data_2KJI # _entry.id 2KJI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KJI pdb_00002kji 10.2210/pdb2kji/pdb RCSB RCSB101197 ? ? WWPDB D_1000101197 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-06-16 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2019-09-18 4 'Structure model' 1 3 2024-10-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' 7 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' citation 2 3 'Structure model' citation_author 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond 7 4 'Structure model' database_2 8 4 'Structure model' pdbx_entry_details 9 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_citation.page_first' 2 3 'Structure model' '_citation.page_last' 3 3 'Structure model' '_citation.pdbx_database_id_DOI' 4 3 'Structure model' '_citation.pdbx_database_id_PubMed' 5 3 'Structure model' '_citation.title' 6 4 'Structure model' '_database_2.pdbx_DOI' 7 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KJI _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2009-05-28 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.content_type unspecified _pdbx_database_related.db_id 4INS _pdbx_database_related.db_name PDB _pdbx_database_related.details 'insulin family' # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Hua, Q.X.' 1 'Nakarawa, S.H.' 2 'Wilken, R.' 3 'Ramos, R.R.' 4 'Jia, W.H.' 5 'Bass, J.' 6 'Weiss, M.A.' 7 # _citation.id primary _citation.title 'A divergent INS protein in Caenorhabditis elegans structurally resembles human insulin and activates the human insulin receptor.' _citation.journal_abbrev 'Genes Dev.' _citation.journal_volume 17 _citation.page_first 826 _citation.page_last 831 _citation.year 2003 _citation.journal_id_ASTM GEDEEP _citation.country US _citation.journal_id_ISSN 0890-9369 _citation.journal_id_CSD 2056 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 12654724 _citation.pdbx_database_id_DOI 10.1101/gad.1058003 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hua, Q.X.' 1 ? primary 'Nakagawa, S.H.' 2 ? primary 'Wilken, J.' 3 ? primary 'Ramos, R.R.' 4 ? primary 'Jia, W.' 5 ? primary 'Bass, J.' 6 ? primary 'Weiss, M.A.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Probable insulin-like peptide beta-type 5' _entity.formula_weight 5304.073 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP residues 63-112' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GETRACGRKLISLVMAVCGDLCNPQEGKDIATECCGNQCSDDYIRSACCP _entity_poly.pdbx_seq_one_letter_code_can GETRACGRKLISLVMAVCGDLCNPQEGKDIATECCGNQCSDDYIRSACCP _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 GLU n 1 3 THR n 1 4 ARG n 1 5 ALA n 1 6 CYS n 1 7 GLY n 1 8 ARG n 1 9 LYS n 1 10 LEU n 1 11 ILE n 1 12 SER n 1 13 LEU n 1 14 VAL n 1 15 MET n 1 16 ALA n 1 17 VAL n 1 18 CYS n 1 19 GLY n 1 20 ASP n 1 21 LEU n 1 22 CYS n 1 23 ASN n 1 24 PRO n 1 25 GLN n 1 26 GLU n 1 27 GLY n 1 28 LYS n 1 29 ASP n 1 30 ILE n 1 31 ALA n 1 32 THR n 1 33 GLU n 1 34 CYS n 1 35 CYS n 1 36 GLY n 1 37 ASN n 1 38 GLN n 1 39 CYS n 1 40 SER n 1 41 ASP n 1 42 ASP n 1 43 TYR n 1 44 ILE n 1 45 ARG n 1 46 SER n 1 47 ALA n 1 48 CYS n 1 49 CYS n 1 50 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name nematode _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ins-6, ZK84.6' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Caenorhabditis elegans' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 6239 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 ARG 4 4 4 ARG ARG A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 MET 15 15 15 MET MET A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 CYS 35 35 35 CYS CYS A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 GLN 38 38 38 GLN GLN A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 TYR 43 43 43 TYR TYR A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 CYS 48 48 48 CYS CYS A . n A 1 49 CYS 49 49 49 CYS CYS A . n A 1 50 PRO 50 50 50 PRO PRO A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2KJI _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KJI _struct.title 'A divergent ins protein in c. elegans structurally resemble insulin and activates the human insulin receptor' _struct.pdbx_model_details 'closest to the average, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KJI _struct_keywords.pdbx_keywords HORMONE _struct_keywords.text 'HORMONE, INSULIN LIKE PEPTIDE, C. ELEGANS, FOLDING, ins-6, Cleavage on pair of basic residues, Disulfide bond, Secreted' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ILB5_CAEEL _struct_ref.pdbx_db_accession P56174 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GETRACGRKLISLVMAVCGDLCNPQEGKDIATECCGNQCSDDYIRSACCP _struct_ref.pdbx_align_begin 63 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KJI _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 50 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P56174 _struct_ref_seq.db_align_beg 63 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 112 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 50 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 CYS A 6 ? CYS A 18 ? CYS A 6 CYS A 18 1 ? 13 HELX_P HELX_P2 2 ASP A 29 ? CYS A 35 ? ASP A 29 CYS A 35 1 ? 7 HELX_P HELX_P3 3 SER A 40 ? CYS A 49 ? SER A 40 CYS A 49 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 35 SG ? ? A CYS 6 A CYS 35 1_555 ? ? ? ? ? ? ? 2.020 ? ? disulf2 disulf ? ? A CYS 18 SG ? ? ? 1_555 A CYS 48 SG ? ? A CYS 18 A CYS 48 1_555 ? ? ? ? ? ? ? 2.022 ? ? disulf3 disulf ? ? A CYS 22 SG ? ? ? 1_555 A CYS 49 SG ? ? A CYS 22 A CYS 49 1_555 ? ? ? ? ? ? ? 2.022 ? ? disulf4 disulf ? ? A CYS 34 SG ? ? ? 1_555 A CYS 39 SG ? ? A CYS 34 A CYS 39 1_555 ? ? ? ? ? ? ? 2.020 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 6 ? CYS A 35 ? CYS A 6 ? 1_555 CYS A 35 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 18 ? CYS A 48 ? CYS A 18 ? 1_555 CYS A 48 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 22 ? CYS A 49 ? CYS A 22 ? 1_555 CYS A 49 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 CYS A 34 ? CYS A 39 ? CYS A 34 ? 1_555 CYS A 39 ? 1_555 SG SG . . . None 'Disulfide bridge' # _pdbx_entry_details.entry_id 2KJI _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A VAL 14 ? ? H A CYS 18 ? ? 1.44 2 1 O A ASP 29 ? ? H A THR 32 ? ? 1.51 3 1 O A ARG 45 ? ? H A CYS 49 ? ? 1.59 4 2 O A VAL 14 ? ? H A CYS 18 ? ? 1.45 5 2 O A ASP 29 ? ? H A THR 32 ? ? 1.45 6 3 O A VAL 14 ? ? H A CYS 18 ? ? 1.51 7 3 O A ASP 29 ? ? H A THR 32 ? ? 1.51 8 4 O A VAL 14 ? ? H A CYS 18 ? ? 1.45 9 4 O A ARG 45 ? ? H A CYS 49 ? ? 1.59 10 5 O A VAL 14 ? ? H A CYS 18 ? ? 1.45 11 5 O A ASP 29 ? ? H A THR 32 ? ? 1.54 12 6 O A VAL 14 ? ? H A CYS 18 ? ? 1.44 13 6 O A ASP 29 ? ? H A THR 32 ? ? 1.52 14 6 O A ARG 8 ? ? H A SER 12 ? ? 1.57 15 7 O A VAL 14 ? ? H A CYS 18 ? ? 1.42 16 7 O A ILE 44 ? ? H A ALA 47 ? ? 1.55 17 7 O A ARG 8 ? ? H A SER 12 ? ? 1.59 18 8 O A VAL 14 ? ? H A CYS 18 ? ? 1.43 19 8 O A ASP 29 ? ? H A THR 32 ? ? 1.54 20 8 O A CYS 6 ? ? H A LEU 10 ? ? 1.55 21 9 O A VAL 14 ? ? H A CYS 18 ? ? 1.43 22 9 O A ASP 29 ? ? H A THR 32 ? ? 1.51 23 10 O A VAL 14 ? ? H A CYS 18 ? ? 1.44 24 10 O A ILE 44 ? ? H A ALA 47 ? ? 1.60 25 11 O A VAL 14 ? ? H A CYS 18 ? ? 1.44 26 11 O A ARG 8 ? ? H A SER 12 ? ? 1.52 27 11 O A ILE 44 ? ? H A CYS 48 ? ? 1.60 28 12 O A VAL 14 ? ? H A CYS 18 ? ? 1.43 29 13 O A VAL 14 ? ? H A CYS 18 ? ? 1.42 30 13 O A ASP 29 ? ? H A THR 32 ? ? 1.56 31 14 O A VAL 14 ? ? H A CYS 18 ? ? 1.51 32 14 O A ILE 44 ? ? H A ALA 47 ? ? 1.59 33 15 O A VAL 14 ? ? H A CYS 18 ? ? 1.44 34 15 O A GLU 33 ? ? H A GLN 38 ? ? 1.55 35 16 O A VAL 14 ? ? H A CYS 18 ? ? 1.43 36 16 O A ASP 29 ? ? H A THR 32 ? ? 1.50 37 16 O A ILE 44 ? ? H A ALA 47 ? ? 1.59 38 17 O A VAL 14 ? ? H A CYS 18 ? ? 1.42 39 18 O A VAL 14 ? ? H A CYS 18 ? ? 1.45 40 18 O A CYS 6 ? ? H A ARG 8 ? ? 1.54 41 19 O A VAL 14 ? ? H A CYS 18 ? ? 1.41 42 19 O A CYS 6 ? ? H A ARG 8 ? ? 1.54 43 20 O A VAL 14 ? ? H A CYS 18 ? ? 1.44 44 20 O A ILE 44 ? ? H A ALA 47 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 6 ? ? -135.84 -65.23 2 1 CYS A 22 ? ? -74.41 -108.59 3 1 ASN A 23 ? ? 173.89 122.99 4 1 PRO A 24 ? ? -82.69 48.93 5 1 GLU A 26 ? ? 42.30 79.57 6 1 LYS A 28 ? ? -93.20 48.66 7 1 ASP A 29 ? ? -167.86 -63.72 8 1 ASN A 37 ? ? -151.54 -88.33 9 1 SER A 40 ? ? 163.04 152.86 10 1 CYS A 49 ? ? -150.36 72.63 11 2 THR A 3 ? ? -77.03 -166.91 12 2 ALA A 5 ? ? -165.18 102.34 13 2 CYS A 6 ? ? -135.95 -80.79 14 2 ASN A 23 ? ? 81.54 106.87 15 2 GLN A 25 ? ? -38.92 152.55 16 2 GLU A 26 ? ? -92.17 41.34 17 2 LYS A 28 ? ? -78.35 -163.62 18 2 ASP A 29 ? ? -154.03 -32.93 19 2 ASN A 37 ? ? -155.92 -55.53 20 2 SER A 40 ? ? 172.48 146.36 21 2 CYS A 49 ? ? -158.61 72.79 22 3 ARG A 4 ? ? -61.73 -168.51 23 3 ALA A 5 ? ? 165.01 112.54 24 3 CYS A 6 ? ? -137.20 -73.28 25 3 CYS A 22 ? ? -34.35 -77.45 26 3 ASN A 23 ? ? -172.91 81.93 27 3 ASP A 29 ? ? -127.45 -80.80 28 3 ASN A 37 ? ? -159.08 -43.26 29 3 SER A 40 ? ? 163.64 150.02 30 4 THR A 3 ? ? -64.14 -164.70 31 4 ARG A 4 ? ? 34.44 -153.02 32 4 ALA A 5 ? ? 179.45 103.44 33 4 CYS A 6 ? ? -138.16 -73.56 34 4 LEU A 21 ? ? -133.97 -52.71 35 4 CYS A 22 ? ? -59.47 -73.37 36 4 ASN A 23 ? ? 164.16 96.22 37 4 ASP A 29 ? ? -133.82 -71.10 38 4 ASN A 37 ? ? -154.99 -73.18 39 4 CYS A 39 ? ? -179.79 145.33 40 4 CYS A 49 ? ? -153.45 71.57 41 5 CYS A 6 ? ? -135.40 -76.01 42 5 CYS A 22 ? ? -59.32 -84.93 43 5 ASN A 23 ? ? 165.85 96.34 44 5 GLU A 26 ? ? -83.93 49.00 45 5 LYS A 28 ? ? -27.54 91.24 46 5 ASP A 29 ? ? -167.62 -67.77 47 5 ASN A 37 ? ? -139.57 -58.70 48 5 CYS A 39 ? ? -170.27 148.21 49 6 THR A 3 ? ? -104.48 -164.24 50 6 CYS A 6 ? ? -137.04 -80.66 51 6 LEU A 21 ? ? -141.99 -37.43 52 6 CYS A 22 ? ? -51.35 -74.70 53 6 ASN A 23 ? ? 163.59 88.69 54 6 PRO A 24 ? ? -79.47 45.37 55 6 GLU A 26 ? ? 42.99 70.80 56 6 LYS A 28 ? ? -94.63 48.24 57 6 ASP A 29 ? ? -158.29 -71.01 58 6 GLU A 33 ? ? -104.80 -64.32 59 6 GLN A 38 ? ? 77.01 -161.39 60 6 CYS A 39 ? ? -153.35 -145.48 61 7 ARG A 4 ? ? -124.31 -162.03 62 7 ALA A 5 ? ? 169.82 117.29 63 7 CYS A 6 ? ? -134.84 -68.62 64 7 CYS A 22 ? ? -30.90 -73.89 65 7 ASN A 23 ? ? -177.64 99.93 66 7 GLU A 26 ? ? -101.53 51.42 67 7 ASP A 29 ? ? -131.48 -71.71 68 7 ASN A 37 ? ? -140.86 -68.80 69 7 CYS A 39 ? ? 178.66 137.05 70 8 THR A 3 ? ? -125.54 -168.30 71 8 CYS A 6 ? ? -136.76 -76.36 72 8 CYS A 22 ? ? -64.10 -82.38 73 8 ASN A 23 ? ? 163.37 100.48 74 8 PRO A 24 ? ? -78.50 48.42 75 8 GLU A 26 ? ? 31.07 69.04 76 8 LYS A 28 ? ? -98.34 50.47 77 8 ASP A 29 ? ? -159.16 -74.89 78 8 ASN A 37 ? ? -146.56 -52.76 79 8 SER A 40 ? ? 168.52 154.99 80 9 ARG A 4 ? ? -98.69 -148.22 81 9 ALA A 5 ? ? 163.64 115.05 82 9 CYS A 6 ? ? -136.49 -72.59 83 9 LEU A 21 ? ? -132.35 -41.72 84 9 CYS A 22 ? ? -57.49 -76.91 85 9 ASN A 23 ? ? 172.41 92.32 86 9 ASP A 29 ? ? -146.49 -75.55 87 9 ASN A 37 ? ? -154.92 -37.75 88 9 CYS A 39 ? ? -170.17 147.24 89 10 THR A 3 ? ? -125.68 -161.86 90 10 CYS A 6 ? ? -137.92 -75.39 91 10 CYS A 22 ? ? -32.41 -76.87 92 10 ASN A 23 ? ? -179.10 96.07 93 10 GLU A 26 ? ? -117.69 65.41 94 10 ASP A 29 ? ? -130.16 -58.55 95 10 ASN A 37 ? ? -155.38 -75.56 96 10 SER A 40 ? ? 169.02 143.49 97 11 THR A 3 ? ? -63.45 -168.63 98 11 CYS A 6 ? ? -137.83 -81.60 99 11 ASN A 23 ? ? 84.19 114.41 100 11 GLN A 25 ? ? -44.16 156.84 101 11 GLU A 26 ? ? -114.63 56.12 102 11 ASP A 29 ? ? -153.04 -47.75 103 11 ASN A 37 ? ? -135.52 -69.52 104 12 CYS A 6 ? ? -135.47 -72.68 105 12 CYS A 22 ? ? -64.38 -81.11 106 12 ASN A 23 ? ? 170.99 97.93 107 12 GLU A 26 ? ? -119.30 64.95 108 12 ASP A 29 ? ? -141.00 -65.39 109 12 ASN A 37 ? ? -136.03 -47.84 110 12 SER A 40 ? ? 163.96 143.65 111 13 GLU A 2 ? ? -63.92 -177.63 112 13 THR A 3 ? ? -126.82 -165.24 113 13 ARG A 4 ? ? 33.20 -140.17 114 13 ALA A 5 ? ? 166.36 110.85 115 13 CYS A 6 ? ? -136.90 -86.32 116 13 LEU A 21 ? ? -130.57 -40.42 117 13 CYS A 22 ? ? -60.74 -82.97 118 13 ASN A 23 ? ? 173.24 95.15 119 13 ASP A 29 ? ? -142.37 -64.80 120 13 ASN A 37 ? ? -140.98 -50.24 121 13 CYS A 39 ? ? 163.31 -179.85 122 13 SER A 40 ? ? 171.67 165.97 123 14 CYS A 6 ? ? -136.13 -58.43 124 14 CYS A 22 ? ? -26.23 -72.70 125 14 ASN A 23 ? ? 171.92 78.20 126 14 GLN A 25 ? ? -84.01 43.87 127 14 GLU A 26 ? ? 22.11 57.47 128 14 ASP A 29 ? ? -147.31 -55.11 129 14 ASN A 37 ? ? -143.41 -76.77 130 14 CYS A 39 ? ? 174.18 172.24 131 14 SER A 40 ? ? 174.66 159.37 132 15 CYS A 6 ? ? -134.88 -91.59 133 15 LEU A 21 ? ? -136.26 -42.76 134 15 CYS A 22 ? ? -55.72 -72.15 135 15 ASN A 23 ? ? 164.10 96.28 136 15 ASP A 29 ? ? -161.34 -61.84 137 15 GLU A 33 ? ? -106.77 -69.90 138 15 CYS A 34 ? ? -35.77 -35.53 139 15 GLN A 38 ? ? 68.41 178.23 140 15 CYS A 39 ? ? -152.15 -153.42 141 15 CYS A 49 ? ? -153.43 75.24 142 16 GLU A 2 ? ? -60.29 -176.62 143 16 ARG A 4 ? ? 33.08 -152.32 144 16 ALA A 5 ? ? 160.27 112.11 145 16 CYS A 6 ? ? -137.19 -82.37 146 16 CYS A 22 ? ? -10.21 -71.78 147 16 ASN A 23 ? ? 169.12 96.96 148 16 GLU A 26 ? ? 47.10 83.13 149 16 LYS A 28 ? ? -89.80 47.34 150 16 ASP A 29 ? ? -161.77 -66.73 151 16 ASN A 37 ? ? -140.49 -67.74 152 16 CYS A 39 ? ? 173.55 142.13 153 17 THR A 3 ? ? -56.82 -160.18 154 17 CYS A 6 ? ? -136.48 -77.53 155 17 LEU A 21 ? ? -134.65 -45.60 156 17 CYS A 22 ? ? -60.63 -71.54 157 17 ASN A 23 ? ? 164.79 93.92 158 17 ASP A 29 ? ? -133.68 -73.43 159 17 ASN A 37 ? ? -147.64 -54.40 160 17 SER A 40 ? ? 169.74 141.58 161 17 CYS A 49 ? ? -152.75 76.18 162 18 LEU A 21 ? ? -134.44 -46.04 163 18 CYS A 22 ? ? -61.32 -74.41 164 18 ASN A 23 ? ? 166.15 95.06 165 18 ASP A 29 ? ? -137.98 -67.74 166 18 ASN A 37 ? ? -140.85 -54.73 167 18 CYS A 39 ? ? 162.62 175.35 168 19 THR A 3 ? ? -160.61 -163.82 169 19 ALA A 5 ? ? -107.52 75.33 170 19 ASN A 23 ? ? 80.74 110.57 171 19 LYS A 28 ? ? -84.84 48.68 172 19 ASP A 29 ? ? -157.63 -66.46 173 19 ASN A 37 ? ? -157.04 -65.51 174 19 CYS A 39 ? ? 170.92 159.01 175 20 CYS A 6 ? ? -135.48 -71.45 176 20 LEU A 21 ? ? 34.08 61.94 177 20 ASN A 23 ? ? 170.67 104.33 178 20 GLU A 26 ? ? -113.71 52.36 179 20 ASP A 29 ? ? -122.87 -68.18 180 20 ASN A 37 ? ? -137.44 -48.66 181 20 CYS A 39 ? ? 175.37 138.32 182 20 CYS A 48 ? ? -104.66 -60.43 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 4 ? ? 0.317 'SIDE CHAIN' 2 1 ARG A 8 ? ? 0.212 'SIDE CHAIN' 3 1 ARG A 45 ? ? 0.311 'SIDE CHAIN' 4 2 ARG A 4 ? ? 0.195 'SIDE CHAIN' 5 2 ARG A 8 ? ? 0.231 'SIDE CHAIN' 6 2 ARG A 45 ? ? 0.299 'SIDE CHAIN' 7 3 ARG A 4 ? ? 0.190 'SIDE CHAIN' 8 3 ARG A 8 ? ? 0.317 'SIDE CHAIN' 9 3 ARG A 45 ? ? 0.314 'SIDE CHAIN' 10 4 ARG A 4 ? ? 0.315 'SIDE CHAIN' 11 4 ARG A 8 ? ? 0.315 'SIDE CHAIN' 12 4 ARG A 45 ? ? 0.265 'SIDE CHAIN' 13 5 ARG A 4 ? ? 0.315 'SIDE CHAIN' 14 5 ARG A 8 ? ? 0.136 'SIDE CHAIN' 15 5 ARG A 45 ? ? 0.204 'SIDE CHAIN' 16 6 ARG A 4 ? ? 0.140 'SIDE CHAIN' 17 6 ARG A 8 ? ? 0.107 'SIDE CHAIN' 18 7 ARG A 4 ? ? 0.267 'SIDE CHAIN' 19 7 ARG A 8 ? ? 0.201 'SIDE CHAIN' 20 7 ARG A 45 ? ? 0.269 'SIDE CHAIN' 21 8 ARG A 4 ? ? 0.206 'SIDE CHAIN' 22 8 ARG A 8 ? ? 0.236 'SIDE CHAIN' 23 8 ARG A 45 ? ? 0.311 'SIDE CHAIN' 24 9 ARG A 4 ? ? 0.195 'SIDE CHAIN' 25 9 ARG A 8 ? ? 0.315 'SIDE CHAIN' 26 9 ARG A 45 ? ? 0.261 'SIDE CHAIN' 27 10 ARG A 4 ? ? 0.282 'SIDE CHAIN' 28 10 ARG A 8 ? ? 0.136 'SIDE CHAIN' 29 10 ARG A 45 ? ? 0.242 'SIDE CHAIN' 30 11 ARG A 4 ? ? 0.263 'SIDE CHAIN' 31 11 ARG A 8 ? ? 0.238 'SIDE CHAIN' 32 11 ARG A 45 ? ? 0.203 'SIDE CHAIN' 33 12 ARG A 4 ? ? 0.148 'SIDE CHAIN' 34 12 ARG A 8 ? ? 0.207 'SIDE CHAIN' 35 12 ARG A 45 ? ? 0.314 'SIDE CHAIN' 36 13 ARG A 8 ? ? 0.100 'SIDE CHAIN' 37 13 ARG A 45 ? ? 0.181 'SIDE CHAIN' 38 14 ARG A 4 ? ? 0.313 'SIDE CHAIN' 39 14 ARG A 8 ? ? 0.233 'SIDE CHAIN' 40 14 ARG A 45 ? ? 0.307 'SIDE CHAIN' 41 15 ARG A 4 ? ? 0.255 'SIDE CHAIN' 42 15 ARG A 8 ? ? 0.214 'SIDE CHAIN' 43 15 ARG A 45 ? ? 0.250 'SIDE CHAIN' 44 16 ARG A 4 ? ? 0.311 'SIDE CHAIN' 45 16 ARG A 8 ? ? 0.230 'SIDE CHAIN' 46 16 ARG A 45 ? ? 0.154 'SIDE CHAIN' 47 17 ARG A 4 ? ? 0.136 'SIDE CHAIN' 48 17 ARG A 8 ? ? 0.245 'SIDE CHAIN' 49 17 ARG A 45 ? ? 0.221 'SIDE CHAIN' 50 18 ARG A 4 ? ? 0.270 'SIDE CHAIN' 51 18 ARG A 8 ? ? 0.256 'SIDE CHAIN' 52 18 ARG A 45 ? ? 0.236 'SIDE CHAIN' 53 19 ARG A 4 ? ? 0.147 'SIDE CHAIN' 54 19 ARG A 8 ? ? 0.155 'SIDE CHAIN' 55 19 ARG A 45 ? ? 0.225 'SIDE CHAIN' 56 20 ARG A 4 ? ? 0.287 'SIDE CHAIN' 57 20 ARG A 8 ? ? 0.228 'SIDE CHAIN' 58 20 ARG A 45 ? ? 0.234 'SIDE CHAIN' # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 40 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KJI _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KJI _pdbx_nmr_representative.selection_criteria 'closest to the average' # _pdbx_nmr_sample_details.contents '0.5 mM insulin-like peptide-1, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample.component 'insulin-like peptide-1' _pdbx_nmr_exptl_sample.concentration 0.5 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling ? _pdbx_nmr_exptl_sample.solution_id 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.1 _pdbx_nmr_exptl_sample_conditions.pH 7.4 _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D TOCSY' 1 2 1 NOESY 1 3 1 COSY # _pdbx_nmr_details.entry_id 2KJI _pdbx_nmr_details.text 'THIS STRUCTURE WAS DETERMINED USING STANDARD 2D HOMONUCLEAR NMR TECHNIQUES.' # _pdbx_nmr_refine.entry_id 2KJI _pdbx_nmr_refine.method 'DISTANCE GEOMETRY, SIMULATED ANNEALING' _pdbx_nmr_refine.details 'RMSD VALUES FOR ALL 20 STRUCTURES VERSUS GEOMETRIC AVERAGE: (BACKBONE, 5-23, 30-48) 0.41 ANGSTROM' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'BRUNGER, A.T. ET AL.' refinement X-PLOR 3.85 1 Varian 'structure solution' VNMR_6.1B 6.1B 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 ILE N N N N 137 ILE CA C N S 138 ILE C C N N 139 ILE O O N N 140 ILE CB C N S 141 ILE CG1 C N N 142 ILE CG2 C N N 143 ILE CD1 C N N 144 ILE OXT O N N 145 ILE H H N N 146 ILE H2 H N N 147 ILE HA H N N 148 ILE HB H N N 149 ILE HG12 H N N 150 ILE HG13 H N N 151 ILE HG21 H N N 152 ILE HG22 H N N 153 ILE HG23 H N N 154 ILE HD11 H N N 155 ILE HD12 H N N 156 ILE HD13 H N N 157 ILE HXT H N N 158 LEU N N N N 159 LEU CA C N S 160 LEU C C N N 161 LEU O O N N 162 LEU CB C N N 163 LEU CG C N N 164 LEU CD1 C N N 165 LEU CD2 C N N 166 LEU OXT O N N 167 LEU H H N N 168 LEU H2 H N N 169 LEU HA H N N 170 LEU HB2 H N N 171 LEU HB3 H N N 172 LEU HG H N N 173 LEU HD11 H N N 174 LEU HD12 H N N 175 LEU HD13 H N N 176 LEU HD21 H N N 177 LEU HD22 H N N 178 LEU HD23 H N N 179 LEU HXT H N N 180 LYS N N N N 181 LYS CA C N S 182 LYS C C N N 183 LYS O O N N 184 LYS CB C N N 185 LYS CG C N N 186 LYS CD C N N 187 LYS CE C N N 188 LYS NZ N N N 189 LYS OXT O N N 190 LYS H H N N 191 LYS H2 H N N 192 LYS HA H N N 193 LYS HB2 H N N 194 LYS HB3 H N N 195 LYS HG2 H N N 196 LYS HG3 H N N 197 LYS HD2 H N N 198 LYS HD3 H N N 199 LYS HE2 H N N 200 LYS HE3 H N N 201 LYS HZ1 H N N 202 LYS HZ2 H N N 203 LYS HZ3 H N N 204 LYS HXT H N N 205 MET N N N N 206 MET CA C N S 207 MET C C N N 208 MET O O N N 209 MET CB C N N 210 MET CG C N N 211 MET SD S N N 212 MET CE C N N 213 MET OXT O N N 214 MET H H N N 215 MET H2 H N N 216 MET HA H N N 217 MET HB2 H N N 218 MET HB3 H N N 219 MET HG2 H N N 220 MET HG3 H N N 221 MET HE1 H N N 222 MET HE2 H N N 223 MET HE3 H N N 224 MET HXT H N N 225 PRO N N N N 226 PRO CA C N S 227 PRO C C N N 228 PRO O O N N 229 PRO CB C N N 230 PRO CG C N N 231 PRO CD C N N 232 PRO OXT O N N 233 PRO H H N N 234 PRO HA H N N 235 PRO HB2 H N N 236 PRO HB3 H N N 237 PRO HG2 H N N 238 PRO HG3 H N N 239 PRO HD2 H N N 240 PRO HD3 H N N 241 PRO HXT H N N 242 SER N N N N 243 SER CA C N S 244 SER C C N N 245 SER O O N N 246 SER CB C N N 247 SER OG O N N 248 SER OXT O N N 249 SER H H N N 250 SER H2 H N N 251 SER HA H N N 252 SER HB2 H N N 253 SER HB3 H N N 254 SER HG H N N 255 SER HXT H N N 256 THR N N N N 257 THR CA C N S 258 THR C C N N 259 THR O O N N 260 THR CB C N R 261 THR OG1 O N N 262 THR CG2 C N N 263 THR OXT O N N 264 THR H H N N 265 THR H2 H N N 266 THR HA H N N 267 THR HB H N N 268 THR HG1 H N N 269 THR HG21 H N N 270 THR HG22 H N N 271 THR HG23 H N N 272 THR HXT H N N 273 TYR N N N N 274 TYR CA C N S 275 TYR C C N N 276 TYR O O N N 277 TYR CB C N N 278 TYR CG C Y N 279 TYR CD1 C Y N 280 TYR CD2 C Y N 281 TYR CE1 C Y N 282 TYR CE2 C Y N 283 TYR CZ C Y N 284 TYR OH O N N 285 TYR OXT O N N 286 TYR H H N N 287 TYR H2 H N N 288 TYR HA H N N 289 TYR HB2 H N N 290 TYR HB3 H N N 291 TYR HD1 H N N 292 TYR HD2 H N N 293 TYR HE1 H N N 294 TYR HE2 H N N 295 TYR HH H N N 296 TYR HXT H N N 297 VAL N N N N 298 VAL CA C N S 299 VAL C C N N 300 VAL O O N N 301 VAL CB C N N 302 VAL CG1 C N N 303 VAL CG2 C N N 304 VAL OXT O N N 305 VAL H H N N 306 VAL H2 H N N 307 VAL HA H N N 308 VAL HB H N N 309 VAL HG11 H N N 310 VAL HG12 H N N 311 VAL HG13 H N N 312 VAL HG21 H N N 313 VAL HG22 H N N 314 VAL HG23 H N N 315 VAL HXT H N N 316 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 ILE N CA sing N N 129 ILE N H sing N N 130 ILE N H2 sing N N 131 ILE CA C sing N N 132 ILE CA CB sing N N 133 ILE CA HA sing N N 134 ILE C O doub N N 135 ILE C OXT sing N N 136 ILE CB CG1 sing N N 137 ILE CB CG2 sing N N 138 ILE CB HB sing N N 139 ILE CG1 CD1 sing N N 140 ILE CG1 HG12 sing N N 141 ILE CG1 HG13 sing N N 142 ILE CG2 HG21 sing N N 143 ILE CG2 HG22 sing N N 144 ILE CG2 HG23 sing N N 145 ILE CD1 HD11 sing N N 146 ILE CD1 HD12 sing N N 147 ILE CD1 HD13 sing N N 148 ILE OXT HXT sing N N 149 LEU N CA sing N N 150 LEU N H sing N N 151 LEU N H2 sing N N 152 LEU CA C sing N N 153 LEU CA CB sing N N 154 LEU CA HA sing N N 155 LEU C O doub N N 156 LEU C OXT sing N N 157 LEU CB CG sing N N 158 LEU CB HB2 sing N N 159 LEU CB HB3 sing N N 160 LEU CG CD1 sing N N 161 LEU CG CD2 sing N N 162 LEU CG HG sing N N 163 LEU CD1 HD11 sing N N 164 LEU CD1 HD12 sing N N 165 LEU CD1 HD13 sing N N 166 LEU CD2 HD21 sing N N 167 LEU CD2 HD22 sing N N 168 LEU CD2 HD23 sing N N 169 LEU OXT HXT sing N N 170 LYS N CA sing N N 171 LYS N H sing N N 172 LYS N H2 sing N N 173 LYS CA C sing N N 174 LYS CA CB sing N N 175 LYS CA HA sing N N 176 LYS C O doub N N 177 LYS C OXT sing N N 178 LYS CB CG sing N N 179 LYS CB HB2 sing N N 180 LYS CB HB3 sing N N 181 LYS CG CD sing N N 182 LYS CG HG2 sing N N 183 LYS CG HG3 sing N N 184 LYS CD CE sing N N 185 LYS CD HD2 sing N N 186 LYS CD HD3 sing N N 187 LYS CE NZ sing N N 188 LYS CE HE2 sing N N 189 LYS CE HE3 sing N N 190 LYS NZ HZ1 sing N N 191 LYS NZ HZ2 sing N N 192 LYS NZ HZ3 sing N N 193 LYS OXT HXT sing N N 194 MET N CA sing N N 195 MET N H sing N N 196 MET N H2 sing N N 197 MET CA C sing N N 198 MET CA CB sing N N 199 MET CA HA sing N N 200 MET C O doub N N 201 MET C OXT sing N N 202 MET CB CG sing N N 203 MET CB HB2 sing N N 204 MET CB HB3 sing N N 205 MET CG SD sing N N 206 MET CG HG2 sing N N 207 MET CG HG3 sing N N 208 MET SD CE sing N N 209 MET CE HE1 sing N N 210 MET CE HE2 sing N N 211 MET CE HE3 sing N N 212 MET OXT HXT sing N N 213 PRO N CA sing N N 214 PRO N CD sing N N 215 PRO N H sing N N 216 PRO CA C sing N N 217 PRO CA CB sing N N 218 PRO CA HA sing N N 219 PRO C O doub N N 220 PRO C OXT sing N N 221 PRO CB CG sing N N 222 PRO CB HB2 sing N N 223 PRO CB HB3 sing N N 224 PRO CG CD sing N N 225 PRO CG HG2 sing N N 226 PRO CG HG3 sing N N 227 PRO CD HD2 sing N N 228 PRO CD HD3 sing N N 229 PRO OXT HXT sing N N 230 SER N CA sing N N 231 SER N H sing N N 232 SER N H2 sing N N 233 SER CA C sing N N 234 SER CA CB sing N N 235 SER CA HA sing N N 236 SER C O doub N N 237 SER C OXT sing N N 238 SER CB OG sing N N 239 SER CB HB2 sing N N 240 SER CB HB3 sing N N 241 SER OG HG sing N N 242 SER OXT HXT sing N N 243 THR N CA sing N N 244 THR N H sing N N 245 THR N H2 sing N N 246 THR CA C sing N N 247 THR CA CB sing N N 248 THR CA HA sing N N 249 THR C O doub N N 250 THR C OXT sing N N 251 THR CB OG1 sing N N 252 THR CB CG2 sing N N 253 THR CB HB sing N N 254 THR OG1 HG1 sing N N 255 THR CG2 HG21 sing N N 256 THR CG2 HG22 sing N N 257 THR CG2 HG23 sing N N 258 THR OXT HXT sing N N 259 TYR N CA sing N N 260 TYR N H sing N N 261 TYR N H2 sing N N 262 TYR CA C sing N N 263 TYR CA CB sing N N 264 TYR CA HA sing N N 265 TYR C O doub N N 266 TYR C OXT sing N N 267 TYR CB CG sing N N 268 TYR CB HB2 sing N N 269 TYR CB HB3 sing N N 270 TYR CG CD1 doub Y N 271 TYR CG CD2 sing Y N 272 TYR CD1 CE1 sing Y N 273 TYR CD1 HD1 sing N N 274 TYR CD2 CE2 doub Y N 275 TYR CD2 HD2 sing N N 276 TYR CE1 CZ doub Y N 277 TYR CE1 HE1 sing N N 278 TYR CE2 CZ sing Y N 279 TYR CE2 HE2 sing N N 280 TYR CZ OH sing N N 281 TYR OH HH sing N N 282 TYR OXT HXT sing N N 283 VAL N CA sing N N 284 VAL N H sing N N 285 VAL N H2 sing N N 286 VAL CA C sing N N 287 VAL CA CB sing N N 288 VAL CA HA sing N N 289 VAL C O doub N N 290 VAL C OXT sing N N 291 VAL CB CG1 sing N N 292 VAL CB CG2 sing N N 293 VAL CB HB sing N N 294 VAL CG1 HG11 sing N N 295 VAL CG1 HG12 sing N N 296 VAL CG1 HG13 sing N N 297 VAL CG2 HG21 sing N N 298 VAL CG2 HG22 sing N N 299 VAL CG2 HG23 sing N N 300 VAL OXT HXT sing N N 301 # _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'BRUKER DRX' # _atom_sites.entry_id 2KJI _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_