data_2KIO
# 
_entry.id   2KIO 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.398 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2KIO         pdb_00002kio 10.2210/pdb2kio/pdb 
RCSB  RCSB101167   ?            ?                   
WWPDB D_1000101167 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-01-19 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-11-15 
4 'Structure model' 1 3 2024-11-06 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Database references'       
3 3 'Structure model' 'Derived calculations'      
4 4 'Structure model' 'Data collection'           
5 4 'Structure model' 'Database references'       
6 4 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  3 'Structure model' pdbx_database_related     
2  3 'Structure model' pdbx_struct_assembly      
3  3 'Structure model' pdbx_struct_assembly_prop 
4  3 'Structure model' pdbx_struct_oper_list     
5  4 'Structure model' chem_comp_atom            
6  4 'Structure model' chem_comp_bond            
7  4 'Structure model' database_2                
8  4 'Structure model' pdbx_entry_details        
9  4 'Structure model' pdbx_modification_feature 
10 4 'Structure model' pdbx_nmr_software         
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_pdbx_database_related.db_name'      
2 4 'Structure model' '_database_2.pdbx_DOI'                
3 4 'Structure model' '_database_2.pdbx_database_accession' 
4 4 'Structure model' '_pdbx_nmr_software.name'             
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2KIO 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2009-05-07 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 6228  BMRB 'oxidized yeast TOR1 FATC domain in solution at 298K'           
unspecified 1w1n  PDB  'oxidized yeast TOR1 FATC domain in solution at 298K'           
unspecified 16284 BMRB 'oxidized yeast TOR1 FATC domain bound to DPC micelles at 318K' 
unspecified 2kit  PDB  'reduced yeast TOR1 FATC domain bound to DPC micelles at 298K'  
unspecified 16295 BMRB 'reduced yeast TOR1 FATC domain bound to DPC micelles at 298K'  
# 
_audit_author.name           'Dames, S.A.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     
'Structural Basis for the Association of the Redox-sensitive Target of Rapamycin FATC Domain with Membrane-mimetic Micelles.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            285 
_citation.page_first                7766 
_citation.page_last                 7775 
_citation.year                      2010 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20042596 
_citation.pdbx_database_id_DOI      10.1074/jbc.M109.058404 
# 
_citation_author.citation_id        primary 
_citation_author.name               'Dames, S.A.' 
_citation_author.ordinal            1 
_citation_author.identifier_ORCID   ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Serine/threonine-protein kinase TOR1' 
_entity.formula_weight             3963.473 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    2.7.11.1 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'yeast TOR1 FATC domain' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'Phosphatidylinositol kinase homolog TOR1, Target of rapamycin kinase 1, Dominant rapamycin resistance protein 1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       NELDVPEQVDKLIQQATSIERLCQHYIGWCPFW 
_entity_poly.pdbx_seq_one_letter_code_can   NELDVPEQVDKLIQQATSIERLCQHYIGWCPFW 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ASN n 
1 2  GLU n 
1 3  LEU n 
1 4  ASP n 
1 5  VAL n 
1 6  PRO n 
1 7  GLU n 
1 8  GLN n 
1 9  VAL n 
1 10 ASP n 
1 11 LYS n 
1 12 LEU n 
1 13 ILE n 
1 14 GLN n 
1 15 GLN n 
1 16 ALA n 
1 17 THR n 
1 18 SER n 
1 19 ILE n 
1 20 GLU n 
1 21 ARG n 
1 22 LEU n 
1 23 CYS n 
1 24 GLN n 
1 25 HIS n 
1 26 TYR n 
1 27 ILE n 
1 28 GLY n 
1 29 TRP n 
1 30 CYS n 
1 31 PRO n 
1 32 PHE n 
1 33 TRP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               yeast 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'DRR1, J1803, TOR1, YJR066W' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Saccharomyces cerevisiae' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     4932 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              'Rosetta (DE3)' 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               pGEV2 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGEV2 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  ASN 1  1  1  ASN ASN A . n 
A 1 2  GLU 2  2  2  GLU GLU A . n 
A 1 3  LEU 3  3  3  LEU LEU A . n 
A 1 4  ASP 4  4  4  ASP ASP A . n 
A 1 5  VAL 5  5  5  VAL VAL A . n 
A 1 6  PRO 6  6  6  PRO PRO A . n 
A 1 7  GLU 7  7  7  GLU GLU A . n 
A 1 8  GLN 8  8  8  GLN GLN A . n 
A 1 9  VAL 9  9  9  VAL VAL A . n 
A 1 10 ASP 10 10 10 ASP ASP A . n 
A 1 11 LYS 11 11 11 LYS LYS A . n 
A 1 12 LEU 12 12 12 LEU LEU A . n 
A 1 13 ILE 13 13 13 ILE ILE A . n 
A 1 14 GLN 14 14 14 GLN GLN A . n 
A 1 15 GLN 15 15 15 GLN GLN A . n 
A 1 16 ALA 16 16 16 ALA ALA A . n 
A 1 17 THR 17 17 17 THR THR A . n 
A 1 18 SER 18 18 18 SER SER A . n 
A 1 19 ILE 19 19 19 ILE ILE A . n 
A 1 20 GLU 20 20 20 GLU GLU A . n 
A 1 21 ARG 21 21 21 ARG ARG A . n 
A 1 22 LEU 22 22 22 LEU LEU A . n 
A 1 23 CYS 23 23 23 CYS CYS A . n 
A 1 24 GLN 24 24 24 GLN GLN A . n 
A 1 25 HIS 25 25 25 HIS HIS A . n 
A 1 26 TYR 26 26 26 TYR TYR A . n 
A 1 27 ILE 27 27 27 ILE ILE A . n 
A 1 28 GLY 28 28 28 GLY GLY A . n 
A 1 29 TRP 29 29 29 TRP TRP A . n 
A 1 30 CYS 30 30 30 CYS CYS A . n 
A 1 31 PRO 31 31 31 PRO PRO A . n 
A 1 32 PHE 32 32 32 PHE PHE A . n 
A 1 33 TRP 33 33 33 TRP TRP A . n 
# 
_exptl.entry_id          2KIO 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2KIO 
_struct.title                     'NMR structure of the oxidized yeast TOR1 FATC domain bound to DPC micelles at 318K' 
_struct.pdbx_model_details        'lowest energy, model 1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2KIO 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
;protein, dpc micelle, membrane-mimetic, ATP-binding, Cell cycle, Cell membrane, Kinase, Membrane, Nucleotide-binding, Serine/threonine-protein kinase, Transferase, Vacuole
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    TOR1_YEAST 
_struct_ref.pdbx_db_accession          P35169 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   NELDVPEQVDKLIQQATSIERLCQHYIGWCPFW 
_struct_ref.pdbx_align_begin           2438 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2KIO 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 33 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P35169 
_struct_ref_seq.db_align_beg                  2438 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  2470 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       33 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 0    ? 
1 MORE         0    ? 
1 'SSA (A^2)'  3410 ? 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   ? 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       PRO 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        6 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       TYR 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        26 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        PRO 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         6 
_struct_conf.end_auth_comp_id        TYR 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         26 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            disulf1 
_struct_conn.conn_type_id                  disulf 
_struct_conn.pdbx_leaving_atom_flag        ? 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           A 
_struct_conn.ptnr1_label_comp_id           CYS 
_struct_conn.ptnr1_label_seq_id            23 
_struct_conn.ptnr1_label_atom_id           SG 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           A 
_struct_conn.ptnr2_label_comp_id           CYS 
_struct_conn.ptnr2_label_seq_id            30 
_struct_conn.ptnr2_label_atom_id           SG 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            A 
_struct_conn.ptnr1_auth_comp_id            CYS 
_struct_conn.ptnr1_auth_seq_id             23 
_struct_conn.ptnr2_auth_asym_id            A 
_struct_conn.ptnr2_auth_comp_id            CYS 
_struct_conn.ptnr2_auth_seq_id             30 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               2.021 
_struct_conn.pdbx_value_order              ? 
_struct_conn.pdbx_role                     ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_pdbx_modification_feature.ordinal                            1 
_pdbx_modification_feature.label_comp_id                      CYS 
_pdbx_modification_feature.label_asym_id                      A 
_pdbx_modification_feature.label_seq_id                       23 
_pdbx_modification_feature.label_alt_id                       ? 
_pdbx_modification_feature.modified_residue_label_comp_id     CYS 
_pdbx_modification_feature.modified_residue_label_asym_id     A 
_pdbx_modification_feature.modified_residue_label_seq_id      30 
_pdbx_modification_feature.modified_residue_label_alt_id      ? 
_pdbx_modification_feature.auth_comp_id                       CYS 
_pdbx_modification_feature.auth_asym_id                       A 
_pdbx_modification_feature.auth_seq_id                        23 
_pdbx_modification_feature.PDB_ins_code                       ? 
_pdbx_modification_feature.symmetry                           1_555 
_pdbx_modification_feature.modified_residue_auth_comp_id      CYS 
_pdbx_modification_feature.modified_residue_auth_asym_id      A 
_pdbx_modification_feature.modified_residue_auth_seq_id       30 
_pdbx_modification_feature.modified_residue_PDB_ins_code      ? 
_pdbx_modification_feature.modified_residue_symmetry          1_555 
_pdbx_modification_feature.comp_id_linking_atom               SG 
_pdbx_modification_feature.modified_residue_id_linking_atom   SG 
_pdbx_modification_feature.modified_residue_id                . 
_pdbx_modification_feature.ref_pcm_id                         . 
_pdbx_modification_feature.ref_comp_id                        . 
_pdbx_modification_feature.type                               None 
_pdbx_modification_feature.category                           'Disulfide bridge' 
# 
_pdbx_entry_details.entry_id                   2KIO 
_pdbx_entry_details.compound_details           ? 
_pdbx_entry_details.source_details             ? 
_pdbx_entry_details.nonpolymer_details         ? 
_pdbx_entry_details.sequence_details           ? 
_pdbx_entry_details.has_ligand_of_interest     ? 
_pdbx_entry_details.has_protein_modification   Y 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1  O A VAL 9  ? ? H   A ILE 13 ? ? 1.56 
2  2  O A LEU 3  ? ? H   A VAL 5  ? ? 1.53 
3  2  O A VAL 9  ? ? H   A ILE 13 ? ? 1.57 
4  3  O A LEU 12 ? ? H   A ALA 16 ? ? 1.55 
5  4  O A ASP 10 ? ? H   A GLN 14 ? ? 1.46 
6  4  O A CYS 23 ? ? H   A GLY 28 ? ? 1.54 
7  4  O A VAL 9  ? ? H   A ILE 13 ? ? 1.54 
8  4  O A ILE 13 ? ? H   A ALA 16 ? ? 1.55 
9  5  O A VAL 9  ? ? H   A ILE 13 ? ? 1.57 
10 5  O A LEU 22 ? ? H   A TYR 26 ? ? 1.58 
11 6  O A LYS 11 ? ? H   A GLN 15 ? ? 1.53 
12 6  O A SER 18 ? ? H   A LEU 22 ? ? 1.59 
13 7  O A LEU 22 ? ? H   A TYR 26 ? ? 1.44 
14 7  O A LYS 11 ? ? H   A GLN 15 ? ? 1.56 
15 7  O A VAL 9  ? ? H   A ILE 13 ? ? 1.57 
16 8  O A LEU 12 ? ? H   A ALA 16 ? ? 1.45 
17 8  O A THR 17 ? ? H   A GLU 20 ? ? 1.56 
18 8  O A VAL 9  ? ? H   A ILE 13 ? ? 1.59 
19 8  O A LEU 22 ? ? H   A TYR 26 ? ? 1.59 
20 9  O A LYS 11 ? ? H   A GLN 15 ? ? 1.53 
21 9  O A ASP 10 ? ? H   A GLN 14 ? ? 1.54 
22 10 O A LEU 22 ? ? H   A TYR 26 ? ? 1.45 
23 10 O A VAL 9  ? ? H   A ILE 13 ? ? 1.57 
24 12 O A VAL 9  ? ? H   A ILE 13 ? ? 1.57 
25 12 O A ILE 13 ? ? H   A ALA 16 ? ? 1.58 
26 13 O A LEU 22 ? ? H   A TYR 26 ? ? 1.51 
27 13 O A ASP 10 ? ? H   A GLN 14 ? ? 1.52 
28 13 O A VAL 9  ? ? H   A ILE 13 ? ? 1.53 
29 14 O A LEU 22 ? ? H   A TYR 26 ? ? 1.45 
30 14 O A VAL 9  ? ? H   A ILE 13 ? ? 1.53 
31 15 O A ASP 10 ? ? H   A GLN 14 ? ? 1.52 
32 15 O A VAL 9  ? ? H   A ILE 13 ? ? 1.55 
33 16 O A LEU 22 ? ? H   A TYR 26 ? ? 1.48 
34 16 O A SER 18 ? ? H   A LEU 22 ? ? 1.52 
35 16 O A LEU 3  ? ? H   A VAL 5  ? ? 1.52 
36 16 O A VAL 9  ? ? H   A ILE 13 ? ? 1.56 
37 16 O A ASP 10 ? ? H   A GLN 14 ? ? 1.58 
38 17 O A LYS 11 ? ? H   A GLN 15 ? ? 1.59 
39 17 O A SER 18 ? ? H   A LEU 22 ? ? 1.60 
40 18 O A LYS 11 ? ? H   A GLN 15 ? ? 1.58 
41 19 O A GLN 14 ? ? HG1 A THR 17 ? ? 1.41 
42 19 O A LEU 12 ? ? H   A ALA 16 ? ? 1.42 
43 19 O A CYS 23 ? ? H   A GLY 28 ? ? 1.49 
44 19 O A VAL 5  ? ? H   A GLU 7  ? ? 1.50 
45 19 O A LYS 11 ? ? H   A GLN 15 ? ? 1.53 
46 19 O A ARG 21 ? ? H   A HIS 25 ? ? 1.56 
47 19 O A VAL 9  ? ? H   A ILE 13 ? ? 1.58 
48 20 O A ASP 10 ? ? H   A GLN 14 ? ? 1.51 
49 20 O A LYS 11 ? ? H   A GLN 15 ? ? 1.54 
50 20 O A ILE 27 ? ? H   A TRP 29 ? ? 1.55 
51 20 O A LEU 22 ? ? H   A TYR 26 ? ? 1.58 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1  GLU A 2  ? ? -63.89  77.36   
2   1  GLU A 7  ? ? -93.94  -70.53  
3   1  SER A 18 ? ? -91.47  -68.31  
4   1  HIS A 25 ? ? -95.65  -70.16  
5   1  ILE A 27 ? ? -92.26  -80.64  
6   1  PHE A 32 ? ? -53.73  -7.27   
7   2  ASP A 4  ? ? -65.98  40.52   
8   2  GLN A 8  ? ? -48.10  -16.64  
9   2  THR A 17 ? ? -37.97  -25.78  
10  2  SER A 18 ? ? -83.56  -70.38  
11  2  CYS A 23 ? ? -43.43  -16.40  
12  2  HIS A 25 ? ? -92.75  -70.16  
13  2  ILE A 27 ? ? -94.13  -80.13  
14  2  PRO A 31 ? ? -39.48  -84.99  
15  2  PHE A 32 ? ? -172.65 66.71   
16  3  GLU A 2  ? ? -48.25  103.91  
17  3  PRO A 6  ? ? -52.38  84.01   
18  3  GLN A 8  ? ? -57.85  -9.36   
19  3  ALA A 16 ? ? -48.96  -9.53   
20  3  HIS A 25 ? ? -95.48  -67.92  
21  3  ILE A 27 ? ? -98.90  -81.05  
22  3  CYS A 30 ? ? -160.21 101.36  
23  3  PRO A 31 ? ? -41.81  -86.12  
24  3  PHE A 32 ? ? -178.50 74.21   
25  4  LEU A 3  ? ? -69.70  12.90   
26  4  ASP A 4  ? ? -71.53  38.00   
27  4  GLU A 7  ? ? -93.98  -71.24  
28  4  GLN A 8  ? ? -49.30  -19.67  
29  4  SER A 18 ? ? -64.89  -70.05  
30  4  HIS A 25 ? ? -91.66  -70.38  
31  4  ILE A 27 ? ? -85.75  -72.00  
32  4  TRP A 29 ? ? -170.04 120.20  
33  5  GLN A 8  ? ? -57.35  -9.97   
34  5  HIS A 25 ? ? -95.53  -61.58  
35  5  TYR A 26 ? ? -81.66  -73.89  
36  5  ILE A 27 ? ? -76.56  -79.53  
37  5  CYS A 30 ? ? -160.17 73.30   
38  5  PHE A 32 ? ? -56.61  -3.20   
39  6  LEU A 3  ? ? -66.04  12.02   
40  6  GLN A 8  ? ? -49.77  -12.93  
41  6  SER A 18 ? ? -63.02  -70.10  
42  6  HIS A 25 ? ? -95.32  -65.58  
43  6  ILE A 27 ? ? -97.22  -80.93  
44  6  CYS A 30 ? ? -155.11 69.48   
45  6  PHE A 32 ? ? -60.02  1.01    
46  7  ASP A 4  ? ? -115.50 69.61   
47  7  PRO A 6  ? ? -28.46  106.39  
48  7  GLU A 7  ? ? -95.43  -70.20  
49  7  TYR A 26 ? ? -92.94  -68.52  
50  7  ILE A 27 ? ? -82.07  -80.58  
51  7  CYS A 30 ? ? -160.70 109.00  
52  7  PRO A 31 ? ? -38.31  -102.31 
53  7  PHE A 32 ? ? -159.60 65.37   
54  8  LEU A 3  ? ? -50.33  -9.62   
55  8  PRO A 6  ? ? -50.74  82.92   
56  8  GLN A 8  ? ? -56.40  -9.44   
57  8  HIS A 25 ? ? -95.10  -62.24  
58  8  ILE A 27 ? ? -99.49  -81.04  
59  8  TRP A 29 ? ? -116.33 78.19   
60  8  CYS A 30 ? ? -150.51 69.21   
61  8  PHE A 32 ? ? -162.20 29.36   
62  9  GLU A 2  ? ? -48.71  167.80  
63  9  VAL A 9  ? ? -77.60  -70.04  
64  9  SER A 18 ? ? -62.63  -70.25  
65  9  CYS A 23 ? ? -46.06  -18.83  
66  9  HIS A 25 ? ? -96.07  -69.66  
67  9  PRO A 31 ? ? -36.78  -92.16  
68  9  PHE A 32 ? ? -174.26 69.49   
69  10 GLU A 2  ? ? -47.27  107.24  
70  10 LEU A 3  ? ? -59.23  -4.45   
71  10 GLN A 8  ? ? -56.72  -9.83   
72  10 SER A 18 ? ? -94.36  -70.72  
73  10 ILE A 19 ? ? -38.79  -31.91  
74  10 TYR A 26 ? ? -97.81  -76.84  
75  10 ILE A 27 ? ? -59.19  -80.26  
76  10 PRO A 31 ? ? -37.66  -94.01  
77  10 PHE A 32 ? ? -158.20 59.21   
78  11 GLU A 2  ? ? -61.66  98.06   
79  11 ASP A 4  ? ? -44.30  91.27   
80  11 PRO A 6  ? ? -49.97  108.00  
81  11 GLN A 8  ? ? -54.23  -9.90   
82  11 ILE A 19 ? ? -39.59  -26.83  
83  11 HIS A 25 ? ? -95.62  -65.60  
84  11 TYR A 26 ? ? -67.25  -72.02  
85  11 ILE A 27 ? ? -93.14  -81.17  
86  11 CYS A 30 ? ? -153.44 77.22   
87  11 PHE A 32 ? ? -55.86  -3.90   
88  12 GLU A 7  ? ? -95.68  -63.40  
89  12 GLN A 8  ? ? -54.71  -9.24   
90  12 VAL A 9  ? ? -85.70  -70.24  
91  12 THR A 17 ? ? -34.50  -30.12  
92  12 SER A 18 ? ? -89.32  -71.37  
93  12 ILE A 27 ? ? -100.51 -80.96  
94  13 LEU A 3  ? ? -66.07  6.01    
95  13 GLU A 7  ? ? -93.75  -67.63  
96  13 ALA A 16 ? ? -52.98  -9.55   
97  13 SER A 18 ? ? -95.80  -71.88  
98  13 TYR A 26 ? ? -87.34  -80.32  
99  13 PRO A 31 ? ? -34.24  -98.05  
100 13 PHE A 32 ? ? -172.08 70.29   
101 14 LEU A 3  ? ? -66.19  11.96   
102 14 PRO A 6  ? ? -36.41  97.32   
103 14 GLU A 7  ? ? -95.97  -65.44  
104 14 SER A 18 ? ? -69.05  -70.90  
105 15 GLN A 8  ? ? -48.84  -14.08  
106 15 SER A 18 ? ? -65.75  -71.00  
107 15 HIS A 25 ? ? -95.24  -69.09  
108 15 ILE A 27 ? ? -98.84  -80.84  
109 15 TRP A 29 ? ? -170.29 130.37  
110 15 PHE A 32 ? ? -158.52 28.11   
111 16 LEU A 3  ? ? -67.42  19.88   
112 16 ASP A 4  ? ? -67.01  58.08   
113 16 PRO A 6  ? ? -22.04  100.15  
114 16 SER A 18 ? ? -95.54  -67.83  
115 16 ILE A 19 ? ? -38.11  -28.27  
116 16 TYR A 26 ? ? -61.68  -77.46  
117 16 ILE A 27 ? ? -99.15  -80.78  
118 16 CYS A 30 ? ? -160.30 108.55  
119 16 PRO A 31 ? ? -40.12  -83.08  
120 16 PHE A 32 ? ? -176.23 71.21   
121 17 GLN A 8  ? ? -54.65  -9.62   
122 17 HIS A 25 ? ? -95.30  -68.53  
123 17 ILE A 27 ? ? -102.01 -80.70  
124 18 GLU A 2  ? ? -50.05  90.73   
125 18 ASP A 4  ? ? -83.46  47.53   
126 18 PRO A 6  ? ? -50.98  106.03  
127 18 GLN A 8  ? ? -54.89  -9.52   
128 18 HIS A 25 ? ? -95.49  -70.40  
129 18 ILE A 27 ? ? -90.74  -81.02  
130 18 TRP A 29 ? ? -165.95 116.74  
131 18 PRO A 31 ? ? -83.76  41.09   
132 18 PHE A 32 ? ? -160.19 27.80   
133 19 GLU A 2  ? ? -46.54  109.87  
134 19 ASP A 4  ? ? -100.44 56.73   
135 19 PRO A 6  ? ? -57.79  55.47   
136 19 GLN A 8  ? ? -55.62  -9.73   
137 19 ALA A 16 ? ? -53.02  -9.05   
138 19 SER A 18 ? ? -79.32  -70.81  
139 19 ILE A 27 ? ? -76.34  -76.05  
140 19 PRO A 31 ? ? -70.28  -89.64  
141 19 PHE A 32 ? ? -155.40 47.12   
142 20 GLU A 2  ? ? -159.07 84.62   
143 20 ASP A 4  ? ? -66.62  99.10   
144 20 GLU A 7  ? ? -85.33  -70.88  
145 20 ALA A 16 ? ? -46.33  -13.76  
146 20 SER A 18 ? ? -65.02  -70.63  
147 20 ILE A 19 ? ? -38.38  -30.11  
148 20 TYR A 26 ? ? -88.93  -80.91  
149 20 ILE A 27 ? ? -48.62  -19.72  
150 20 PRO A 31 ? ? -37.08  -105.65 
151 20 PHE A 32 ? ? -158.99 63.43   
# 
_pdbx_nmr_ensemble.entry_id                                      2KIO 
_pdbx_nmr_ensemble.conformers_calculated_total_number            200 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2KIO 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
1 '0.40-0.46 mM [U-13C; U-15N] y1fatc-1' ? 
2 '0.40 mM [U-13C; U-15N] y1fatc-2'      ? 
# 
loop_
_pdbx_nmr_exptl_sample.component 
_pdbx_nmr_exptl_sample.concentration 
_pdbx_nmr_exptl_sample.concentration_range 
_pdbx_nmr_exptl_sample.concentration_units 
_pdbx_nmr_exptl_sample.isotopic_labeling 
_pdbx_nmr_exptl_sample.solution_id 
y1fatc-1 ?    0.40-0.46 mM '[U-13C; U-15N]' 1 
y1fatc-2 0.40 ?         mM '[U-13C; U-15N]' 2 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         318 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  6.5 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      150 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1  1 '2D 1H-15N HSQC'              1 
2  1 '2D 1H-13C HSQC'              1 
3  1 '2D 1H-15N HSQC'              1 
4  1 '2D 1H-13C HSQC'              1 
5  1 '3D HNCA'                     1 
6  1 '3D HCCH-TOCSY'               1 
7  1 '3D 1H-15N NOESY'             1 
8  1 '3D 1H-13C NOESY'             1 
9  1 '3D 1H-13C NOESY'             2 
10 1 '3D HNHB'                     1 
11 1 
;13C'-{13Cg} SED 1H-15N HSQC
;
1 
12 1 '15N-{13Cg} SED 1H-15N HSQC'  1 
13 1 '{15N} SED 1H-13C HSQC'       1 
14 1 
;{13C'} SED 1H-13C HSQC
;
1 
15 1 '15N T1'                      1 
16 1 '15N T2'                      1 
17 1 '{1H}-15N-NOE'                1 
# 
_pdbx_nmr_constraints.disulfide_bond_constraints_total_count        1 
_pdbx_nmr_constraints.entry_id                                      2KIO 
_pdbx_nmr_constraints.hydrogen_bond_constraints_total_count         ? 
_pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count        ? 
_pdbx_nmr_constraints.NA_beta-angle_constraints_total_count         ? 
_pdbx_nmr_constraints.NA_chi-angle_constraints_total_count          ? 
_pdbx_nmr_constraints.NA_delta-angle_constraints_total_count        ? 
_pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count      ? 
_pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count        ? 
_pdbx_nmr_constraints.NA_other-angle_constraints_total_count        ? 
_pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count       ? 
_pdbx_nmr_constraints.NOE_constraints_total                         932 
_pdbx_nmr_constraints.NOE_interentity_total_count                   ? 
_pdbx_nmr_constraints.NOE_interproton_distance_evaluation           ? 
_pdbx_nmr_constraints.NOE_intraresidue_total_count                  ? 
_pdbx_nmr_constraints.NOE_long_range_total_count                    ? 
_pdbx_nmr_constraints.NOE_medium_range_total_count                  ? 
_pdbx_nmr_constraints.NOE_motional_averaging_correction             ? 
_pdbx_nmr_constraints.NOE_pseudoatom_corrections                    ? 
_pdbx_nmr_constraints.NOE_sequential_total_count                    ? 
_pdbx_nmr_constraints.protein_chi_angle_constraints_total_count     15 
_pdbx_nmr_constraints.protein_other_angle_constraints_total_count   ? 
_pdbx_nmr_constraints.protein_phi_angle_constraints_total_count     25 
_pdbx_nmr_constraints.protein_psi_angle_constraints_total_count     21 
# 
_pdbx_nmr_refine.entry_id           2KIO 
_pdbx_nmr_refine.method             'torsion angle dynamics, simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
'structure solution'              'X-PLOR NIH' 2.16.0   'Schwieters, Kuszewski, Tjandra and Clore'          1 
'chemical shift assignment'       NMRView      5.2.2_01 'Johnson, One Moon Scientific'                      2 
processing                        NMRPipe      ?        'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 3 
processing                        NMRDraw      ?        'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 4 
'structure analysis'              ProcheckNMR  ?        'Laskowski and MacArthur'                           5 
'structure visualization'         MOLMOL       ?        'Koradi, Billeter and Wuthrich'                     6 
processing                        XwinNMR      3.5      'Bruker Biospin'                                    7 
'analysis of 15n relaxation data' TENSOR2      2        'P. Dosset, D. Marion, M. Blackledge'               8 
refinement                        'X-PLOR NIH' 2.16.0   'Schwieters, Kuszewski, Tjandra and Clore'          9 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASN N    N N N 41  
ASN CA   C N S 42  
ASN C    C N N 43  
ASN O    O N N 44  
ASN CB   C N N 45  
ASN CG   C N N 46  
ASN OD1  O N N 47  
ASN ND2  N N N 48  
ASN OXT  O N N 49  
ASN H    H N N 50  
ASN H2   H N N 51  
ASN HA   H N N 52  
ASN HB2  H N N 53  
ASN HB3  H N N 54  
ASN HD21 H N N 55  
ASN HD22 H N N 56  
ASN HXT  H N N 57  
ASP N    N N N 58  
ASP CA   C N S 59  
ASP C    C N N 60  
ASP O    O N N 61  
ASP CB   C N N 62  
ASP CG   C N N 63  
ASP OD1  O N N 64  
ASP OD2  O N N 65  
ASP OXT  O N N 66  
ASP H    H N N 67  
ASP H2   H N N 68  
ASP HA   H N N 69  
ASP HB2  H N N 70  
ASP HB3  H N N 71  
ASP HD2  H N N 72  
ASP HXT  H N N 73  
CYS N    N N N 74  
CYS CA   C N R 75  
CYS C    C N N 76  
CYS O    O N N 77  
CYS CB   C N N 78  
CYS SG   S N N 79  
CYS OXT  O N N 80  
CYS H    H N N 81  
CYS H2   H N N 82  
CYS HA   H N N 83  
CYS HB2  H N N 84  
CYS HB3  H N N 85  
CYS HG   H N N 86  
CYS HXT  H N N 87  
GLN N    N N N 88  
GLN CA   C N S 89  
GLN C    C N N 90  
GLN O    O N N 91  
GLN CB   C N N 92  
GLN CG   C N N 93  
GLN CD   C N N 94  
GLN OE1  O N N 95  
GLN NE2  N N N 96  
GLN OXT  O N N 97  
GLN H    H N N 98  
GLN H2   H N N 99  
GLN HA   H N N 100 
GLN HB2  H N N 101 
GLN HB3  H N N 102 
GLN HG2  H N N 103 
GLN HG3  H N N 104 
GLN HE21 H N N 105 
GLN HE22 H N N 106 
GLN HXT  H N N 107 
GLU N    N N N 108 
GLU CA   C N S 109 
GLU C    C N N 110 
GLU O    O N N 111 
GLU CB   C N N 112 
GLU CG   C N N 113 
GLU CD   C N N 114 
GLU OE1  O N N 115 
GLU OE2  O N N 116 
GLU OXT  O N N 117 
GLU H    H N N 118 
GLU H2   H N N 119 
GLU HA   H N N 120 
GLU HB2  H N N 121 
GLU HB3  H N N 122 
GLU HG2  H N N 123 
GLU HG3  H N N 124 
GLU HE2  H N N 125 
GLU HXT  H N N 126 
GLY N    N N N 127 
GLY CA   C N N 128 
GLY C    C N N 129 
GLY O    O N N 130 
GLY OXT  O N N 131 
GLY H    H N N 132 
GLY H2   H N N 133 
GLY HA2  H N N 134 
GLY HA3  H N N 135 
GLY HXT  H N N 136 
HIS N    N N N 137 
HIS CA   C N S 138 
HIS C    C N N 139 
HIS O    O N N 140 
HIS CB   C N N 141 
HIS CG   C Y N 142 
HIS ND1  N Y N 143 
HIS CD2  C Y N 144 
HIS CE1  C Y N 145 
HIS NE2  N Y N 146 
HIS OXT  O N N 147 
HIS H    H N N 148 
HIS H2   H N N 149 
HIS HA   H N N 150 
HIS HB2  H N N 151 
HIS HB3  H N N 152 
HIS HD1  H N N 153 
HIS HD2  H N N 154 
HIS HE1  H N N 155 
HIS HE2  H N N 156 
HIS HXT  H N N 157 
ILE N    N N N 158 
ILE CA   C N S 159 
ILE C    C N N 160 
ILE O    O N N 161 
ILE CB   C N S 162 
ILE CG1  C N N 163 
ILE CG2  C N N 164 
ILE CD1  C N N 165 
ILE OXT  O N N 166 
ILE H    H N N 167 
ILE H2   H N N 168 
ILE HA   H N N 169 
ILE HB   H N N 170 
ILE HG12 H N N 171 
ILE HG13 H N N 172 
ILE HG21 H N N 173 
ILE HG22 H N N 174 
ILE HG23 H N N 175 
ILE HD11 H N N 176 
ILE HD12 H N N 177 
ILE HD13 H N N 178 
ILE HXT  H N N 179 
LEU N    N N N 180 
LEU CA   C N S 181 
LEU C    C N N 182 
LEU O    O N N 183 
LEU CB   C N N 184 
LEU CG   C N N 185 
LEU CD1  C N N 186 
LEU CD2  C N N 187 
LEU OXT  O N N 188 
LEU H    H N N 189 
LEU H2   H N N 190 
LEU HA   H N N 191 
LEU HB2  H N N 192 
LEU HB3  H N N 193 
LEU HG   H N N 194 
LEU HD11 H N N 195 
LEU HD12 H N N 196 
LEU HD13 H N N 197 
LEU HD21 H N N 198 
LEU HD22 H N N 199 
LEU HD23 H N N 200 
LEU HXT  H N N 201 
LYS N    N N N 202 
LYS CA   C N S 203 
LYS C    C N N 204 
LYS O    O N N 205 
LYS CB   C N N 206 
LYS CG   C N N 207 
LYS CD   C N N 208 
LYS CE   C N N 209 
LYS NZ   N N N 210 
LYS OXT  O N N 211 
LYS H    H N N 212 
LYS H2   H N N 213 
LYS HA   H N N 214 
LYS HB2  H N N 215 
LYS HB3  H N N 216 
LYS HG2  H N N 217 
LYS HG3  H N N 218 
LYS HD2  H N N 219 
LYS HD3  H N N 220 
LYS HE2  H N N 221 
LYS HE3  H N N 222 
LYS HZ1  H N N 223 
LYS HZ2  H N N 224 
LYS HZ3  H N N 225 
LYS HXT  H N N 226 
PHE N    N N N 227 
PHE CA   C N S 228 
PHE C    C N N 229 
PHE O    O N N 230 
PHE CB   C N N 231 
PHE CG   C Y N 232 
PHE CD1  C Y N 233 
PHE CD2  C Y N 234 
PHE CE1  C Y N 235 
PHE CE2  C Y N 236 
PHE CZ   C Y N 237 
PHE OXT  O N N 238 
PHE H    H N N 239 
PHE H2   H N N 240 
PHE HA   H N N 241 
PHE HB2  H N N 242 
PHE HB3  H N N 243 
PHE HD1  H N N 244 
PHE HD2  H N N 245 
PHE HE1  H N N 246 
PHE HE2  H N N 247 
PHE HZ   H N N 248 
PHE HXT  H N N 249 
PRO N    N N N 250 
PRO CA   C N S 251 
PRO C    C N N 252 
PRO O    O N N 253 
PRO CB   C N N 254 
PRO CG   C N N 255 
PRO CD   C N N 256 
PRO OXT  O N N 257 
PRO H    H N N 258 
PRO HA   H N N 259 
PRO HB2  H N N 260 
PRO HB3  H N N 261 
PRO HG2  H N N 262 
PRO HG3  H N N 263 
PRO HD2  H N N 264 
PRO HD3  H N N 265 
PRO HXT  H N N 266 
SER N    N N N 267 
SER CA   C N S 268 
SER C    C N N 269 
SER O    O N N 270 
SER CB   C N N 271 
SER OG   O N N 272 
SER OXT  O N N 273 
SER H    H N N 274 
SER H2   H N N 275 
SER HA   H N N 276 
SER HB2  H N N 277 
SER HB3  H N N 278 
SER HG   H N N 279 
SER HXT  H N N 280 
THR N    N N N 281 
THR CA   C N S 282 
THR C    C N N 283 
THR O    O N N 284 
THR CB   C N R 285 
THR OG1  O N N 286 
THR CG2  C N N 287 
THR OXT  O N N 288 
THR H    H N N 289 
THR H2   H N N 290 
THR HA   H N N 291 
THR HB   H N N 292 
THR HG1  H N N 293 
THR HG21 H N N 294 
THR HG22 H N N 295 
THR HG23 H N N 296 
THR HXT  H N N 297 
TRP N    N N N 298 
TRP CA   C N S 299 
TRP C    C N N 300 
TRP O    O N N 301 
TRP CB   C N N 302 
TRP CG   C Y N 303 
TRP CD1  C Y N 304 
TRP CD2  C Y N 305 
TRP NE1  N Y N 306 
TRP CE2  C Y N 307 
TRP CE3  C Y N 308 
TRP CZ2  C Y N 309 
TRP CZ3  C Y N 310 
TRP CH2  C Y N 311 
TRP OXT  O N N 312 
TRP H    H N N 313 
TRP H2   H N N 314 
TRP HA   H N N 315 
TRP HB2  H N N 316 
TRP HB3  H N N 317 
TRP HD1  H N N 318 
TRP HE1  H N N 319 
TRP HE3  H N N 320 
TRP HZ2  H N N 321 
TRP HZ3  H N N 322 
TRP HH2  H N N 323 
TRP HXT  H N N 324 
TYR N    N N N 325 
TYR CA   C N S 326 
TYR C    C N N 327 
TYR O    O N N 328 
TYR CB   C N N 329 
TYR CG   C Y N 330 
TYR CD1  C Y N 331 
TYR CD2  C Y N 332 
TYR CE1  C Y N 333 
TYR CE2  C Y N 334 
TYR CZ   C Y N 335 
TYR OH   O N N 336 
TYR OXT  O N N 337 
TYR H    H N N 338 
TYR H2   H N N 339 
TYR HA   H N N 340 
TYR HB2  H N N 341 
TYR HB3  H N N 342 
TYR HD1  H N N 343 
TYR HD2  H N N 344 
TYR HE1  H N N 345 
TYR HE2  H N N 346 
TYR HH   H N N 347 
TYR HXT  H N N 348 
VAL N    N N N 349 
VAL CA   C N S 350 
VAL C    C N N 351 
VAL O    O N N 352 
VAL CB   C N N 353 
VAL CG1  C N N 354 
VAL CG2  C N N 355 
VAL OXT  O N N 356 
VAL H    H N N 357 
VAL H2   H N N 358 
VAL HA   H N N 359 
VAL HB   H N N 360 
VAL HG11 H N N 361 
VAL HG12 H N N 362 
VAL HG13 H N N 363 
VAL HG21 H N N 364 
VAL HG22 H N N 365 
VAL HG23 H N N 366 
VAL HXT  H N N 367 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
GLN N   CA   sing N N 83  
GLN N   H    sing N N 84  
GLN N   H2   sing N N 85  
GLN CA  C    sing N N 86  
GLN CA  CB   sing N N 87  
GLN CA  HA   sing N N 88  
GLN C   O    doub N N 89  
GLN C   OXT  sing N N 90  
GLN CB  CG   sing N N 91  
GLN CB  HB2  sing N N 92  
GLN CB  HB3  sing N N 93  
GLN CG  CD   sing N N 94  
GLN CG  HG2  sing N N 95  
GLN CG  HG3  sing N N 96  
GLN CD  OE1  doub N N 97  
GLN CD  NE2  sing N N 98  
GLN NE2 HE21 sing N N 99  
GLN NE2 HE22 sing N N 100 
GLN OXT HXT  sing N N 101 
GLU N   CA   sing N N 102 
GLU N   H    sing N N 103 
GLU N   H2   sing N N 104 
GLU CA  C    sing N N 105 
GLU CA  CB   sing N N 106 
GLU CA  HA   sing N N 107 
GLU C   O    doub N N 108 
GLU C   OXT  sing N N 109 
GLU CB  CG   sing N N 110 
GLU CB  HB2  sing N N 111 
GLU CB  HB3  sing N N 112 
GLU CG  CD   sing N N 113 
GLU CG  HG2  sing N N 114 
GLU CG  HG3  sing N N 115 
GLU CD  OE1  doub N N 116 
GLU CD  OE2  sing N N 117 
GLU OE2 HE2  sing N N 118 
GLU OXT HXT  sing N N 119 
GLY N   CA   sing N N 120 
GLY N   H    sing N N 121 
GLY N   H2   sing N N 122 
GLY CA  C    sing N N 123 
GLY CA  HA2  sing N N 124 
GLY CA  HA3  sing N N 125 
GLY C   O    doub N N 126 
GLY C   OXT  sing N N 127 
GLY OXT HXT  sing N N 128 
HIS N   CA   sing N N 129 
HIS N   H    sing N N 130 
HIS N   H2   sing N N 131 
HIS CA  C    sing N N 132 
HIS CA  CB   sing N N 133 
HIS CA  HA   sing N N 134 
HIS C   O    doub N N 135 
HIS C   OXT  sing N N 136 
HIS CB  CG   sing N N 137 
HIS CB  HB2  sing N N 138 
HIS CB  HB3  sing N N 139 
HIS CG  ND1  sing Y N 140 
HIS CG  CD2  doub Y N 141 
HIS ND1 CE1  doub Y N 142 
HIS ND1 HD1  sing N N 143 
HIS CD2 NE2  sing Y N 144 
HIS CD2 HD2  sing N N 145 
HIS CE1 NE2  sing Y N 146 
HIS CE1 HE1  sing N N 147 
HIS NE2 HE2  sing N N 148 
HIS OXT HXT  sing N N 149 
ILE N   CA   sing N N 150 
ILE N   H    sing N N 151 
ILE N   H2   sing N N 152 
ILE CA  C    sing N N 153 
ILE CA  CB   sing N N 154 
ILE CA  HA   sing N N 155 
ILE C   O    doub N N 156 
ILE C   OXT  sing N N 157 
ILE CB  CG1  sing N N 158 
ILE CB  CG2  sing N N 159 
ILE CB  HB   sing N N 160 
ILE CG1 CD1  sing N N 161 
ILE CG1 HG12 sing N N 162 
ILE CG1 HG13 sing N N 163 
ILE CG2 HG21 sing N N 164 
ILE CG2 HG22 sing N N 165 
ILE CG2 HG23 sing N N 166 
ILE CD1 HD11 sing N N 167 
ILE CD1 HD12 sing N N 168 
ILE CD1 HD13 sing N N 169 
ILE OXT HXT  sing N N 170 
LEU N   CA   sing N N 171 
LEU N   H    sing N N 172 
LEU N   H2   sing N N 173 
LEU CA  C    sing N N 174 
LEU CA  CB   sing N N 175 
LEU CA  HA   sing N N 176 
LEU C   O    doub N N 177 
LEU C   OXT  sing N N 178 
LEU CB  CG   sing N N 179 
LEU CB  HB2  sing N N 180 
LEU CB  HB3  sing N N 181 
LEU CG  CD1  sing N N 182 
LEU CG  CD2  sing N N 183 
LEU CG  HG   sing N N 184 
LEU CD1 HD11 sing N N 185 
LEU CD1 HD12 sing N N 186 
LEU CD1 HD13 sing N N 187 
LEU CD2 HD21 sing N N 188 
LEU CD2 HD22 sing N N 189 
LEU CD2 HD23 sing N N 190 
LEU OXT HXT  sing N N 191 
LYS N   CA   sing N N 192 
LYS N   H    sing N N 193 
LYS N   H2   sing N N 194 
LYS CA  C    sing N N 195 
LYS CA  CB   sing N N 196 
LYS CA  HA   sing N N 197 
LYS C   O    doub N N 198 
LYS C   OXT  sing N N 199 
LYS CB  CG   sing N N 200 
LYS CB  HB2  sing N N 201 
LYS CB  HB3  sing N N 202 
LYS CG  CD   sing N N 203 
LYS CG  HG2  sing N N 204 
LYS CG  HG3  sing N N 205 
LYS CD  CE   sing N N 206 
LYS CD  HD2  sing N N 207 
LYS CD  HD3  sing N N 208 
LYS CE  NZ   sing N N 209 
LYS CE  HE2  sing N N 210 
LYS CE  HE3  sing N N 211 
LYS NZ  HZ1  sing N N 212 
LYS NZ  HZ2  sing N N 213 
LYS NZ  HZ3  sing N N 214 
LYS OXT HXT  sing N N 215 
PHE N   CA   sing N N 216 
PHE N   H    sing N N 217 
PHE N   H2   sing N N 218 
PHE CA  C    sing N N 219 
PHE CA  CB   sing N N 220 
PHE CA  HA   sing N N 221 
PHE C   O    doub N N 222 
PHE C   OXT  sing N N 223 
PHE CB  CG   sing N N 224 
PHE CB  HB2  sing N N 225 
PHE CB  HB3  sing N N 226 
PHE CG  CD1  doub Y N 227 
PHE CG  CD2  sing Y N 228 
PHE CD1 CE1  sing Y N 229 
PHE CD1 HD1  sing N N 230 
PHE CD2 CE2  doub Y N 231 
PHE CD2 HD2  sing N N 232 
PHE CE1 CZ   doub Y N 233 
PHE CE1 HE1  sing N N 234 
PHE CE2 CZ   sing Y N 235 
PHE CE2 HE2  sing N N 236 
PHE CZ  HZ   sing N N 237 
PHE OXT HXT  sing N N 238 
PRO N   CA   sing N N 239 
PRO N   CD   sing N N 240 
PRO N   H    sing N N 241 
PRO CA  C    sing N N 242 
PRO CA  CB   sing N N 243 
PRO CA  HA   sing N N 244 
PRO C   O    doub N N 245 
PRO C   OXT  sing N N 246 
PRO CB  CG   sing N N 247 
PRO CB  HB2  sing N N 248 
PRO CB  HB3  sing N N 249 
PRO CG  CD   sing N N 250 
PRO CG  HG2  sing N N 251 
PRO CG  HG3  sing N N 252 
PRO CD  HD2  sing N N 253 
PRO CD  HD3  sing N N 254 
PRO OXT HXT  sing N N 255 
SER N   CA   sing N N 256 
SER N   H    sing N N 257 
SER N   H2   sing N N 258 
SER CA  C    sing N N 259 
SER CA  CB   sing N N 260 
SER CA  HA   sing N N 261 
SER C   O    doub N N 262 
SER C   OXT  sing N N 263 
SER CB  OG   sing N N 264 
SER CB  HB2  sing N N 265 
SER CB  HB3  sing N N 266 
SER OG  HG   sing N N 267 
SER OXT HXT  sing N N 268 
THR N   CA   sing N N 269 
THR N   H    sing N N 270 
THR N   H2   sing N N 271 
THR CA  C    sing N N 272 
THR CA  CB   sing N N 273 
THR CA  HA   sing N N 274 
THR C   O    doub N N 275 
THR C   OXT  sing N N 276 
THR CB  OG1  sing N N 277 
THR CB  CG2  sing N N 278 
THR CB  HB   sing N N 279 
THR OG1 HG1  sing N N 280 
THR CG2 HG21 sing N N 281 
THR CG2 HG22 sing N N 282 
THR CG2 HG23 sing N N 283 
THR OXT HXT  sing N N 284 
TRP N   CA   sing N N 285 
TRP N   H    sing N N 286 
TRP N   H2   sing N N 287 
TRP CA  C    sing N N 288 
TRP CA  CB   sing N N 289 
TRP CA  HA   sing N N 290 
TRP C   O    doub N N 291 
TRP C   OXT  sing N N 292 
TRP CB  CG   sing N N 293 
TRP CB  HB2  sing N N 294 
TRP CB  HB3  sing N N 295 
TRP CG  CD1  doub Y N 296 
TRP CG  CD2  sing Y N 297 
TRP CD1 NE1  sing Y N 298 
TRP CD1 HD1  sing N N 299 
TRP CD2 CE2  doub Y N 300 
TRP CD2 CE3  sing Y N 301 
TRP NE1 CE2  sing Y N 302 
TRP NE1 HE1  sing N N 303 
TRP CE2 CZ2  sing Y N 304 
TRP CE3 CZ3  doub Y N 305 
TRP CE3 HE3  sing N N 306 
TRP CZ2 CH2  doub Y N 307 
TRP CZ2 HZ2  sing N N 308 
TRP CZ3 CH2  sing Y N 309 
TRP CZ3 HZ3  sing N N 310 
TRP CH2 HH2  sing N N 311 
TRP OXT HXT  sing N N 312 
TYR N   CA   sing N N 313 
TYR N   H    sing N N 314 
TYR N   H2   sing N N 315 
TYR CA  C    sing N N 316 
TYR CA  CB   sing N N 317 
TYR CA  HA   sing N N 318 
TYR C   O    doub N N 319 
TYR C   OXT  sing N N 320 
TYR CB  CG   sing N N 321 
TYR CB  HB2  sing N N 322 
TYR CB  HB3  sing N N 323 
TYR CG  CD1  doub Y N 324 
TYR CG  CD2  sing Y N 325 
TYR CD1 CE1  sing Y N 326 
TYR CD1 HD1  sing N N 327 
TYR CD2 CE2  doub Y N 328 
TYR CD2 HD2  sing N N 329 
TYR CE1 CZ   doub Y N 330 
TYR CE1 HE1  sing N N 331 
TYR CE2 CZ   sing Y N 332 
TYR CE2 HE2  sing N N 333 
TYR CZ  OH   sing N N 334 
TYR OH  HH   sing N N 335 
TYR OXT HXT  sing N N 336 
VAL N   CA   sing N N 337 
VAL N   H    sing N N 338 
VAL N   H2   sing N N 339 
VAL CA  C    sing N N 340 
VAL CA  CB   sing N N 341 
VAL CA  HA   sing N N 342 
VAL C   O    doub N N 343 
VAL C   OXT  sing N N 344 
VAL CB  CG1  sing N N 345 
VAL CB  CG2  sing N N 346 
VAL CB  HB   sing N N 347 
VAL CG1 HG11 sing N N 348 
VAL CG1 HG12 sing N N 349 
VAL CG1 HG13 sing N N 350 
VAL CG2 HG21 sing N N 351 
VAL CG2 HG22 sing N N 352 
VAL CG2 HG23 sing N N 353 
VAL OXT HXT  sing N N 354 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.type 
1 DRX Bruker 600 ? 
2 DRX Bruker 800 ? 
# 
_atom_sites.entry_id                    2KIO 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_