data_2KDB # _entry.id 2KDB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2KDB RCSB RCSB100978 WWPDB D_1000100978 # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id HT53A _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KDB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2009-01-06 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wu, B.' 1 'Yee, A.' 2 'Fares, C.' 3 'Lemak, A.' 4 'Gutmanas, A.' 5 'Doherty, R.' 6 'Semesi, A.' 7 'Dhe-Paganon, S.' 8 'Arrowsmith, C.' 9 'Northeast Structural Genomics Consortium (NESG)' 10 'Structural Genomics Consortium (SGC)' 11 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'Structure of human homocysteine-inducible, endoplasmic reticulum stress-inducible, ubiquitin-like domain member 2 (Herpud2 or Herp)' 'To be Published' ? ? ? ? ? ? ? 0353 ? ? ? 1 'A novel strategy for NMR resonance assignment and protein structure determination.' J.Biomol.Nmr 49 27 38 2011 JBNME9 NE 0925-2738 0800 ? 21161328 10.1007/s10858-010-9458-0 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Doherty, R.' 1 primary 'Wu, B.' 2 primary 'Fares, C.' 3 primary 'Lemak, A.' 4 primary 'Gutmanas, A.' 5 primary 'Semesi, A.' 6 primary 'Yee, A.' 7 primary 'Arrowsmith, C.H.' 8 primary 'Dhe-Paganon, S.' 9 1 'Lemak, A.' 10 1 'Gutmanas, A.' 11 1 'Chitayat, S.' 12 1 'Karra, M.' 13 1 'Fares, C.' 14 1 'Sunnerhagen, M.' 15 1 'Arrowsmith, C.H.' 16 # _cell.entry_id 2KDB _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2KDB _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein' _entity.formula_weight 11570.251 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'Ubiquitin-like domain, residues 9-85' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGRENLYFQGHPVTLIIKAPNQKYSDQTISCFLNWTVGKLKTHLSNVYPSKPLTKDQRLVYSGRLLPDH LQLKDILRKQDEYHMVHLV ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGRENLYFQGHPVTLIIKAPNQKYSDQTISCFLNWTVGKLKTHLSNVYPSKPLTKDQRLVYSGRLLPDH LQLKDILRKQDEYHMVHLV ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier HT53A # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 ARG n 1 15 GLU n 1 16 ASN n 1 17 LEU n 1 18 TYR n 1 19 PHE n 1 20 GLN n 1 21 GLY n 1 22 HIS n 1 23 PRO n 1 24 VAL n 1 25 THR n 1 26 LEU n 1 27 ILE n 1 28 ILE n 1 29 LYS n 1 30 ALA n 1 31 PRO n 1 32 ASN n 1 33 GLN n 1 34 LYS n 1 35 TYR n 1 36 SER n 1 37 ASP n 1 38 GLN n 1 39 THR n 1 40 ILE n 1 41 SER n 1 42 CYS n 1 43 PHE n 1 44 LEU n 1 45 ASN n 1 46 TRP n 1 47 THR n 1 48 VAL n 1 49 GLY n 1 50 LYS n 1 51 LEU n 1 52 LYS n 1 53 THR n 1 54 HIS n 1 55 LEU n 1 56 SER n 1 57 ASN n 1 58 VAL n 1 59 TYR n 1 60 PRO n 1 61 SER n 1 62 LYS n 1 63 PRO n 1 64 LEU n 1 65 THR n 1 66 LYS n 1 67 ASP n 1 68 GLN n 1 69 ARG n 1 70 LEU n 1 71 VAL n 1 72 TYR n 1 73 SER n 1 74 GLY n 1 75 ARG n 1 76 LEU n 1 77 LEU n 1 78 PRO n 1 79 ASP n 1 80 HIS n 1 81 LEU n 1 82 GLN n 1 83 LEU n 1 84 LYS n 1 85 ASP n 1 86 ILE n 1 87 LEU n 1 88 ARG n 1 89 LYS n 1 90 GLN n 1 91 ASP n 1 92 GLU n 1 93 TYR n 1 94 HIS n 1 95 MET n 1 96 VAL n 1 97 HIS n 1 98 LEU n 1 99 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene HERPUD2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'p15Tv lic' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code HERP2_HUMAN _struct_ref.pdbx_db_accession Q9BSE4 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code PVTLIIKAPNQKYSDQTISCFLNWTVGKLKTHLSNVYPSKPLTKDQRLVYSGRLLPDHLQLKDILRKQDEYHMVHLV _struct_ref.pdbx_align_begin 9 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KDB _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 23 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 99 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9BSE4 _struct_ref_seq.db_align_beg 9 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 85 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 77 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2KDB MET A 1 ? UNP Q9BSE4 ? ? 'expression tag' -21 1 1 2KDB GLY A 2 ? UNP Q9BSE4 ? ? 'expression tag' -20 2 1 2KDB SER A 3 ? UNP Q9BSE4 ? ? 'expression tag' -19 3 1 2KDB SER A 4 ? UNP Q9BSE4 ? ? 'expression tag' -18 4 1 2KDB HIS A 5 ? UNP Q9BSE4 ? ? 'expression tag' -17 5 1 2KDB HIS A 6 ? UNP Q9BSE4 ? ? 'expression tag' -16 6 1 2KDB HIS A 7 ? UNP Q9BSE4 ? ? 'expression tag' -15 7 1 2KDB HIS A 8 ? UNP Q9BSE4 ? ? 'expression tag' -14 8 1 2KDB HIS A 9 ? UNP Q9BSE4 ? ? 'expression tag' -13 9 1 2KDB HIS A 10 ? UNP Q9BSE4 ? ? 'expression tag' -12 10 1 2KDB SER A 11 ? UNP Q9BSE4 ? ? 'expression tag' -11 11 1 2KDB SER A 12 ? UNP Q9BSE4 ? ? 'expression tag' -10 12 1 2KDB GLY A 13 ? UNP Q9BSE4 ? ? 'expression tag' -9 13 1 2KDB ARG A 14 ? UNP Q9BSE4 ? ? 'expression tag' -8 14 1 2KDB GLU A 15 ? UNP Q9BSE4 ? ? 'expression tag' -7 15 1 2KDB ASN A 16 ? UNP Q9BSE4 ? ? 'expression tag' -6 16 1 2KDB LEU A 17 ? UNP Q9BSE4 ? ? 'expression tag' -5 17 1 2KDB TYR A 18 ? UNP Q9BSE4 ? ? 'expression tag' -4 18 1 2KDB PHE A 19 ? UNP Q9BSE4 ? ? 'expression tag' -3 19 1 2KDB GLN A 20 ? UNP Q9BSE4 ? ? 'expression tag' -2 20 1 2KDB GLY A 21 ? UNP Q9BSE4 ? ? 'expression tag' -1 21 1 2KDB HIS A 22 ? UNP Q9BSE4 ? ? 'expression tag' 0 22 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D HNCO' 1 2 1 '3D CBCA(CO)NH' 1 3 1 '3D HBHA(CO)NH' 1 4 1 '3D HNCA' 1 5 1 '3D HCCH-TOCSY' 1 6 1 '3D CCH-TOCSY' 1 7 1 '3D 1H-15N NOESY' 1 8 1 '3D 1H-13C NOESY' 2 9 2 '3D 1H-13C NOESY' 1 10 1 '3D 1H-13C NOESY aromatic' 3 11 3 '2D 1H-13C HSQC' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.temperature_units 1 300 7 ambient ? 298 K 2 300 7 ambient ? 298 K 3 300 7 ambient ? 298 K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;0.5 mM [U-100% 13C; U-100% 15N] humna ubiquitin-like domain of Herp-1, 10 mM [U-100% 2H] TRIS-2, 300 mM sodium chloride-3, 0.01 % sodium azide-4, 10 mM benzamidine-5, 90% H2O/10% D2O ; 1 '90% H2O/10% D2O' ;0.5 mM [U-100% 13C; U-100% 15N] humna ubiquitin-like domain of Herp-6, 10 mM [U-100% 2H] TRIS-7, 300 mM sodium chloride-8, 0.01 % sodium azide-9, 10 mM benzamidine-10, 100% D2O ; 2 '100% D2O' ;0.5 mM [U-7% 13C; U-100% 15N] humna ubiquitin-like domain of Herp-11, 10 mM [U-100% 2H] TRIS-12, 300 mM sodium chloride-13, 0.01 % sodium azide-14, 10 mM benzamidine-15, 90% H2O/10% D2O ; 3 '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Bruker Avance 1 'Bruker Avance' 800 Bruker Avance 2 'Bruker Avance' 500 Varian INOVA 3 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2KDB _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KDB _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KDB _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing MNRPipe 2.3 1 Goddard 'data analysis' SPARKY 3.95 2 Goddard 'peak picking' SPARKY 3.95 3 'Lemak and Arrowsmith' 'backbone assignment' FAWN 1.0 4 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 5 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 6 'Huang, Tejero, Powers and Montelione' 'nmr structure quality assessment' AutoStructure ? 7 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KDB _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KDB _struct.title 'Solution Structure of human ubiquitin-like domain of Herpud2_9_85, Northeast Structural Genomics Consortium (NESG) target HT53A' _struct.pdbx_descriptor 'Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KDB _struct_keywords.pdbx_keywords 'PROTEIN BINDING' _struct_keywords.text ;ubl domain, Membrane, Transmembrane, Unfolded protein response, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, Ontario Centre for Structural Proteomics, OCSP, unknown function, PROTEIN BINDING, SGC ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 47 ? TYR A 59 ? THR A 25 TYR A 37 1 ? 13 HELX_P HELX_P2 2 LEU A 83 ? ARG A 88 ? LEU A 61 ARG A 66 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLN A 38 ? CYS A 42 ? GLN A 16 CYS A 20 A 2 VAL A 24 ? LYS A 29 ? VAL A 2 LYS A 7 A 3 TYR A 93 ? LEU A 98 ? TYR A 71 LEU A 76 A 4 LEU A 70 ? TYR A 72 ? LEU A 48 TYR A 50 A 5 ARG A 75 ? LEU A 77 ? ARG A 53 LEU A 55 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O GLN A 38 ? O GLN A 16 N ILE A 28 ? N ILE A 6 A 2 3 N LYS A 29 ? N LYS A 7 O LEU A 98 ? O LEU A 76 A 3 4 O HIS A 97 ? O HIS A 75 N VAL A 71 ? N VAL A 49 A 4 5 N LEU A 70 ? N LEU A 48 O LEU A 77 ? O LEU A 55 # _atom_sites.entry_id 2KDB _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -21 ? ? ? A . n A 1 2 GLY 2 -20 ? ? ? A . n A 1 3 SER 3 -19 ? ? ? A . n A 1 4 SER 4 -18 ? ? ? A . n A 1 5 HIS 5 -17 ? ? ? A . n A 1 6 HIS 6 -16 ? ? ? A . n A 1 7 HIS 7 -15 ? ? ? A . n A 1 8 HIS 8 -14 ? ? ? A . n A 1 9 HIS 9 -13 ? ? ? A . n A 1 10 HIS 10 -12 ? ? ? A . n A 1 11 SER 11 -11 ? ? ? A . n A 1 12 SER 12 -10 ? ? ? A . n A 1 13 GLY 13 -9 ? ? ? A . n A 1 14 ARG 14 -8 ? ? ? A . n A 1 15 GLU 15 -7 ? ? ? A . n A 1 16 ASN 16 -6 ? ? ? A . n A 1 17 LEU 17 -5 ? ? ? A . n A 1 18 TYR 18 -4 ? ? ? A . n A 1 19 PHE 19 -3 ? ? ? A . n A 1 20 GLN 20 -2 ? ? ? A . n A 1 21 GLY 21 -1 ? ? ? A . n A 1 22 HIS 22 0 ? ? ? A . n A 1 23 PRO 23 1 1 PRO PRO A . n A 1 24 VAL 24 2 2 VAL VAL A . n A 1 25 THR 25 3 3 THR THR A . n A 1 26 LEU 26 4 4 LEU LEU A . n A 1 27 ILE 27 5 5 ILE ILE A . n A 1 28 ILE 28 6 6 ILE ILE A . n A 1 29 LYS 29 7 7 LYS LYS A . n A 1 30 ALA 30 8 8 ALA ALA A . n A 1 31 PRO 31 9 9 PRO PRO A . n A 1 32 ASN 32 10 10 ASN ASN A . n A 1 33 GLN 33 11 11 GLN GLN A . n A 1 34 LYS 34 12 12 LYS LYS A . n A 1 35 TYR 35 13 13 TYR TYR A . n A 1 36 SER 36 14 14 SER SER A . n A 1 37 ASP 37 15 15 ASP ASP A . n A 1 38 GLN 38 16 16 GLN GLN A . n A 1 39 THR 39 17 17 THR THR A . n A 1 40 ILE 40 18 18 ILE ILE A . n A 1 41 SER 41 19 19 SER SER A . n A 1 42 CYS 42 20 20 CYS CYS A . n A 1 43 PHE 43 21 21 PHE PHE A . n A 1 44 LEU 44 22 22 LEU LEU A . n A 1 45 ASN 45 23 23 ASN ASN A . n A 1 46 TRP 46 24 24 TRP TRP A . n A 1 47 THR 47 25 25 THR THR A . n A 1 48 VAL 48 26 26 VAL VAL A . n A 1 49 GLY 49 27 27 GLY GLY A . n A 1 50 LYS 50 28 28 LYS LYS A . n A 1 51 LEU 51 29 29 LEU LEU A . n A 1 52 LYS 52 30 30 LYS LYS A . n A 1 53 THR 53 31 31 THR THR A . n A 1 54 HIS 54 32 32 HIS HIS A . n A 1 55 LEU 55 33 33 LEU LEU A . n A 1 56 SER 56 34 34 SER SER A . n A 1 57 ASN 57 35 35 ASN ASN A . n A 1 58 VAL 58 36 36 VAL VAL A . n A 1 59 TYR 59 37 37 TYR TYR A . n A 1 60 PRO 60 38 38 PRO PRO A . n A 1 61 SER 61 39 39 SER SER A . n A 1 62 LYS 62 40 40 LYS LYS A . n A 1 63 PRO 63 41 41 PRO PRO A . n A 1 64 LEU 64 42 42 LEU LEU A . n A 1 65 THR 65 43 43 THR THR A . n A 1 66 LYS 66 44 44 LYS LYS A . n A 1 67 ASP 67 45 45 ASP ASP A . n A 1 68 GLN 68 46 46 GLN GLN A . n A 1 69 ARG 69 47 47 ARG ARG A . n A 1 70 LEU 70 48 48 LEU LEU A . n A 1 71 VAL 71 49 49 VAL VAL A . n A 1 72 TYR 72 50 50 TYR TYR A . n A 1 73 SER 73 51 51 SER SER A . n A 1 74 GLY 74 52 52 GLY GLY A . n A 1 75 ARG 75 53 53 ARG ARG A . n A 1 76 LEU 76 54 54 LEU LEU A . n A 1 77 LEU 77 55 55 LEU LEU A . n A 1 78 PRO 78 56 56 PRO PRO A . n A 1 79 ASP 79 57 57 ASP ASP A . n A 1 80 HIS 80 58 58 HIS HIS A . n A 1 81 LEU 81 59 59 LEU LEU A . n A 1 82 GLN 82 60 60 GLN GLN A . n A 1 83 LEU 83 61 61 LEU LEU A . n A 1 84 LYS 84 62 62 LYS LYS A . n A 1 85 ASP 85 63 63 ASP ASP A . n A 1 86 ILE 86 64 64 ILE ILE A . n A 1 87 LEU 87 65 65 LEU LEU A . n A 1 88 ARG 88 66 66 ARG ARG A . n A 1 89 LYS 89 67 67 LYS LYS A . n A 1 90 GLN 90 68 68 GLN GLN A . n A 1 91 ASP 91 69 69 ASP ASP A . n A 1 92 GLU 92 70 70 GLU GLU A . n A 1 93 TYR 93 71 71 TYR TYR A . n A 1 94 HIS 94 72 72 HIS HIS A . n A 1 95 MET 95 73 73 MET MET A . n A 1 96 VAL 96 74 74 VAL VAL A . n A 1 97 HIS 97 75 75 HIS HIS A . n A 1 98 LEU 98 76 76 LEU LEU A . n A 1 99 VAL 99 77 77 VAL VAL A . n # loop_ _pdbx_SG_project.full_name_of_center _pdbx_SG_project.id _pdbx_SG_project.initial_of_center _pdbx_SG_project.project_name 'Northeast Structural Genomics Consortium' 1 NESG 'PSI, Protein Structure Initiative' 'Structural Genomics Consortium' 2 SGC ? # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-02-10 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2012-05-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Database references' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'humna ubiquitin-like domain of Herp-1' 0.5 ? mM '[U-100% 13C; U-100% 15N]' 1 TRIS-2 10 ? mM '[U-100% 2H]' 1 'sodium chloride-3' 300 ? mM ? 1 'sodium azide-4' 0.01 ? % ? 1 benzamidine-5 10 ? mM ? 1 'humna ubiquitin-like domain of Herp-6' 0.5 ? mM '[U-100% 13C; U-100% 15N]' 2 TRIS-7 10 ? mM '[U-100% 2H]' 2 'sodium chloride-8' 300 ? mM ? 2 'sodium azide-9' 0.01 ? % ? 2 benzamidine-10 10 ? mM ? 2 'humna ubiquitin-like domain of Herp-11' 0.5 ? mM '[U-7% 13C; U-100% 15N]' 3 TRIS-12 10 ? mM '[U-100% 2H]' 3 'sodium chloride-13' 300 ? mM ? 3 'sodium azide-14' 0.01 ? % ? 3 benzamidine-15 10 ? mM ? 3 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 14 ? ? -68.81 -177.26 2 1 ASP A 69 ? ? 70.73 -55.61 3 2 ASP A 15 ? ? -57.83 102.47 4 2 SER A 51 ? ? 56.25 18.62 5 2 ASP A 69 ? ? 73.49 -55.84 6 3 ASP A 15 ? ? -58.74 100.25 7 3 LYS A 40 ? ? 56.08 78.16 8 3 ASP A 69 ? ? 75.49 -47.51 9 4 GLN A 11 ? ? 80.31 -48.63 10 4 LYS A 40 ? ? 60.84 65.57 11 4 PRO A 41 ? ? -48.24 100.07 12 4 ASP A 45 ? ? -125.65 -60.57 13 4 ASP A 69 ? ? 57.49 18.68 14 4 GLU A 70 ? ? -136.03 -63.90 15 5 SER A 14 ? ? -81.53 -157.88 16 5 LYS A 40 ? ? 51.31 73.13 17 5 ASP A 69 ? ? 67.31 -67.25 18 6 LYS A 40 ? ? 56.23 76.94 19 6 ASP A 69 ? ? 71.21 -24.45 20 6 GLU A 70 ? ? -92.16 -60.21 21 7 ASN A 10 ? ? -111.96 -72.01 22 7 GLN A 11 ? ? -170.44 36.14 23 7 SER A 14 ? ? -76.26 -162.51 24 7 ASP A 69 ? ? 63.40 -78.96 25 8 ASP A 15 ? ? -69.50 85.65 26 8 ASP A 69 ? ? 69.49 -64.39 27 9 ASP A 15 ? ? -61.83 95.91 28 9 ASP A 69 ? ? -27.19 104.96 29 9 GLU A 70 ? ? -164.98 -65.55 30 10 LYS A 40 ? ? 54.66 79.42 31 10 ASP A 69 ? ? 72.13 -59.28 32 11 LYS A 40 ? ? 58.18 72.24 33 11 ASP A 69 ? ? 74.80 -47.49 34 11 GLU A 70 ? ? -77.15 -93.61 35 12 GLN A 11 ? ? -39.84 88.97 36 12 ASP A 15 ? ? -56.47 86.81 37 12 LYS A 40 ? ? 53.19 82.00 38 12 SER A 51 ? ? 65.72 -2.45 39 12 ASP A 69 ? ? 73.58 -50.87 40 12 GLU A 70 ? ? -70.38 -93.91 41 13 ASP A 15 ? ? -68.10 93.41 42 13 LYS A 40 ? ? 55.91 73.02 43 13 SER A 51 ? ? 64.11 -0.82 44 14 LYS A 40 ? ? 52.58 74.54 45 14 ASP A 69 ? ? 72.56 -62.35 46 14 GLU A 70 ? ? -78.55 -78.29 47 15 ASN A 10 ? ? -121.15 -78.90 48 15 GLN A 11 ? ? -163.75 55.78 49 15 ASP A 15 ? ? -65.25 86.87 50 15 ASP A 69 ? ? 69.69 -65.67 51 15 GLU A 70 ? ? -68.31 -89.75 52 16 LYS A 40 ? ? 57.26 73.45 53 16 SER A 51 ? ? 52.33 19.13 54 16 ASP A 69 ? ? 71.12 -63.41 55 16 GLU A 70 ? ? -75.64 -90.88 56 17 GLN A 11 ? ? 77.46 -42.61 57 17 SER A 14 ? ? -77.24 -156.42 58 17 LYS A 40 ? ? 52.17 71.08 59 17 ASP A 69 ? ? 68.95 -68.32 60 17 GLU A 70 ? ? -46.34 -70.07 61 18 ASP A 15 ? ? 49.79 23.94 62 18 LYS A 40 ? ? 58.19 85.81 63 18 ASP A 69 ? ? 71.18 -65.54 64 18 GLU A 70 ? ? -73.74 -77.18 65 19 LYS A 40 ? ? 54.62 80.11 66 19 ASP A 69 ? ? 61.18 -70.54 67 19 GLU A 70 ? ? -59.84 -80.35 68 20 LYS A 40 ? ? 55.76 78.23 69 20 ASP A 69 ? ? 70.92 -65.56 70 20 GLU A 70 ? ? -69.57 -82.59 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -21 ? A MET 1 2 1 Y 1 A GLY -20 ? A GLY 2 3 1 Y 1 A SER -19 ? A SER 3 4 1 Y 1 A SER -18 ? A SER 4 5 1 Y 1 A HIS -17 ? A HIS 5 6 1 Y 1 A HIS -16 ? A HIS 6 7 1 Y 1 A HIS -15 ? A HIS 7 8 1 Y 1 A HIS -14 ? A HIS 8 9 1 Y 1 A HIS -13 ? A HIS 9 10 1 Y 1 A HIS -12 ? A HIS 10 11 1 Y 1 A SER -11 ? A SER 11 12 1 Y 1 A SER -10 ? A SER 12 13 1 Y 1 A GLY -9 ? A GLY 13 14 1 Y 1 A ARG -8 ? A ARG 14 15 1 Y 1 A GLU -7 ? A GLU 15 16 1 Y 1 A ASN -6 ? A ASN 16 17 1 Y 1 A LEU -5 ? A LEU 17 18 1 Y 1 A TYR -4 ? A TYR 18 19 1 Y 1 A PHE -3 ? A PHE 19 20 1 Y 1 A GLN -2 ? A GLN 20 21 1 Y 1 A GLY -1 ? A GLY 21 22 1 Y 1 A HIS 0 ? A HIS 22 23 2 Y 1 A MET -21 ? A MET 1 24 2 Y 1 A GLY -20 ? A GLY 2 25 2 Y 1 A SER -19 ? A SER 3 26 2 Y 1 A SER -18 ? A SER 4 27 2 Y 1 A HIS -17 ? A HIS 5 28 2 Y 1 A HIS -16 ? A HIS 6 29 2 Y 1 A HIS -15 ? A HIS 7 30 2 Y 1 A HIS -14 ? A HIS 8 31 2 Y 1 A HIS -13 ? A HIS 9 32 2 Y 1 A HIS -12 ? A HIS 10 33 2 Y 1 A SER -11 ? A SER 11 34 2 Y 1 A SER -10 ? A SER 12 35 2 Y 1 A GLY -9 ? A GLY 13 36 2 Y 1 A ARG -8 ? A ARG 14 37 2 Y 1 A GLU -7 ? A GLU 15 38 2 Y 1 A ASN -6 ? A ASN 16 39 2 Y 1 A LEU -5 ? A LEU 17 40 2 Y 1 A TYR -4 ? A TYR 18 41 2 Y 1 A PHE -3 ? A PHE 19 42 2 Y 1 A GLN -2 ? A GLN 20 43 2 Y 1 A GLY -1 ? A GLY 21 44 2 Y 1 A HIS 0 ? A HIS 22 45 3 Y 1 A MET -21 ? A MET 1 46 3 Y 1 A GLY -20 ? A GLY 2 47 3 Y 1 A SER -19 ? A SER 3 48 3 Y 1 A SER -18 ? A SER 4 49 3 Y 1 A HIS -17 ? A HIS 5 50 3 Y 1 A HIS -16 ? A HIS 6 51 3 Y 1 A HIS -15 ? A HIS 7 52 3 Y 1 A HIS -14 ? A HIS 8 53 3 Y 1 A HIS -13 ? A HIS 9 54 3 Y 1 A HIS -12 ? A HIS 10 55 3 Y 1 A SER -11 ? A SER 11 56 3 Y 1 A SER -10 ? A SER 12 57 3 Y 1 A GLY -9 ? A GLY 13 58 3 Y 1 A ARG -8 ? A ARG 14 59 3 Y 1 A GLU -7 ? A GLU 15 60 3 Y 1 A ASN -6 ? A ASN 16 61 3 Y 1 A LEU -5 ? A LEU 17 62 3 Y 1 A TYR -4 ? A TYR 18 63 3 Y 1 A PHE -3 ? A PHE 19 64 3 Y 1 A GLN -2 ? A GLN 20 65 3 Y 1 A GLY -1 ? A GLY 21 66 3 Y 1 A HIS 0 ? A HIS 22 67 4 Y 1 A MET -21 ? A MET 1 68 4 Y 1 A GLY -20 ? A GLY 2 69 4 Y 1 A SER -19 ? A SER 3 70 4 Y 1 A SER -18 ? A SER 4 71 4 Y 1 A HIS -17 ? A HIS 5 72 4 Y 1 A HIS -16 ? A HIS 6 73 4 Y 1 A HIS -15 ? A HIS 7 74 4 Y 1 A HIS -14 ? A HIS 8 75 4 Y 1 A HIS -13 ? A HIS 9 76 4 Y 1 A HIS -12 ? A HIS 10 77 4 Y 1 A SER -11 ? A SER 11 78 4 Y 1 A SER -10 ? A SER 12 79 4 Y 1 A GLY -9 ? A GLY 13 80 4 Y 1 A ARG -8 ? A ARG 14 81 4 Y 1 A GLU -7 ? A GLU 15 82 4 Y 1 A ASN -6 ? A ASN 16 83 4 Y 1 A LEU -5 ? A LEU 17 84 4 Y 1 A TYR -4 ? A TYR 18 85 4 Y 1 A PHE -3 ? A PHE 19 86 4 Y 1 A GLN -2 ? A GLN 20 87 4 Y 1 A GLY -1 ? A GLY 21 88 4 Y 1 A HIS 0 ? A HIS 22 89 5 Y 1 A MET -21 ? A MET 1 90 5 Y 1 A GLY -20 ? A GLY 2 91 5 Y 1 A SER -19 ? A SER 3 92 5 Y 1 A SER -18 ? A SER 4 93 5 Y 1 A HIS -17 ? A HIS 5 94 5 Y 1 A HIS -16 ? A HIS 6 95 5 Y 1 A HIS -15 ? A HIS 7 96 5 Y 1 A HIS -14 ? A HIS 8 97 5 Y 1 A HIS -13 ? A HIS 9 98 5 Y 1 A HIS -12 ? A HIS 10 99 5 Y 1 A SER -11 ? A SER 11 100 5 Y 1 A SER -10 ? A SER 12 101 5 Y 1 A GLY -9 ? A GLY 13 102 5 Y 1 A ARG -8 ? A ARG 14 103 5 Y 1 A GLU -7 ? A GLU 15 104 5 Y 1 A ASN -6 ? A ASN 16 105 5 Y 1 A LEU -5 ? A LEU 17 106 5 Y 1 A TYR -4 ? A TYR 18 107 5 Y 1 A PHE -3 ? A PHE 19 108 5 Y 1 A GLN -2 ? A GLN 20 109 5 Y 1 A GLY -1 ? A GLY 21 110 5 Y 1 A HIS 0 ? A HIS 22 111 6 Y 1 A MET -21 ? A MET 1 112 6 Y 1 A GLY -20 ? A GLY 2 113 6 Y 1 A SER -19 ? A SER 3 114 6 Y 1 A SER -18 ? A SER 4 115 6 Y 1 A HIS -17 ? A HIS 5 116 6 Y 1 A HIS -16 ? A HIS 6 117 6 Y 1 A HIS -15 ? A HIS 7 118 6 Y 1 A HIS -14 ? A HIS 8 119 6 Y 1 A HIS -13 ? A HIS 9 120 6 Y 1 A HIS -12 ? A HIS 10 121 6 Y 1 A SER -11 ? A SER 11 122 6 Y 1 A SER -10 ? A SER 12 123 6 Y 1 A GLY -9 ? A GLY 13 124 6 Y 1 A ARG -8 ? A ARG 14 125 6 Y 1 A GLU -7 ? A GLU 15 126 6 Y 1 A ASN -6 ? A ASN 16 127 6 Y 1 A LEU -5 ? A LEU 17 128 6 Y 1 A TYR -4 ? A TYR 18 129 6 Y 1 A PHE -3 ? A PHE 19 130 6 Y 1 A GLN -2 ? A GLN 20 131 6 Y 1 A GLY -1 ? A GLY 21 132 6 Y 1 A HIS 0 ? A HIS 22 133 7 Y 1 A MET -21 ? A MET 1 134 7 Y 1 A GLY -20 ? A GLY 2 135 7 Y 1 A SER -19 ? A SER 3 136 7 Y 1 A SER -18 ? A SER 4 137 7 Y 1 A HIS -17 ? A HIS 5 138 7 Y 1 A HIS -16 ? A HIS 6 139 7 Y 1 A HIS -15 ? A HIS 7 140 7 Y 1 A HIS -14 ? A HIS 8 141 7 Y 1 A HIS -13 ? A HIS 9 142 7 Y 1 A HIS -12 ? A HIS 10 143 7 Y 1 A SER -11 ? A SER 11 144 7 Y 1 A SER -10 ? A SER 12 145 7 Y 1 A GLY -9 ? A GLY 13 146 7 Y 1 A ARG -8 ? A ARG 14 147 7 Y 1 A GLU -7 ? A GLU 15 148 7 Y 1 A ASN -6 ? A ASN 16 149 7 Y 1 A LEU -5 ? A LEU 17 150 7 Y 1 A TYR -4 ? A TYR 18 151 7 Y 1 A PHE -3 ? A PHE 19 152 7 Y 1 A GLN -2 ? A GLN 20 153 7 Y 1 A GLY -1 ? A GLY 21 154 7 Y 1 A HIS 0 ? A HIS 22 155 8 Y 1 A MET -21 ? A MET 1 156 8 Y 1 A GLY -20 ? A GLY 2 157 8 Y 1 A SER -19 ? A SER 3 158 8 Y 1 A SER -18 ? A SER 4 159 8 Y 1 A HIS -17 ? A HIS 5 160 8 Y 1 A HIS -16 ? A HIS 6 161 8 Y 1 A HIS -15 ? A HIS 7 162 8 Y 1 A HIS -14 ? A HIS 8 163 8 Y 1 A HIS -13 ? A HIS 9 164 8 Y 1 A HIS -12 ? A HIS 10 165 8 Y 1 A SER -11 ? A SER 11 166 8 Y 1 A SER -10 ? A SER 12 167 8 Y 1 A GLY -9 ? A GLY 13 168 8 Y 1 A ARG -8 ? A ARG 14 169 8 Y 1 A GLU -7 ? A GLU 15 170 8 Y 1 A ASN -6 ? A ASN 16 171 8 Y 1 A LEU -5 ? A LEU 17 172 8 Y 1 A TYR -4 ? A TYR 18 173 8 Y 1 A PHE -3 ? A PHE 19 174 8 Y 1 A GLN -2 ? A GLN 20 175 8 Y 1 A GLY -1 ? A GLY 21 176 8 Y 1 A HIS 0 ? A HIS 22 177 9 Y 1 A MET -21 ? A MET 1 178 9 Y 1 A GLY -20 ? A GLY 2 179 9 Y 1 A SER -19 ? A SER 3 180 9 Y 1 A SER -18 ? A SER 4 181 9 Y 1 A HIS -17 ? A HIS 5 182 9 Y 1 A HIS -16 ? A HIS 6 183 9 Y 1 A HIS -15 ? A HIS 7 184 9 Y 1 A HIS -14 ? A HIS 8 185 9 Y 1 A HIS -13 ? A HIS 9 186 9 Y 1 A HIS -12 ? A HIS 10 187 9 Y 1 A SER -11 ? A SER 11 188 9 Y 1 A SER -10 ? A SER 12 189 9 Y 1 A GLY -9 ? A GLY 13 190 9 Y 1 A ARG -8 ? A ARG 14 191 9 Y 1 A GLU -7 ? A GLU 15 192 9 Y 1 A ASN -6 ? A ASN 16 193 9 Y 1 A LEU -5 ? A LEU 17 194 9 Y 1 A TYR -4 ? A TYR 18 195 9 Y 1 A PHE -3 ? A PHE 19 196 9 Y 1 A GLN -2 ? A GLN 20 197 9 Y 1 A GLY -1 ? A GLY 21 198 9 Y 1 A HIS 0 ? A HIS 22 199 10 Y 1 A MET -21 ? A MET 1 200 10 Y 1 A GLY -20 ? A GLY 2 201 10 Y 1 A SER -19 ? A SER 3 202 10 Y 1 A SER -18 ? A SER 4 203 10 Y 1 A HIS -17 ? A HIS 5 204 10 Y 1 A HIS -16 ? A HIS 6 205 10 Y 1 A HIS -15 ? A HIS 7 206 10 Y 1 A HIS -14 ? A HIS 8 207 10 Y 1 A HIS -13 ? A HIS 9 208 10 Y 1 A HIS -12 ? A HIS 10 209 10 Y 1 A SER -11 ? A SER 11 210 10 Y 1 A SER -10 ? A SER 12 211 10 Y 1 A GLY -9 ? A GLY 13 212 10 Y 1 A ARG -8 ? A ARG 14 213 10 Y 1 A GLU -7 ? A GLU 15 214 10 Y 1 A ASN -6 ? A ASN 16 215 10 Y 1 A LEU -5 ? A LEU 17 216 10 Y 1 A TYR -4 ? A TYR 18 217 10 Y 1 A PHE -3 ? A PHE 19 218 10 Y 1 A GLN -2 ? A GLN 20 219 10 Y 1 A GLY -1 ? A GLY 21 220 10 Y 1 A HIS 0 ? A HIS 22 221 11 Y 1 A MET -21 ? A MET 1 222 11 Y 1 A GLY -20 ? A GLY 2 223 11 Y 1 A SER -19 ? A SER 3 224 11 Y 1 A SER -18 ? A SER 4 225 11 Y 1 A HIS -17 ? A HIS 5 226 11 Y 1 A HIS -16 ? A HIS 6 227 11 Y 1 A HIS -15 ? A HIS 7 228 11 Y 1 A HIS -14 ? A HIS 8 229 11 Y 1 A HIS -13 ? A HIS 9 230 11 Y 1 A HIS -12 ? A HIS 10 231 11 Y 1 A SER -11 ? A SER 11 232 11 Y 1 A SER -10 ? A SER 12 233 11 Y 1 A GLY -9 ? A GLY 13 234 11 Y 1 A ARG -8 ? A ARG 14 235 11 Y 1 A GLU -7 ? A GLU 15 236 11 Y 1 A ASN -6 ? A ASN 16 237 11 Y 1 A LEU -5 ? A LEU 17 238 11 Y 1 A TYR -4 ? A TYR 18 239 11 Y 1 A PHE -3 ? A PHE 19 240 11 Y 1 A GLN -2 ? A GLN 20 241 11 Y 1 A GLY -1 ? A GLY 21 242 11 Y 1 A HIS 0 ? A HIS 22 243 12 Y 1 A MET -21 ? A MET 1 244 12 Y 1 A GLY -20 ? A GLY 2 245 12 Y 1 A SER -19 ? A SER 3 246 12 Y 1 A SER -18 ? A SER 4 247 12 Y 1 A HIS -17 ? A HIS 5 248 12 Y 1 A HIS -16 ? A HIS 6 249 12 Y 1 A HIS -15 ? A HIS 7 250 12 Y 1 A HIS -14 ? A HIS 8 251 12 Y 1 A HIS -13 ? A HIS 9 252 12 Y 1 A HIS -12 ? A HIS 10 253 12 Y 1 A SER -11 ? A SER 11 254 12 Y 1 A SER -10 ? A SER 12 255 12 Y 1 A GLY -9 ? A GLY 13 256 12 Y 1 A ARG -8 ? A ARG 14 257 12 Y 1 A GLU -7 ? A GLU 15 258 12 Y 1 A ASN -6 ? A ASN 16 259 12 Y 1 A LEU -5 ? A LEU 17 260 12 Y 1 A TYR -4 ? A TYR 18 261 12 Y 1 A PHE -3 ? A PHE 19 262 12 Y 1 A GLN -2 ? A GLN 20 263 12 Y 1 A GLY -1 ? A GLY 21 264 12 Y 1 A HIS 0 ? A HIS 22 265 13 Y 1 A MET -21 ? A MET 1 266 13 Y 1 A GLY -20 ? A GLY 2 267 13 Y 1 A SER -19 ? A SER 3 268 13 Y 1 A SER -18 ? A SER 4 269 13 Y 1 A HIS -17 ? A HIS 5 270 13 Y 1 A HIS -16 ? A HIS 6 271 13 Y 1 A HIS -15 ? A HIS 7 272 13 Y 1 A HIS -14 ? A HIS 8 273 13 Y 1 A HIS -13 ? A HIS 9 274 13 Y 1 A HIS -12 ? A HIS 10 275 13 Y 1 A SER -11 ? A SER 11 276 13 Y 1 A SER -10 ? A SER 12 277 13 Y 1 A GLY -9 ? A GLY 13 278 13 Y 1 A ARG -8 ? A ARG 14 279 13 Y 1 A GLU -7 ? A GLU 15 280 13 Y 1 A ASN -6 ? A ASN 16 281 13 Y 1 A LEU -5 ? A LEU 17 282 13 Y 1 A TYR -4 ? A TYR 18 283 13 Y 1 A PHE -3 ? A PHE 19 284 13 Y 1 A GLN -2 ? A GLN 20 285 13 Y 1 A GLY -1 ? A GLY 21 286 13 Y 1 A HIS 0 ? A HIS 22 287 14 Y 1 A MET -21 ? A MET 1 288 14 Y 1 A GLY -20 ? A GLY 2 289 14 Y 1 A SER -19 ? A SER 3 290 14 Y 1 A SER -18 ? A SER 4 291 14 Y 1 A HIS -17 ? A HIS 5 292 14 Y 1 A HIS -16 ? A HIS 6 293 14 Y 1 A HIS -15 ? A HIS 7 294 14 Y 1 A HIS -14 ? A HIS 8 295 14 Y 1 A HIS -13 ? A HIS 9 296 14 Y 1 A HIS -12 ? A HIS 10 297 14 Y 1 A SER -11 ? A SER 11 298 14 Y 1 A SER -10 ? A SER 12 299 14 Y 1 A GLY -9 ? A GLY 13 300 14 Y 1 A ARG -8 ? A ARG 14 301 14 Y 1 A GLU -7 ? A GLU 15 302 14 Y 1 A ASN -6 ? A ASN 16 303 14 Y 1 A LEU -5 ? A LEU 17 304 14 Y 1 A TYR -4 ? A TYR 18 305 14 Y 1 A PHE -3 ? A PHE 19 306 14 Y 1 A GLN -2 ? A GLN 20 307 14 Y 1 A GLY -1 ? A GLY 21 308 14 Y 1 A HIS 0 ? A HIS 22 309 15 Y 1 A MET -21 ? A MET 1 310 15 Y 1 A GLY -20 ? A GLY 2 311 15 Y 1 A SER -19 ? A SER 3 312 15 Y 1 A SER -18 ? A SER 4 313 15 Y 1 A HIS -17 ? A HIS 5 314 15 Y 1 A HIS -16 ? A HIS 6 315 15 Y 1 A HIS -15 ? A HIS 7 316 15 Y 1 A HIS -14 ? A HIS 8 317 15 Y 1 A HIS -13 ? A HIS 9 318 15 Y 1 A HIS -12 ? A HIS 10 319 15 Y 1 A SER -11 ? A SER 11 320 15 Y 1 A SER -10 ? A SER 12 321 15 Y 1 A GLY -9 ? A GLY 13 322 15 Y 1 A ARG -8 ? A ARG 14 323 15 Y 1 A GLU -7 ? A GLU 15 324 15 Y 1 A ASN -6 ? A ASN 16 325 15 Y 1 A LEU -5 ? A LEU 17 326 15 Y 1 A TYR -4 ? A TYR 18 327 15 Y 1 A PHE -3 ? A PHE 19 328 15 Y 1 A GLN -2 ? A GLN 20 329 15 Y 1 A GLY -1 ? A GLY 21 330 15 Y 1 A HIS 0 ? A HIS 22 331 16 Y 1 A MET -21 ? A MET 1 332 16 Y 1 A GLY -20 ? A GLY 2 333 16 Y 1 A SER -19 ? A SER 3 334 16 Y 1 A SER -18 ? A SER 4 335 16 Y 1 A HIS -17 ? A HIS 5 336 16 Y 1 A HIS -16 ? A HIS 6 337 16 Y 1 A HIS -15 ? A HIS 7 338 16 Y 1 A HIS -14 ? A HIS 8 339 16 Y 1 A HIS -13 ? A HIS 9 340 16 Y 1 A HIS -12 ? A HIS 10 341 16 Y 1 A SER -11 ? A SER 11 342 16 Y 1 A SER -10 ? A SER 12 343 16 Y 1 A GLY -9 ? A GLY 13 344 16 Y 1 A ARG -8 ? A ARG 14 345 16 Y 1 A GLU -7 ? A GLU 15 346 16 Y 1 A ASN -6 ? A ASN 16 347 16 Y 1 A LEU -5 ? A LEU 17 348 16 Y 1 A TYR -4 ? A TYR 18 349 16 Y 1 A PHE -3 ? A PHE 19 350 16 Y 1 A GLN -2 ? A GLN 20 351 16 Y 1 A GLY -1 ? A GLY 21 352 16 Y 1 A HIS 0 ? A HIS 22 353 17 Y 1 A MET -21 ? A MET 1 354 17 Y 1 A GLY -20 ? A GLY 2 355 17 Y 1 A SER -19 ? A SER 3 356 17 Y 1 A SER -18 ? A SER 4 357 17 Y 1 A HIS -17 ? A HIS 5 358 17 Y 1 A HIS -16 ? A HIS 6 359 17 Y 1 A HIS -15 ? A HIS 7 360 17 Y 1 A HIS -14 ? A HIS 8 361 17 Y 1 A HIS -13 ? A HIS 9 362 17 Y 1 A HIS -12 ? A HIS 10 363 17 Y 1 A SER -11 ? A SER 11 364 17 Y 1 A SER -10 ? A SER 12 365 17 Y 1 A GLY -9 ? A GLY 13 366 17 Y 1 A ARG -8 ? A ARG 14 367 17 Y 1 A GLU -7 ? A GLU 15 368 17 Y 1 A ASN -6 ? A ASN 16 369 17 Y 1 A LEU -5 ? A LEU 17 370 17 Y 1 A TYR -4 ? A TYR 18 371 17 Y 1 A PHE -3 ? A PHE 19 372 17 Y 1 A GLN -2 ? A GLN 20 373 17 Y 1 A GLY -1 ? A GLY 21 374 17 Y 1 A HIS 0 ? A HIS 22 375 18 Y 1 A MET -21 ? A MET 1 376 18 Y 1 A GLY -20 ? A GLY 2 377 18 Y 1 A SER -19 ? A SER 3 378 18 Y 1 A SER -18 ? A SER 4 379 18 Y 1 A HIS -17 ? A HIS 5 380 18 Y 1 A HIS -16 ? A HIS 6 381 18 Y 1 A HIS -15 ? A HIS 7 382 18 Y 1 A HIS -14 ? A HIS 8 383 18 Y 1 A HIS -13 ? A HIS 9 384 18 Y 1 A HIS -12 ? A HIS 10 385 18 Y 1 A SER -11 ? A SER 11 386 18 Y 1 A SER -10 ? A SER 12 387 18 Y 1 A GLY -9 ? A GLY 13 388 18 Y 1 A ARG -8 ? A ARG 14 389 18 Y 1 A GLU -7 ? A GLU 15 390 18 Y 1 A ASN -6 ? A ASN 16 391 18 Y 1 A LEU -5 ? A LEU 17 392 18 Y 1 A TYR -4 ? A TYR 18 393 18 Y 1 A PHE -3 ? A PHE 19 394 18 Y 1 A GLN -2 ? A GLN 20 395 18 Y 1 A GLY -1 ? A GLY 21 396 18 Y 1 A HIS 0 ? A HIS 22 397 19 Y 1 A MET -21 ? A MET 1 398 19 Y 1 A GLY -20 ? A GLY 2 399 19 Y 1 A SER -19 ? A SER 3 400 19 Y 1 A SER -18 ? A SER 4 401 19 Y 1 A HIS -17 ? A HIS 5 402 19 Y 1 A HIS -16 ? A HIS 6 403 19 Y 1 A HIS -15 ? A HIS 7 404 19 Y 1 A HIS -14 ? A HIS 8 405 19 Y 1 A HIS -13 ? A HIS 9 406 19 Y 1 A HIS -12 ? A HIS 10 407 19 Y 1 A SER -11 ? A SER 11 408 19 Y 1 A SER -10 ? A SER 12 409 19 Y 1 A GLY -9 ? A GLY 13 410 19 Y 1 A ARG -8 ? A ARG 14 411 19 Y 1 A GLU -7 ? A GLU 15 412 19 Y 1 A ASN -6 ? A ASN 16 413 19 Y 1 A LEU -5 ? A LEU 17 414 19 Y 1 A TYR -4 ? A TYR 18 415 19 Y 1 A PHE -3 ? A PHE 19 416 19 Y 1 A GLN -2 ? A GLN 20 417 19 Y 1 A GLY -1 ? A GLY 21 418 19 Y 1 A HIS 0 ? A HIS 22 419 20 Y 1 A MET -21 ? A MET 1 420 20 Y 1 A GLY -20 ? A GLY 2 421 20 Y 1 A SER -19 ? A SER 3 422 20 Y 1 A SER -18 ? A SER 4 423 20 Y 1 A HIS -17 ? A HIS 5 424 20 Y 1 A HIS -16 ? A HIS 6 425 20 Y 1 A HIS -15 ? A HIS 7 426 20 Y 1 A HIS -14 ? A HIS 8 427 20 Y 1 A HIS -13 ? A HIS 9 428 20 Y 1 A HIS -12 ? A HIS 10 429 20 Y 1 A SER -11 ? A SER 11 430 20 Y 1 A SER -10 ? A SER 12 431 20 Y 1 A GLY -9 ? A GLY 13 432 20 Y 1 A ARG -8 ? A ARG 14 433 20 Y 1 A GLU -7 ? A GLU 15 434 20 Y 1 A ASN -6 ? A ASN 16 435 20 Y 1 A LEU -5 ? A LEU 17 436 20 Y 1 A TYR -4 ? A TYR 18 437 20 Y 1 A PHE -3 ? A PHE 19 438 20 Y 1 A GLN -2 ? A GLN 20 439 20 Y 1 A GLY -1 ? A GLY 21 440 20 Y 1 A HIS 0 ? A HIS 22 #