data_2KKH # _entry.id 2KKH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2KKH pdb_00002kkh 10.2210/pdb2kkh/pdb RCSB RCSB101232 ? ? WWPDB D_1000101232 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2010-01-26 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 4 'Structure model' 1 3 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_conn_angle 6 3 'Structure model' pdbx_struct_oper_list 7 3 'Structure model' struct_conn 8 3 'Structure model' struct_site 9 4 'Structure model' chem_comp_atom 10 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 6 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 7 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 8 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 9 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 10 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 11 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 12 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 13 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 14 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 15 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 16 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 17 3 'Structure model' '_pdbx_struct_conn_angle.value' 18 3 'Structure model' '_struct_conn.pdbx_dist_value' 19 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 20 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 21 3 'Structure model' '_struct_conn.ptnr1_label_asym_id' 22 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 23 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 24 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 25 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 26 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 27 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 28 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 29 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' 30 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 31 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 32 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2KKH _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2009-06-20 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Zimmerman, M.' 1 'Clarke, O.' 2 'Gulbis, J.M.' 3 'Keizer, D.W.' 4 'Jarvis, R.S.' 5 'Cobbett, C.S.' 6 'Hinds, M.G.' 7 'Xiao, Z.' 8 'Wedd, A.G.' 9 # _citation.id primary _citation.title ;Metal binding affinities of Arabidopsis zinc and copper transporters: selectivities match the relative, but not the absolute, affinities of their amino-terminal domains ; _citation.journal_abbrev Biochemistry _citation.journal_volume 48 _citation.page_first 11640 _citation.page_last 11654 _citation.year 2009 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19883117 _citation.pdbx_database_id_DOI 10.1021/bi901573b # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zimmermann, M.' 1 ? primary 'Clarke, O.' 2 ? primary 'Gulbis, J.M.' 3 ? primary 'Keizer, D.W.' 4 ? primary 'Jarvis, R.S.' 5 ? primary 'Cobbett, C.S.' 6 ? primary 'Hinds, M.G.' 7 ? primary 'Xiao, Z.' 8 ? primary 'Wedd, A.G.' 9 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Putative heavy metal transporter' 10746.498 1 ? ? 'UNP residues 2-96' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 3 water nat water 18.015 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ALQNKEEEKKKVKKLQKSYFDVLGICCTSEVPIIENILKSLDGVKEYSVIVPSRTVIVVHDSLLISPFQIAKALNEARLE ANVRVNGETSFKNKW ; _entity_poly.pdbx_seq_one_letter_code_can ;ALQNKEEEKKKVKKLQKSYFDVLGICCTSEVPIIENILKSLDGVKEYSVIVPSRTVIVVHDSLLISPFQIAKALNEARLE ANVRVNGETSFKNKW ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 LEU n 1 3 GLN n 1 4 ASN n 1 5 LYS n 1 6 GLU n 1 7 GLU n 1 8 GLU n 1 9 LYS n 1 10 LYS n 1 11 LYS n 1 12 VAL n 1 13 LYS n 1 14 LYS n 1 15 LEU n 1 16 GLN n 1 17 LYS n 1 18 SER n 1 19 TYR n 1 20 PHE n 1 21 ASP n 1 22 VAL n 1 23 LEU n 1 24 GLY n 1 25 ILE n 1 26 CYS n 1 27 CYS n 1 28 THR n 1 29 SER n 1 30 GLU n 1 31 VAL n 1 32 PRO n 1 33 ILE n 1 34 ILE n 1 35 GLU n 1 36 ASN n 1 37 ILE n 1 38 LEU n 1 39 LYS n 1 40 SER n 1 41 LEU n 1 42 ASP n 1 43 GLY n 1 44 VAL n 1 45 LYS n 1 46 GLU n 1 47 TYR n 1 48 SER n 1 49 VAL n 1 50 ILE n 1 51 VAL n 1 52 PRO n 1 53 SER n 1 54 ARG n 1 55 THR n 1 56 VAL n 1 57 ILE n 1 58 VAL n 1 59 VAL n 1 60 HIS n 1 61 ASP n 1 62 SER n 1 63 LEU n 1 64 LEU n 1 65 ILE n 1 66 SER n 1 67 PRO n 1 68 PHE n 1 69 GLN n 1 70 ILE n 1 71 ALA n 1 72 LYS n 1 73 ALA n 1 74 LEU n 1 75 ASN n 1 76 GLU n 1 77 ALA n 1 78 ARG n 1 79 LEU n 1 80 GLU n 1 81 ALA n 1 82 ASN n 1 83 VAL n 1 84 ARG n 1 85 VAL n 1 86 ASN n 1 87 GLY n 1 88 GLU n 1 89 THR n 1 90 SER n 1 91 PHE n 1 92 LYS n 1 93 ASN n 1 94 LYS n 1 95 TRP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'mouse-ear cress,thale-cress' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Arabidopsis thaliana' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3702 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant DE3 _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 2 2 ALA ALA A . n A 1 2 LEU 2 3 3 LEU LEU A . n A 1 3 GLN 3 4 4 GLN GLN A . n A 1 4 ASN 4 5 5 ASN ASN A . n A 1 5 LYS 5 6 6 LYS LYS A . n A 1 6 GLU 6 7 7 GLU GLU A . n A 1 7 GLU 7 8 8 GLU GLU A . n A 1 8 GLU 8 9 9 GLU GLU A . n A 1 9 LYS 9 10 10 LYS LYS A . n A 1 10 LYS 10 11 11 LYS LYS A . n A 1 11 LYS 11 12 12 LYS LYS A . n A 1 12 VAL 12 13 13 VAL VAL A . n A 1 13 LYS 13 14 14 LYS LYS A . n A 1 14 LYS 14 15 15 LYS LYS A . n A 1 15 LEU 15 16 16 LEU LEU A . n A 1 16 GLN 16 17 17 GLN GLN A . n A 1 17 LYS 17 18 18 LYS LYS A . n A 1 18 SER 18 19 19 SER SER A . n A 1 19 TYR 19 20 20 TYR TYR A . n A 1 20 PHE 20 21 21 PHE PHE A . n A 1 21 ASP 21 22 22 ASP ASP A . n A 1 22 VAL 22 23 23 VAL VAL A . n A 1 23 LEU 23 24 24 LEU LEU A . n A 1 24 GLY 24 25 25 GLY GLY A . n A 1 25 ILE 25 26 26 ILE ILE A . n A 1 26 CYS 26 27 27 CYS CYS A . n A 1 27 CYS 27 28 28 CYS CYS A . n A 1 28 THR 28 29 29 THR THR A . n A 1 29 SER 29 30 30 SER SER A . n A 1 30 GLU 30 31 31 GLU GLU A . n A 1 31 VAL 31 32 32 VAL VAL A . n A 1 32 PRO 32 33 33 PRO PRO A . n A 1 33 ILE 33 34 34 ILE ILE A . n A 1 34 ILE 34 35 35 ILE ILE A . n A 1 35 GLU 35 36 36 GLU GLU A . n A 1 36 ASN 36 37 37 ASN ASN A . n A 1 37 ILE 37 38 38 ILE ILE A . n A 1 38 LEU 38 39 39 LEU LEU A . n A 1 39 LYS 39 40 40 LYS LYS A . n A 1 40 SER 40 41 41 SER SER A . n A 1 41 LEU 41 42 42 LEU LEU A . n A 1 42 ASP 42 43 43 ASP ASP A . n A 1 43 GLY 43 44 44 GLY GLY A . n A 1 44 VAL 44 45 45 VAL VAL A . n A 1 45 LYS 45 46 46 LYS LYS A . n A 1 46 GLU 46 47 47 GLU GLU A . n A 1 47 TYR 47 48 48 TYR TYR A . n A 1 48 SER 48 49 49 SER SER A . n A 1 49 VAL 49 50 50 VAL VAL A . n A 1 50 ILE 50 51 51 ILE ILE A . n A 1 51 VAL 51 52 52 VAL VAL A . n A 1 52 PRO 52 53 53 PRO PRO A . n A 1 53 SER 53 54 54 SER SER A . n A 1 54 ARG 54 55 55 ARG ARG A . n A 1 55 THR 55 56 56 THR THR A . n A 1 56 VAL 56 57 57 VAL VAL A . n A 1 57 ILE 57 58 58 ILE ILE A . n A 1 58 VAL 58 59 59 VAL VAL A . n A 1 59 VAL 59 60 60 VAL VAL A . n A 1 60 HIS 60 61 61 HIS HIS A . n A 1 61 ASP 61 62 62 ASP ASP A . n A 1 62 SER 62 63 63 SER SER A . n A 1 63 LEU 63 64 64 LEU LEU A . n A 1 64 LEU 64 65 65 LEU LEU A . n A 1 65 ILE 65 66 66 ILE ILE A . n A 1 66 SER 66 67 67 SER SER A . n A 1 67 PRO 67 68 68 PRO PRO A . n A 1 68 PHE 68 69 69 PHE PHE A . n A 1 69 GLN 69 70 70 GLN GLN A . n A 1 70 ILE 70 71 71 ILE ILE A . n A 1 71 ALA 71 72 72 ALA ALA A . n A 1 72 LYS 72 73 73 LYS LYS A . n A 1 73 ALA 73 74 74 ALA ALA A . n A 1 74 LEU 74 75 75 LEU LEU A . n A 1 75 ASN 75 76 76 ASN ASN A . n A 1 76 GLU 76 77 77 GLU GLU A . n A 1 77 ALA 77 78 78 ALA ALA A . n A 1 78 ARG 78 79 79 ARG ARG A . n A 1 79 LEU 79 80 80 LEU LEU A . n A 1 80 GLU 80 81 81 GLU GLU A . n A 1 81 ALA 81 82 82 ALA ALA A . n A 1 82 ASN 82 83 83 ASN ASN A . n A 1 83 VAL 83 84 84 VAL VAL A . n A 1 84 ARG 84 85 85 ARG ARG A . n A 1 85 VAL 85 86 86 VAL VAL A . n A 1 86 ASN 86 87 87 ASN ASN A . n A 1 87 GLY 87 88 88 GLY GLY A . n A 1 88 GLU 88 89 89 GLU GLU A . n A 1 89 THR 89 90 90 THR THR A . n A 1 90 SER 90 91 91 SER SER A . n A 1 91 PHE 91 92 92 PHE PHE A . n A 1 92 LYS 92 93 93 LYS LYS A . n A 1 93 ASN 93 94 94 ASN ASN A . n A 1 94 LYS 94 95 95 LYS LYS A . n A 1 95 TRP 95 96 96 TRP TRP A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 201 ZN ZN A . C 3 HOH 1 301 301 HOH HOH A . # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details 'Solution structure of the N-terminal zinc binding domain of the P1B-type ATPase HMA4 from Arabidopsis thaliana' _exptl.entry_id 2KKH _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2KKH _struct.title 'Structure of the zinc binding domain of the ATPase HMA4' _struct.pdbx_model_details 'closest to the average, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2KKH _struct_keywords.pdbx_keywords 'METAL TRANSPORT' _struct_keywords.text ;Zinc transport, metal binding, metal selectivity, Arabidopsis thaliana, ferredoxin fold, ATP-binding, Hydrolase, Nucleotide-binding, Phosphoprotein, Transmembrane, METAL TRANSPORT ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8RVG7_ARATH _struct_ref.pdbx_db_accession Q8RVG7 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ALQNKEEEKKKVKKLQKSYFDVLGICCTSEVPIIENILKSLDGVKEYSVIVPSRTVIVVHDSLLISPFQIAKALNEARLE ANVRVNGETSFKNKW ; _struct_ref.pdbx_align_begin 2 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2KKH _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 95 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8RVG7 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 96 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 96 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 4 ? GLU A 8 ? ASN A 5 GLU A 9 5 ? 5 HELX_P HELX_P2 2 GLU A 30 ? LEU A 41 ? GLU A 31 LEU A 42 1 ? 12 HELX_P HELX_P3 3 SER A 66 ? ARG A 78 ? SER A 67 ARG A 79 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 26 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 27 A ZN 201 1_555 ? ? ? ? ? ? ? 2.298 ? ? metalc2 metalc ? ? A CYS 27 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 28 A ZN 201 1_555 ? ? ? ? ? ? ? 2.301 ? ? metalc3 metalc ? ? A GLU 30 OE2 ? ? ? 1_555 B ZN . ZN ? ? A GLU 31 A ZN 201 1_555 ? ? ? ? ? ? ? 1.970 ? ? metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 C HOH . O ? ? A ZN 201 A HOH 301 1_555 ? ? ? ? ? ? ? 2.196 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 26 ? A CYS 27 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 27 ? A CYS 28 ? 1_555 109.7 ? 2 SG ? A CYS 26 ? A CYS 27 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 OE2 ? A GLU 30 ? A GLU 31 ? 1_555 109.4 ? 3 SG ? A CYS 27 ? A CYS 28 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 OE2 ? A GLU 30 ? A GLU 31 ? 1_555 109.5 ? 4 SG ? A CYS 26 ? A CYS 27 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 O ? C HOH . ? A HOH 301 ? 1_555 109.2 ? 5 SG ? A CYS 27 ? A CYS 28 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 O ? C HOH . ? A HOH 301 ? 1_555 109.5 ? 6 OE2 ? A GLU 30 ? A GLU 31 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 O ? C HOH . ? A HOH 301 ? 1_555 109.6 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 44 ? ILE A 50 ? VAL A 45 ILE A 51 A 2 THR A 55 ? HIS A 60 ? THR A 56 HIS A 61 A 3 GLN A 16 ? VAL A 22 ? GLN A 17 VAL A 23 A 4 ALA A 81 ? VAL A 83 ? ALA A 82 VAL A 84 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LYS A 45 ? N LYS A 46 O VAL A 59 ? O VAL A 60 A 2 3 O HIS A 60 ? O HIS A 61 N GLN A 16 ? N GLN A 17 A 3 4 N ASP A 21 ? N ASP A 22 O ASN A 82 ? O ASN A 83 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 26 ? CYS A 27 . ? 1_555 ? 2 AC1 4 CYS A 27 ? CYS A 28 . ? 1_555 ? 3 AC1 4 GLU A 30 ? GLU A 31 . ? 1_555 ? 4 AC1 4 HOH C . ? HOH A 301 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 3 ? ? 58.08 169.10 2 1 LYS A 6 ? ? -55.47 -9.79 3 1 LYS A 14 ? ? -177.93 70.41 4 1 LEU A 16 ? ? 59.29 -172.30 5 1 CYS A 28 ? ? 44.92 -171.69 6 1 GLU A 81 ? ? 54.87 105.35 7 1 ARG A 85 ? ? 38.64 91.47 8 1 GLU A 89 ? ? -160.39 -13.95 9 1 THR A 90 ? ? 43.47 79.61 10 1 LYS A 93 ? ? -156.02 -21.40 11 2 LYS A 12 ? ? 56.44 108.27 12 2 LYS A 14 ? ? -92.58 -73.19 13 2 LYS A 15 ? ? 51.57 -83.65 14 2 CYS A 28 ? ? 39.77 -156.89 15 2 GLU A 89 ? ? 54.57 172.56 16 2 SER A 91 ? ? -171.43 90.94 17 2 LYS A 93 ? ? -86.67 -91.42 18 3 LEU A 3 ? ? 55.06 6.02 19 3 GLN A 4 ? ? -133.20 -85.02 20 3 LYS A 10 ? ? 54.64 172.30 21 3 LYS A 12 ? ? 53.39 -80.62 22 3 LYS A 15 ? ? -52.16 -71.34 23 3 LEU A 16 ? ? 43.20 -168.42 24 3 CYS A 28 ? ? 40.56 -163.54 25 3 GLU A 81 ? ? 46.97 100.19 26 3 ARG A 85 ? ? 36.43 -90.00 27 3 PHE A 92 ? ? 54.06 -81.28 28 4 LYS A 15 ? ? -56.70 -159.02 29 4 CYS A 28 ? ? 36.59 -155.69 30 4 ARG A 55 ? ? 43.88 27.74 31 4 ALA A 78 ? ? -80.55 38.31 32 4 ARG A 79 ? ? 50.35 18.21 33 4 GLU A 89 ? ? 58.46 146.07 34 4 THR A 90 ? ? -157.67 -135.94 35 4 SER A 91 ? ? 54.75 -170.90 36 4 PHE A 92 ? ? 55.43 115.54 37 4 ASN A 94 ? ? 43.12 -167.52 38 5 LYS A 12 ? ? 58.35 147.99 39 5 LEU A 16 ? ? -68.52 -157.61 40 5 CYS A 28 ? ? 39.36 -160.95 41 5 ALA A 78 ? ? -85.74 34.52 42 5 ARG A 85 ? ? 56.32 155.91 43 6 LYS A 15 ? ? -172.36 146.18 44 6 LEU A 16 ? ? 51.85 -171.81 45 6 CYS A 28 ? ? 43.67 -167.53 46 6 GLU A 81 ? ? 55.85 107.81 47 6 PHE A 92 ? ? 40.57 -164.59 48 7 LYS A 6 ? ? 54.33 7.34 49 7 LYS A 14 ? ? 57.15 115.75 50 7 LYS A 15 ? ? 52.66 170.04 51 7 LEU A 16 ? ? 53.42 167.36 52 7 CYS A 28 ? ? 40.13 -164.07 53 7 ALA A 78 ? ? -78.14 22.03 54 7 ARG A 85 ? ? 39.89 87.11 55 7 ASN A 87 ? ? -150.53 78.95 56 7 LYS A 93 ? ? -77.68 -74.91 57 7 ASN A 94 ? ? 55.95 91.04 58 8 LEU A 3 ? ? 39.48 71.08 59 8 GLN A 4 ? ? -172.91 80.93 60 8 ASN A 5 ? ? -142.64 -3.76 61 8 LYS A 10 ? ? 38.77 -161.20 62 8 LYS A 12 ? ? 56.62 105.74 63 8 LYS A 14 ? ? -152.13 -81.75 64 8 LYS A 15 ? ? -146.62 16.01 65 8 CYS A 28 ? ? 39.72 -158.33 66 8 ARG A 55 ? ? 34.40 41.63 67 8 ARG A 79 ? ? 71.00 46.43 68 8 ARG A 85 ? ? -39.69 119.20 69 8 ASN A 94 ? ? -170.76 92.40 70 9 ASN A 5 ? ? -45.24 -86.55 71 9 LYS A 6 ? ? 55.08 9.40 72 9 LYS A 10 ? ? -87.89 48.70 73 9 LYS A 12 ? ? 58.59 122.86 74 9 LYS A 14 ? ? 56.60 75.25 75 9 LEU A 16 ? ? 59.16 -172.27 76 9 CYS A 28 ? ? 41.91 -168.74 77 9 GLU A 81 ? ? 42.53 94.29 78 9 ARG A 85 ? ? 57.56 133.26 79 9 GLU A 89 ? ? -164.95 113.54 80 9 LYS A 93 ? ? -85.48 -78.54 81 10 GLN A 4 ? ? 49.84 86.59 82 10 LYS A 14 ? ? 53.57 167.93 83 10 CYS A 28 ? ? 38.99 -139.75 84 10 ASP A 43 ? ? -143.95 -53.88 85 10 GLU A 81 ? ? 56.78 123.93 86 10 ARG A 85 ? ? -32.31 105.52 87 10 THR A 90 ? ? -65.02 -71.24 88 10 SER A 91 ? ? 51.38 86.95 89 11 LEU A 3 ? ? 42.97 89.00 90 11 LYS A 12 ? ? 53.57 15.20 91 11 LYS A 14 ? ? -87.23 -83.91 92 11 LEU A 16 ? ? 40.40 -158.35 93 11 CYS A 28 ? ? 43.78 -169.91 94 11 ARG A 79 ? ? 70.88 33.02 95 11 LEU A 80 ? ? -105.37 -168.80 96 11 ARG A 85 ? ? 39.31 92.99 97 11 LYS A 93 ? ? -167.42 -165.12 98 12 LEU A 3 ? ? 56.01 -75.83 99 12 GLN A 4 ? ? 53.11 97.84 100 12 ASN A 5 ? ? -68.09 90.93 101 12 LYS A 12 ? ? 45.28 98.94 102 12 LYS A 15 ? ? 39.89 -131.76 103 12 LEU A 16 ? ? 53.76 167.75 104 12 CYS A 28 ? ? 58.65 165.53 105 12 GLU A 81 ? ? 49.86 101.95 106 12 GLU A 89 ? ? 56.98 107.90 107 12 LYS A 93 ? ? -161.55 22.61 108 13 LYS A 6 ? ? -52.21 -9.04 109 13 LEU A 16 ? ? -93.22 -137.40 110 13 CYS A 28 ? ? 39.98 -163.54 111 13 ALA A 78 ? ? -77.28 30.71 112 13 ARG A 85 ? ? 57.56 133.74 113 13 SER A 91 ? ? 60.51 146.84 114 13 LYS A 93 ? ? 52.88 86.63 115 14 LYS A 6 ? ? 51.95 9.17 116 14 LYS A 12 ? ? 77.49 -153.05 117 14 LYS A 15 ? ? -96.87 -110.13 118 14 LEU A 16 ? ? 53.36 -168.31 119 14 CYS A 28 ? ? 40.66 -164.99 120 14 ALA A 78 ? ? -74.07 35.10 121 14 ARG A 85 ? ? 56.53 155.87 122 14 GLU A 89 ? ? -78.96 -169.07 123 14 SER A 91 ? ? -150.30 -149.90 124 14 PHE A 92 ? ? 54.31 103.07 125 15 GLN A 4 ? ? 42.69 -93.48 126 15 ASN A 5 ? ? -161.55 83.52 127 15 LYS A 15 ? ? -142.26 -99.68 128 15 LEU A 16 ? ? 45.74 -172.66 129 15 CYS A 28 ? ? 40.47 -164.67 130 15 ALA A 78 ? ? -83.27 31.65 131 15 ARG A 85 ? ? 57.84 141.03 132 15 ASN A 87 ? ? -65.42 -93.56 133 15 SER A 91 ? ? -83.76 -116.40 134 15 ASN A 94 ? ? 50.73 176.66 135 15 LYS A 95 ? ? 47.08 -175.90 136 16 ASN A 5 ? ? -140.59 14.26 137 16 LYS A 10 ? ? 60.71 80.45 138 16 LYS A 12 ? ? 57.62 89.92 139 16 LYS A 14 ? ? -107.40 43.24 140 16 LYS A 15 ? ? -103.41 71.45 141 16 CYS A 28 ? ? 39.93 -162.65 142 16 GLU A 81 ? ? 59.47 114.37 143 16 ARG A 85 ? ? 40.09 95.95 144 17 LYS A 10 ? ? 57.81 119.84 145 17 LYS A 12 ? ? 59.20 104.67 146 17 LYS A 14 ? ? -107.11 62.73 147 17 LEU A 16 ? ? 54.54 175.67 148 17 CYS A 28 ? ? 37.24 -143.46 149 17 ARG A 55 ? ? 33.83 41.90 150 17 ALA A 78 ? ? -82.70 42.07 151 17 ARG A 79 ? ? 41.68 23.60 152 17 LEU A 80 ? ? -88.68 -138.56 153 17 GLU A 81 ? ? -174.27 101.25 154 17 ARG A 85 ? ? -39.51 155.93 155 17 LYS A 93 ? ? 55.95 100.62 156 17 LYS A 95 ? ? 43.32 -168.12 157 18 LEU A 3 ? ? 53.48 169.56 158 18 LYS A 6 ? ? 56.17 8.89 159 18 LYS A 15 ? ? -70.39 -145.61 160 18 LEU A 16 ? ? 54.97 111.89 161 18 CYS A 28 ? ? 34.69 -151.66 162 18 ARG A 55 ? ? 42.87 23.67 163 18 ALA A 78 ? ? -85.97 33.87 164 18 ARG A 79 ? ? 55.12 18.64 165 18 GLU A 81 ? ? -65.58 90.61 166 18 ARG A 85 ? ? 39.39 88.05 167 18 THR A 90 ? ? 53.36 164.99 168 19 LYS A 10 ? ? 56.39 113.84 169 19 LYS A 14 ? ? 40.49 -90.34 170 19 LYS A 15 ? ? -150.36 28.72 171 19 CYS A 28 ? ? 45.40 -164.65 172 19 ARG A 55 ? ? 32.04 35.76 173 19 ALA A 78 ? ? -81.23 33.30 174 19 ARG A 79 ? ? 54.90 16.65 175 19 ARG A 85 ? ? -38.88 138.10 176 19 GLU A 89 ? ? -170.51 129.46 177 19 SER A 91 ? ? 42.86 95.58 178 19 PHE A 92 ? ? -156.32 -30.19 179 20 ASN A 5 ? ? -89.49 -106.55 180 20 LYS A 6 ? ? 70.20 -42.71 181 20 LEU A 16 ? ? 58.20 142.78 182 20 CYS A 28 ? ? 41.04 -168.06 183 20 GLU A 81 ? ? 44.65 97.90 184 20 THR A 90 ? ? 48.32 99.91 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.conformers_calculated_total_number 256 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2KKH _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_ensemble_rms.atom_type ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.chain_range_begin ? _pdbx_nmr_ensemble_rms.chain_range_end ? _pdbx_nmr_ensemble_rms.coord_average_rmsd_method ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error ? _pdbx_nmr_ensemble_rms.distance_rms_dev 0.016 _pdbx_nmr_ensemble_rms.distance_rms_dev_error 0.001 _pdbx_nmr_ensemble_rms.entry_id 2KKH _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev ? _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error ? _pdbx_nmr_ensemble_rms.residue_range_begin ? _pdbx_nmr_ensemble_rms.residue_range_end ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2KKH _pdbx_nmr_representative.selection_criteria 'closest to the average' # _pdbx_nmr_sample_details.contents '0.5 mM [U-99% 13C; U-99% 15N] protein-1, 50 mM potassium phosphate-2, 0.02 % sodium azide-3, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id protein-1 0.5 ? mM '[U-99% 13C; U-99% 15N]' 1 'potassium phosphate-2' 50 ? mM ? 1 'sodium azide-3' 0.02 ? % ? 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 50 _pdbx_nmr_exptl_sample_conditions.pH 7.3 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D HNCA' 1 3 1 '3D HNCACB' 1 4 1 '3D HCCH-TOCSY' 1 5 1 '3D HN(CO)CA' 1 6 1 '3D 1H-13C NOESY' 1 7 1 '3D 1H-15N NOESY' 1 8 1 '3D C(CO)NH' # _pdbx_nmr_details.entry_id 2KKH _pdbx_nmr_details.text 'Heteronuclear spectra were recorded on spectrometers equipped with cryogenically cooled probes.' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2KKH _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count 30 _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1683 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 811 _pdbx_nmr_constraints.NOE_long_range_total_count 377 _pdbx_nmr_constraints.NOE_medium_range_total_count 212 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 283 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 57 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 58 # _pdbx_nmr_refine.entry_id 2KKH _pdbx_nmr_refine.method 'DGSA-distance geometry simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Bruker AG' collection TopSpin 2.0 1 'Bruker AG' processing TopSpin 2.0 2 'Bartels et al.' 'chemical shift assignment' XEASY 3.13 3 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 4 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' 22 5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 PHE N N N N 230 PHE CA C N S 231 PHE C C N N 232 PHE O O N N 233 PHE CB C N N 234 PHE CG C Y N 235 PHE CD1 C Y N 236 PHE CD2 C Y N 237 PHE CE1 C Y N 238 PHE CE2 C Y N 239 PHE CZ C Y N 240 PHE OXT O N N 241 PHE H H N N 242 PHE H2 H N N 243 PHE HA H N N 244 PHE HB2 H N N 245 PHE HB3 H N N 246 PHE HD1 H N N 247 PHE HD2 H N N 248 PHE HE1 H N N 249 PHE HE2 H N N 250 PHE HZ H N N 251 PHE HXT H N N 252 PRO N N N N 253 PRO CA C N S 254 PRO C C N N 255 PRO O O N N 256 PRO CB C N N 257 PRO CG C N N 258 PRO CD C N N 259 PRO OXT O N N 260 PRO H H N N 261 PRO HA H N N 262 PRO HB2 H N N 263 PRO HB3 H N N 264 PRO HG2 H N N 265 PRO HG3 H N N 266 PRO HD2 H N N 267 PRO HD3 H N N 268 PRO HXT H N N 269 SER N N N N 270 SER CA C N S 271 SER C C N N 272 SER O O N N 273 SER CB C N N 274 SER OG O N N 275 SER OXT O N N 276 SER H H N N 277 SER H2 H N N 278 SER HA H N N 279 SER HB2 H N N 280 SER HB3 H N N 281 SER HG H N N 282 SER HXT H N N 283 THR N N N N 284 THR CA C N S 285 THR C C N N 286 THR O O N N 287 THR CB C N R 288 THR OG1 O N N 289 THR CG2 C N N 290 THR OXT O N N 291 THR H H N N 292 THR H2 H N N 293 THR HA H N N 294 THR HB H N N 295 THR HG1 H N N 296 THR HG21 H N N 297 THR HG22 H N N 298 THR HG23 H N N 299 THR HXT H N N 300 TRP N N N N 301 TRP CA C N S 302 TRP C C N N 303 TRP O O N N 304 TRP CB C N N 305 TRP CG C Y N 306 TRP CD1 C Y N 307 TRP CD2 C Y N 308 TRP NE1 N Y N 309 TRP CE2 C Y N 310 TRP CE3 C Y N 311 TRP CZ2 C Y N 312 TRP CZ3 C Y N 313 TRP CH2 C Y N 314 TRP OXT O N N 315 TRP H H N N 316 TRP H2 H N N 317 TRP HA H N N 318 TRP HB2 H N N 319 TRP HB3 H N N 320 TRP HD1 H N N 321 TRP HE1 H N N 322 TRP HE3 H N N 323 TRP HZ2 H N N 324 TRP HZ3 H N N 325 TRP HH2 H N N 326 TRP HXT H N N 327 TYR N N N N 328 TYR CA C N S 329 TYR C C N N 330 TYR O O N N 331 TYR CB C N N 332 TYR CG C Y N 333 TYR CD1 C Y N 334 TYR CD2 C Y N 335 TYR CE1 C Y N 336 TYR CE2 C Y N 337 TYR CZ C Y N 338 TYR OH O N N 339 TYR OXT O N N 340 TYR H H N N 341 TYR H2 H N N 342 TYR HA H N N 343 TYR HB2 H N N 344 TYR HB3 H N N 345 TYR HD1 H N N 346 TYR HD2 H N N 347 TYR HE1 H N N 348 TYR HE2 H N N 349 TYR HH H N N 350 TYR HXT H N N 351 VAL N N N N 352 VAL CA C N S 353 VAL C C N N 354 VAL O O N N 355 VAL CB C N N 356 VAL CG1 C N N 357 VAL CG2 C N N 358 VAL OXT O N N 359 VAL H H N N 360 VAL H2 H N N 361 VAL HA H N N 362 VAL HB H N N 363 VAL HG11 H N N 364 VAL HG12 H N N 365 VAL HG13 H N N 366 VAL HG21 H N N 367 VAL HG22 H N N 368 VAL HG23 H N N 369 VAL HXT H N N 370 ZN ZN ZN N N 371 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 PHE N CA sing N N 218 PHE N H sing N N 219 PHE N H2 sing N N 220 PHE CA C sing N N 221 PHE CA CB sing N N 222 PHE CA HA sing N N 223 PHE C O doub N N 224 PHE C OXT sing N N 225 PHE CB CG sing N N 226 PHE CB HB2 sing N N 227 PHE CB HB3 sing N N 228 PHE CG CD1 doub Y N 229 PHE CG CD2 sing Y N 230 PHE CD1 CE1 sing Y N 231 PHE CD1 HD1 sing N N 232 PHE CD2 CE2 doub Y N 233 PHE CD2 HD2 sing N N 234 PHE CE1 CZ doub Y N 235 PHE CE1 HE1 sing N N 236 PHE CE2 CZ sing Y N 237 PHE CE2 HE2 sing N N 238 PHE CZ HZ sing N N 239 PHE OXT HXT sing N N 240 PRO N CA sing N N 241 PRO N CD sing N N 242 PRO N H sing N N 243 PRO CA C sing N N 244 PRO CA CB sing N N 245 PRO CA HA sing N N 246 PRO C O doub N N 247 PRO C OXT sing N N 248 PRO CB CG sing N N 249 PRO CB HB2 sing N N 250 PRO CB HB3 sing N N 251 PRO CG CD sing N N 252 PRO CG HG2 sing N N 253 PRO CG HG3 sing N N 254 PRO CD HD2 sing N N 255 PRO CD HD3 sing N N 256 PRO OXT HXT sing N N 257 SER N CA sing N N 258 SER N H sing N N 259 SER N H2 sing N N 260 SER CA C sing N N 261 SER CA CB sing N N 262 SER CA HA sing N N 263 SER C O doub N N 264 SER C OXT sing N N 265 SER CB OG sing N N 266 SER CB HB2 sing N N 267 SER CB HB3 sing N N 268 SER OG HG sing N N 269 SER OXT HXT sing N N 270 THR N CA sing N N 271 THR N H sing N N 272 THR N H2 sing N N 273 THR CA C sing N N 274 THR CA CB sing N N 275 THR CA HA sing N N 276 THR C O doub N N 277 THR C OXT sing N N 278 THR CB OG1 sing N N 279 THR CB CG2 sing N N 280 THR CB HB sing N N 281 THR OG1 HG1 sing N N 282 THR CG2 HG21 sing N N 283 THR CG2 HG22 sing N N 284 THR CG2 HG23 sing N N 285 THR OXT HXT sing N N 286 TRP N CA sing N N 287 TRP N H sing N N 288 TRP N H2 sing N N 289 TRP CA C sing N N 290 TRP CA CB sing N N 291 TRP CA HA sing N N 292 TRP C O doub N N 293 TRP C OXT sing N N 294 TRP CB CG sing N N 295 TRP CB HB2 sing N N 296 TRP CB HB3 sing N N 297 TRP CG CD1 doub Y N 298 TRP CG CD2 sing Y N 299 TRP CD1 NE1 sing Y N 300 TRP CD1 HD1 sing N N 301 TRP CD2 CE2 doub Y N 302 TRP CD2 CE3 sing Y N 303 TRP NE1 CE2 sing Y N 304 TRP NE1 HE1 sing N N 305 TRP CE2 CZ2 sing Y N 306 TRP CE3 CZ3 doub Y N 307 TRP CE3 HE3 sing N N 308 TRP CZ2 CH2 doub Y N 309 TRP CZ2 HZ2 sing N N 310 TRP CZ3 CH2 sing Y N 311 TRP CZ3 HZ3 sing N N 312 TRP CH2 HH2 sing N N 313 TRP OXT HXT sing N N 314 TYR N CA sing N N 315 TYR N H sing N N 316 TYR N H2 sing N N 317 TYR CA C sing N N 318 TYR CA CB sing N N 319 TYR CA HA sing N N 320 TYR C O doub N N 321 TYR C OXT sing N N 322 TYR CB CG sing N N 323 TYR CB HB2 sing N N 324 TYR CB HB3 sing N N 325 TYR CG CD1 doub Y N 326 TYR CG CD2 sing Y N 327 TYR CD1 CE1 sing Y N 328 TYR CD1 HD1 sing N N 329 TYR CD2 CE2 doub Y N 330 TYR CD2 HD2 sing N N 331 TYR CE1 CZ doub Y N 332 TYR CE1 HE1 sing N N 333 TYR CE2 CZ sing Y N 334 TYR CE2 HE2 sing N N 335 TYR CZ OH sing N N 336 TYR OH HH sing N N 337 TYR OXT HXT sing N N 338 VAL N CA sing N N 339 VAL N H sing N N 340 VAL N H2 sing N N 341 VAL CA C sing N N 342 VAL CA CB sing N N 343 VAL CA HA sing N N 344 VAL C O doub N N 345 VAL C OXT sing N N 346 VAL CB CG1 sing N N 347 VAL CB CG2 sing N N 348 VAL CB HB sing N N 349 VAL CG1 HG11 sing N N 350 VAL CG1 HG12 sing N N 351 VAL CG1 HG13 sing N N 352 VAL CG2 HG21 sing N N 353 VAL CG2 HG22 sing N N 354 VAL CG2 HG23 sing N N 355 VAL OXT HXT sing N N 356 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Bruker AVANCE 1 'Bruker Avance' 600 Bruker DRX 2 'Bruker DRX' 800 Bruker AVANCE 3 'Bruker Avance' # _atom_sites.entry_id 2KKH _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_