130 
LEU N   H2   sing N N 131 
LEU CA  C    sing N N 132 
LEU CA  CB   sing N N 133 
LEU CA  HA   sing N N 134 
LEU C   O    doub N N 135 
LEU C   OXT  sing N N 136 
LEU CB  CG   sing N N 137 
LEU CB  HB2  sing N N 138 
LEU CB  HB3  sing N N 139 
LEU CG  CD1  sing N N 140 
LEU CG  CD2  sing N N 141 
LEU CG  HG   sing N N 142 
LEU CD1 HD11 sing N N 143 
LEU CD1 HD12 sing N N 144 
LEU CD1 HD13 sing N N 145 
LEU CD2 HD21 sing N N 146 
LEU CD2 HD22 sing N N 147 
LEU CD2 HD23 sing N N 148 
LEU OXT HXT  sing N N 149 
LYS N   CA   sing N N 150 
LYS N   H    sing N N 151 
LYS N   H2   sing N N 152 
LYS CA  C    sing N N 153 
LYS CA  CB   sing N N 154 
LYS CA  HA   sing N N 155 
LYS C   O    doub N N 156 
LYS C   OXT  sing N N 157 
LYS CB  CG   sing N N 158 
LYS CB  HB2  sing N N 159 
LYS CB  HB3  sing N N 160 
LYS CG  CD   sing N N 161 
LYS CG  HG2  sing N N 162 
LYS CG  HG3  sing N N 163 
LYS CD  CE   sing N N 164 
LYS CD  HD2  sing N N 165 
LYS CD  HD3  sing N N 166 
LYS CE  NZ   sing N N 167 
LYS CE  HE2  sing N N 168 
LYS CE  HE3  sing N N 169 
LYS NZ  HZ1  sing N N 170 
LYS NZ  HZ2  sing N N 171 
LYS NZ  HZ3  sing N N 172 
LYS OXT HXT  sing N N 173 
PHE N   CA   sing N N 174 
PHE N   H    sing N N 175 
PHE N   H2   sing N N 176 
PHE CA  C    sing N N 177 
PHE CA  CB   sing N N 178 
PHE CA  HA   sing N N 179 
PHE C   O    doub N N 180 
PHE C   OXT  sing N N 181 
PHE CB  CG   sing N N 182 
PHE CB  HB2  sing N N 183 
PHE CB  HB3  sing N N 184 
PHE CG  CD1  doub Y N 185 
PHE CG  CD2  sing Y N 186 
PHE CD1 CE1  sing Y N 187 
PHE CD1 HD1  sing N N 188 
PHE CD2 CE2  doub Y N 189 
PHE CD2 HD2  sing N N 190 
PHE CE1 CZ   doub Y N 191 
PHE CE1 HE1  sing N N 192 
PHE CE2 CZ   sing Y N 193 
PHE CE2 HE2  sing N N 194 
PHE CZ  HZ   sing N N 195 
PHE OXT HXT  sing N N 196 
PRO N   CA   sing N N 197 
PRO N   CD   sing N N 198 
PRO N   H    sing N N 199 
PRO CA  C    sing N N 200 
PRO CA  CB   sing N N 201 
PRO CA  HA   sing N N 202 
PRO C   O    doub N N 203 
PRO C   OXT  sing N N 204 
PRO CB  CG   sing N N 205 
PRO CB  HB2  sing N N 206 
PRO CB  HB3  sing N N 207 
PRO CG  CD   sing N N 208 
PRO CG  HG2  sing N N 209 
PRO CG  HG3  sing N N 210 
PRO CD  HD2  sing N N 211 
PRO CD  HD3  sing N N 212 
PRO OXT HXT  sing N N 213 
SER N   CA   sing N N 214 
SER N   H    sing N N 215 
SER N   H2   sing N N 216 
SER CA  C    sing N N 217 
SER CA  CB   sing N N 218 
SER CA  HA   sing N N 219 
SER C   O    doub N N 220 
SER C   OXT  sing N N 221 
SER CB  OG   sing N N 222 
SER CB  HB2  sing N N 223 
SER CB  HB3  sing N N 224 
SER OG  HG   sing N N 225 
SER OXT HXT  sing N N 226 
THR N   CA   sing N N 227 
THR N   H    sing N N 228 
THR N   H2   sing N N 229 
THR CA  C    sing N N 230 
THR CA  CB   sing N N 231 
THR CA  HA   sing N N 232 
THR C   O    doub N N 233 
THR C   OXT  sing N N 234 
THR CB  OG1  sing N N 235 
THR CB  CG2  sing N N 236 
THR CB  HB   sing N N 237 
THR OG1 HG1  sing N N 238 
THR CG2 HG21 sing N N 239 
THR CG2 HG22 sing N N 240 
THR CG2 HG23 sing N N 241 
THR OXT HXT  sing N N 242 
TYR N   CA   sing N N 243 
TYR N   H    sing N N 244 
TYR N   H2   sing N N 245 
TYR CA  C    sing N N 246 
TYR CA  CB   sing N N 247 
TYR CA  HA   sing N N 248 
TYR C   O    doub N N 249 
TYR C   OXT  sing N N 250 
TYR CB  CG   sing N N 251 
TYR CB  HB2  sing N N 252 
TYR CB  HB3  sing N N 253 
TYR CG  CD1  doub Y N 254 
TYR CG  CD2  sing Y N 255 
TYR CD1 CE1  sing Y N 256 
TYR CD1 HD1  sing N N 257 
TYR CD2 CE2  doub Y N 258 
TYR CD2 HD2  sing N N 259 
TYR CE1 CZ   doub Y N 260 
TYR CE1 HE1  sing N N 261 
TYR CE2 CZ   sing Y N 262 
TYR CE2 HE2  sing N N 263 
TYR CZ  OH   sing N N 264 
TYR OH  HH   sing N N 265 
TYR OXT HXT  sing N N 266 
VAL N   CA   sing N N 267 
VAL N   H    sing N N 268 
VAL N   H2   sing N N 269 
VAL CA  C    sing N N 270 
VAL CA  CB   sing N N 271 
VAL CA  HA   sing N N 272 
VAL C   O    doub N N 273 
VAL C   OXT  sing N N 274 
VAL CB  CG1  sing N N 275 
VAL CB  CG2  sing N N 276 
VAL CB  HB   sing N N 277 
VAL CG1 HG11 sing N N 278 
VAL CG1 HG12 sing N N 279 
VAL CG1 HG13 sing N N 280 
VAL CG2 HG21 sing N N 281 
VAL CG2 HG22 sing N N 282 
VAL CG2 HG23 sing N N 283 
VAL OXT HXT  sing N N 284 
# 
_pdbx_nmr_spectrometer.field_strength    600 
_pdbx_nmr_spectrometer.manufacturer      Varian 
_pdbx_nmr_spectrometer.model             INOVA 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              'Varian INOVA' 
# 
_atom_sites.entry_id                    2KCR 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_